Calcium/calmodulin-dependent protein kinase kinase 1

Overview
NameCalcium/calmodulin-dependent protein kinase kinase 1
Smed IDSMED30016333
Length (bp)2248
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium/calmodulin-dependent protein kinase kinase 1 (SMED30016333) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase kinase 1 (SMED30016333) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium/calmodulin-dependent protein kinase kinase 1 (SMED30016333) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase kinase 1 (SMED30016333) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016333

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016333SMESG000070678.1 SmedASXL_014777SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016333SMESG000070678.1 dd_Smed_v6_18437_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30016333SMESG000070678.1 Contig14828newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016333SMESG000070678.1 Contig14828uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Match: CAMKK1 (calcium/calmodulin dependent protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:1469])

HSP 1 Score: 236.498 bits (602), Expect = 6.714e-75
Identity = 131/302 (43.38%), Postives = 182/302 (60.26%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P SEE  R Y RD++ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  +P++ P+
Sbjct:  118 DAEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQAAQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPE 374          

HSP 2 Score: 66.6254 bits (161), Expect = 6.714e-75
Identity = 36/87 (41.38%), Postives = 50/87 (57.47%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS E+KDL+ KML+K PE RI + DIK HPWVT+NG    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  377 EISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP-SWTTVILVKSMLRKRSFGNP 462          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Match: CAMKK1 (calcium/calmodulin dependent protein kinase kinase 1 [Source:HGNC Symbol;Acc:HGNC:1469])

HSP 1 Score: 235.728 bits (600), Expect = 9.124e-75
Identity = 131/302 (43.38%), Postives = 182/302 (60.26%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P SEE  R Y RD++ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  +P++ P+
Sbjct:  145 DAEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQAAQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPE 401          

HSP 2 Score: 66.6254 bits (161), Expect = 9.124e-75
Identity = 36/87 (41.38%), Postives = 50/87 (57.47%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS E+KDL+ KML+K PE RI + DIK HPWVT+NG    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  404 EISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP-SWTTVILVKSMLRKRSFGNP 489          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Match: CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:1470])

HSP 1 Score: 226.483 bits (576), Expect = 5.045e-70
Identity = 123/312 (39.42%), Postives = 188/312 (60.26%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            T ES  +S T  ++  VQ+NQY +  ++G+G+YG VKL  + ++N  YA+K++SK+KL++ +G+ RRPPP         C         Q   P                                     + ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  145 TVESHHVSITGMQD-CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGC--------IQPRGP-------------------------------------IEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.077 bits (144), Expect = 5.045e-70
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Match: CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:1470])

HSP 1 Score: 226.483 bits (576), Expect = 5.480e-70
Identity = 123/312 (39.42%), Postives = 188/312 (60.26%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            T ES  +S T  ++  VQ+NQY +  ++G+G+YG VKL  + ++N  YA+K++SK+KL++ +G+ RRPPP         C         Q   P                                     + ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  145 TVESHHVSITGMQD-CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGC--------IQPRGP-------------------------------------IEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.077 bits (144), Expect = 5.480e-70
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Match: CAMKK2 (calcium/calmodulin dependent protein kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:1470])

HSP 1 Score: 226.483 bits (576), Expect = 5.615e-70
Identity = 123/312 (39.42%), Postives = 188/312 (60.26%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            T ES  +S T  ++  VQ+NQY +  ++G+G+YG VKL  + ++N  YA+K++SK+KL++ +G+ RRPPP         C         Q   P                                     + ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  145 TVESHHVSITGMQD-CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGC--------IQPRGP-------------------------------------IEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.077 bits (144), Expect = 5.615e-70
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Match: ckk-1 (Calcium/calmodulin-dependent protein kinase kinase [Source:UniProtKB/Swiss-Prot;Acc:Q3Y416])

HSP 1 Score: 233.032 bits (593), Expect = 9.162e-69
Identity = 120/302 (39.74%), Postives = 176/302 (58.28%), Query Frame = 3
Query:  456 EGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKF-TGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            E  +Q+NQY+++ ++G+G+YG VKL   + D+NLYALK++ K KL+K+   FR+PPP RN   ++               PS                                  +PL+ + +E+AI KKL +P++VKL EV+D+ + + +YM+FE +E G ++ +    PL E+    YFRD +CGL+YLH+ KIVHRDIKPSNLL+   G VK+ DFGVS +F G D FL  T G+PAF+APE + +    F +G+A DIW+LG+TL+ F+ G V F     I L+  I   PI+ P+ 
Sbjct:   13 ESYIQLNQYRLMEEIGQGSYGIVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRRNKENAA---------------PS-------------------------------VLRNPLQLVQKEIAILKKLSHPNVVKLVEVLDDPNDNYLYMVFEFVEKGSILEIPTDKPLDEDTAWSYFRDTLCGLEYLHYQKIVHRDIKPSNLLLSDIGQVKIADFGVSCEFEGIDAFLSGTAGTPAFMAPEALTEGANHFYSGRAQDIWSLGITLYAFVIGTVPFVDNYIIALHKKIKNDPIVFPEA 268          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Match: ckk-1 (Calcium/calmodulin-dependent protein kinase kinase [Source:UniProtKB/Swiss-Prot;Acc:Q3Y416])

HSP 1 Score: 235.728 bits (600), Expect = 1.314e-68
Identity = 128/333 (38.44%), Postives = 190/333 (57.06%), Query Frame = 3
Query:  369 AVLSPRMN--FRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKF-TGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            A +SP ++   R  KS+S + S         E  +Q+NQY+++ ++G+G+YG VKL   + D+NLYALK++ K KL+K+   FR+PPP RN                ++ +PS                                  +PL+ + +E+AI KKL +P++VKL EV+D+ + + +YM+FE +E G ++ +    PL E+    YFRD +CGL+YLH+ KIVHRDIKPSNLL+   G VK+ DFGVS +F G D FL  T G+PAF+APE + +    F +G+A DIW+LG+TL+ F+ G V F     I L+  I   PI+ P+ 
Sbjct:  100 ATMSPNLSRPTRYVKSVSQQRS---------ESYIQLNQYRLMEEIGQGSYGIVKLAYNEEDKNLYALKVLDKMKLLKNFACFRQPPPRRNK---------------ENAAPS-------------------------------VLRNPLQLVQKEIAILKKLSHPNVVKLVEVLDDPNDNYLYMVFEFVEKGSILEIPTDKPLDEDTAWSYFRDTLCGLEYLHYQKIVHRDIKPSNLLLSDIGQVKIADFGVSCEFEGIDAFLSGTAGTPAFMAPEALTEGANHFYSGRAQDIWSLGITLYAFVIGTVPFVDNYIIALHKKIKNDPIVFPEA 377          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 118.627 bits (296), Expect = 4.528e-30
Identity = 61/185 (32.97%), Postives = 108/185 (58.38%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN--VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGV-SFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            L+++ +E+AI K +++PH++ L++V +   +  +Y++ EH+ GG + +  V     +S+E  RK+FR I+  LD+ H + I HRD+KP NLL+D+   +K+ DFG+ S Q  G    L+ + GSP +  PE ++    K+ G+  D+W+ G+ L+  L G + FD  N  +L   +      +P 
Sbjct:   88 LQKVEREIAIMKLIEHPHVLHLYDVYENKKY--LYLLLEHVSGGELFDYLVRKGRLMSKE-ARKFFRQIISALDFCHAHNICHRDLKPENLLLDERNNIKVADFGMASLQVEGS--MLETSCGSPHYACPEVIRG--EKYDGRKADVWSCGVILYALLVGALPFDDDNLRNLLEKVKRGVFHIPH 265          

HSP 2 Score: 33.113 bits (74), Expect = 4.528e-30
Identity = 12/33 (36.36%), Postives = 22/33 (66.67%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVT 1455
            + ++V+ LL  M+   P +R +L D+ +HPWV+
Sbjct:  267 VPADVQSLLRAMIEVDPGKRYSLADVFKHPWVS 299          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Match: sad-1 (Serine/threonine kinase SAD-1 [Source:UniProtKB/Swiss-Prot;Acc:Q19469])

HSP 1 Score: 118.242 bits (295), Expect = 6.846e-30
Identity = 60/176 (34.09%), Postives = 106/176 (60.23%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN--VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGV-SFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            L+++ +E+AI K +++PH++ L++V +   +  +Y++ EH+ GG + +  V     +S+E  RK+FR I+  LD+ H + I HRD+KP NLL+D+   +K+ DFG+ S Q  G    L+ + GSP +  PE ++    K+ G+  D+W+ G+ L+  L G + FD  N  +L   +
Sbjct:   88 LQKVEREIAIMKLIEHPHVLHLYDVYENKKY--LYLLLEHVSGGELFDYLVRKGRLMSKE-ARKFFRQIISALDFCHAHNICHRDLKPENLLLDERNNIKVADFGMASLQVEGS--MLETSCGSPHYACPEVIRG--EKYDGRKADVWSCGVILYALLVGALPFDDDNLRNLLEKV 256          

HSP 2 Score: 32.7278 bits (73), Expect = 6.846e-30
Identity = 12/33 (36.36%), Postives = 22/33 (66.67%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVT 1455
            + ++V+ LL  M+   P +R +L D+ +HPWV+
Sbjct:  267 VPADVQSLLRAMIEVDPGKRYSLADVFKHPWVS 299          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Match: aak-2 (5'-AMP-activated protein kinase catalytic subunit alpha-2 [Source:UniProtKB/Swiss-Prot;Acc:Q95ZQ4])

HSP 1 Score: 117.857 bits (294), Expect = 2.695e-27
Identity = 63/180 (35.00%), Postives = 106/180 (58.89%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGK-FTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIAT 1331
            LD + +I +E+       +PHI++L++VI  +   +++MI EH+ GG + + +     L     R++F+ I+ G+DY H + +VHRD+KP NLL+D+   VK+ DFG+S   T  D FL+ + GSP + APE +    GK + G  +D+W+ G+ L+  L G + FD  +   L+  I +
Sbjct:  126 LDVVGKIRREIQNLSLFRHPHIIRLYQVI--STPSDIFMIMEHVSGGELFDYIVKHGRLKTAEARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDEQNNVKIADFGLSNIMTDGD-FLRTSCGSPNYAAPEVIS---GKLYAGPEVDVWSCGVILYALLCGTLPFDDEHVPSLFRKIKS 299          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333912)

HSP 1 Score: 196.438 bits (498), Expect = 7.199e-59
Identity = 115/341 (33.72%), Postives = 179/341 (52.49%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEG-LVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQD--TLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            N+  +P      SPR + R     + RES  +S   D+ G  +Q+NQY+++  +G+G+YG VKL   + D   YA+KI+SK++L++ +G  R                                       R P++                    PL R+Y+E+A+ KKLD+P++VKL EV+D+   D++YM+FE ++ G V+ +   +PLSE+     FR+ + GL+YLH  KI+H DIKP NLL+ + G VK+ D GV  +F GDD  + +  T G+PAF APE +     ++ G+A D+WALG TL+  +FG V F + +   LY  I    +  P+
Sbjct:  241 NVPYSPYSTPFSSPRSSRRKP---AFRESRRISI--DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMR---------------------------------------RGPRKAT-----------------SPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYLHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPE 520          

HSP 2 Score: 51.9878 bits (123), Expect = 7.199e-59
Identity = 25/87 (28.74%), Postives = 47/87 (54.02%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +++  +K  + +ML K P +RIT+  +K   WVT +G++  P   + N   ++V D +ID       ++ T++    M ++ SF NP
Sbjct:  523 KVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLP-TEEENCCLVQVDDEDIDSVVRSIPKLDTLILIKTMLKKHSFGNP 608          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333914)

HSP 1 Score: 184.496 bits (467), Expect = 3.054e-55
Identity = 114/359 (31.75%), Postives = 179/359 (49.86%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEG-LVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDY------------------LHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQD--TLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            N+  +P      SPR + R     + RES  +S   D+ G  +Q+NQY+++  +G+G+YG VKL   + D   YA+KI+SK++L++ +G  R                                       R P++                    PL R+Y+E+A+ KKLD+P++VKL EV+D+   D++YM+FE ++ G V+ +   +PLSE+     FR+ + GL+Y                  +H  KI+H DIKP NLL+ + G VK+ D GV  +F GDD  + +  T G+PAF APE +     ++ G+A D+WALG TL+  +FG V F + +   LY  I    +  P+
Sbjct:  241 NVPYSPYSTPFSSPRSSRRKP---AFRESRRISI--DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMR---------------------------------------RGPRKAT-----------------SPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPE 538          

HSP 2 Score: 51.9878 bits (123), Expect = 3.054e-55
Identity = 25/87 (28.74%), Postives = 47/87 (54.02%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +++  +K  + +ML K P +RIT+  +K   WVT +G++  P   + N   ++V D +ID       ++ T++    M ++ SF NP
Sbjct:  541 KVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLP-TEEENCCLVQVDDEDIDSVVRSIPKLDTLILIKTMLKKHSFGNP 626          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0111166)

HSP 1 Score: 165.622 bits (418), Expect = 1.507e-49
Identity = 80/187 (42.78%), Postives = 121/187 (64.71%), Query Frame = 3
Query:  804 PLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQD--TLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQTN 1358
            PL R+Y+E+A+ KKLD+P++VKL EV+D+   D++YM+FE ++ G V+ +   +PLSE+     FR+ + GL+YLH  KI+H DIKP NLL+ + G VK+ D GV  +F GDD  + +  T G+PAF APE +     ++ G+A D+WALG TL+  +FG V F + +   LY  I    +  P+ +
Sbjct:   26 PLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYLHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPETLIPGQNEYCGRAADVWALGATLYSLIFGNVPFLADSVPLLYEKIKQDSVKFPENH 212          

HSP 2 Score: 51.6026 bits (122), Expect = 1.507e-49
Identity = 25/87 (28.74%), Postives = 47/87 (54.02%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +++  +K  + +ML K P +RIT+  +K   WVT +G++  P   + N   ++V D +ID       ++ T++    M ++ SF NP
Sbjct:  213 KVTENLKSCIVQMLEKNPTQRITIPQLKTSKWVTSDGDYPLP-TEEENCCLVQVDDEDIDSVVRSIPKLDTLILIKTMLKKHSFGNP 298          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Match: CG17698 (gene:FBgn0040056 transcript:FBtr0333913)

HSP 1 Score: 150.599 bits (379), Expect = 6.682e-38
Identity = 97/305 (31.80%), Postives = 151/305 (49.51%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEG-LVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDY------------------LHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQD--TLGSPAFLAPE 1190
            N+  +P      SPR + R     + RES  +S   D+ G  +Q+NQY+++  +G+G+YG VKL   + D   YA+KI+SK++L++ +G  R                                       R P++                    PL R+Y+E+A+ KKLD+P++VKL EV+D+   D++YM+FE ++ G V+ +   +PLSE+     FR+ + GL+Y                  +H  KI+H DIKP NLL+ + G VK+ D GV  +F GDD  + +  T G+PAF APE
Sbjct:  241 NVPYSPYSTPFSSPRSSRRKP---AFRESRRISI--DKSGSFLQLNQYRLMEQIGQGSYGLVKLAYSEEDSTHYAMKILSKKRLLRQAGLMR---------------------------------------RGPRKAT-----------------SPLDRVYREIAVLKKLDHPNVVKLVEVLDDPLEDSLYMVFELVKQGEVLRIPTDNPLSEKRAWSIFRESLLGLEYYTMLSSSAISLKRIFVYTVHHQKIIHADIKPGNLLLTEFGHVKIADLGVCNEFLGDDATISNGSTAGTPAFRAPE 484          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Match: sff (gene:FBgn0036544 transcript:FBtr0089527)

HSP 1 Score: 117.857 bits (294), Expect = 1.220e-30
Identity = 59/167 (35.33%), Postives = 100/167 (59.88%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGV-SFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRN 1301
            L ++ +E+AI K +D+PH++ L +V +   +  +Y+I EH+ GG + + +     L+ +  RK+FR I+  LD+ H + I HRD+KP NLL+D+   +K+ DFG+ S Q  G    L+ + GSP +  PE ++    K+ G+  D+W+ G+ L+  L G + FD  N
Sbjct:   59 LMKVEREIAIMKLIDHPHVLGLSDVYENKKY--LYLILEHVSGGELFDYLVKKGRLTPKEARKFFRQIISALDFCHSHSICHRDLKPENLLLDEKNNIKIADFGMASLQPAGS--MLETSCGSPHYACPEVIRG--EKYDGRKADVWSCGVILYALLVGALPFDDDN 219          

HSP 2 Score: 36.1946 bits (82), Expect = 1.220e-30
Identity = 14/33 (42.42%), Postives = 20/33 (60.61%), Query Frame = 1
Query: 1366 EVKDLLTKMLNKIPEERITLNDIKEHPWVTENG 1464
            + + LL  M+   P+ R+TL +I  HPWVT  G
Sbjct:  241 DCQSLLRGMIEVNPDRRLTLAEINRHPWVTAGG 273          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 245.743 bits (626), Expect = 5.053e-78
Identity = 136/325 (41.85%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  378 SPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDEN-LYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
             PRM  R      T ES  +S + D +  VQ+NQYK+  ++G+G+YG VKL  + D++  YA+K++SK++L+K  G+ RRPP              SR+        S G++ S        ++NL   +   D            R+YQE+AI KKLD+ ++VKL EV+D+   DN++M+FE +  GPVM V    PLSEE+   YFRDI+ G++YLH+ KI+HRDIKPSNLL+  +G VK+ DFGVS +F G+D  L ++ G+PAF+APE + D   +F+GKALDIWA+G+TL CF+FGK  F     + L+  I +  +  P
Sbjct:   65 GPRMARRP-----TIESKRVSIS-DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPP--------------SRE--------SNGSVGS--------QENLLKPSGLLD------------RVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFP 341          

HSP 2 Score: 67.0106 bits (162), Expect = 5.053e-78
Identity = 46/138 (33.33%), Postives = 67/138 (48.55%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFNCQLSQNSHPLGDQIIQSTFDDLSQLDQSKS 1767
            +IS ++KDL+T+ML+K+PE RITL +IK HPWVT +G    P +  H +      +   +   + P  +  ++    M R+RSF NP         FE P  +      Q    S P G  +  S F  LS+   S S
Sbjct:  345 EISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQNSVKLVP-SLSAVILVKSMLRKRSFSNP---------FECPSGR------QGRSMSAPGGLTVDMSLFRPLSRGSNSNS 466          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 245.358 bits (625), Expect = 9.267e-78
Identity = 136/325 (41.85%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  378 SPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDEN-LYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
             PRM  R      T ES  +S + D +  VQ+NQYK+  ++G+G+YG VKL  + D++  YA+K++SK++L+K  G+ RRPP              SR+        S G++ S        ++NL   +   D            R+YQE+AI KKLD+ ++VKL EV+D+   DN++M+FE +  GPVM V    PLSEE+   YFRDI+ G++YLH+ KI+HRDIKPSNLL+  +G VK+ DFGVS +F G+D  L ++ G+PAF+APE + D   +F+GKALDIWA+G+TL CF+FGK  F     + L+  I +  +  P
Sbjct:   65 GPRMARRP-----TIESKRVSIS-DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPP--------------SRE--------SNGSVGS--------QENLLKPSGLLD------------RVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFP 341          

HSP 2 Score: 66.6254 bits (161), Expect = 9.267e-78
Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS ++KDL+T+ML+K+PE RITL +IK HPWVT +G    P +  H +      +   +   + P  +  ++    M R+RSF NP
Sbjct:  345 EISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQNSVKLVP-SLSAVILVKSMLRKRSFSNP 430          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1, alpha b [Source:ZFIN;Acc:ZDB-GENE-080722-13])

HSP 1 Score: 245.358 bits (625), Expect = 9.267e-78
Identity = 136/325 (41.85%), Postives = 197/325 (60.62%), Query Frame = 3
Query:  378 SPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDEN-LYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
             PRM  R      T ES  +S + D +  VQ+NQYK+  ++G+G+YG VKL  + D++  YA+K++SK++L+K  G+ RRPP              SR+        S G++ S        ++NL   +   D            R+YQE+AI KKLD+ ++VKL EV+D+   DN++M+FE +  GPVM V    PLSEE+   YFRDI+ G++YLH+ KI+HRDIKPSNLL+  +G VK+ DFGVS +F G+D  L ++ G+PAF+APE + D   +F+GKALDIWA+G+TL CF+FGK  F     + L+  I +  +  P
Sbjct:   65 GPRMARRP-----TIESKRVSIS-DGDDCVQLNQYKLKNEIGKGSYGVVKLAYNEDDDQYYAMKLVSKKRLIKQLGFRRRPP--------------SRE--------SNGSVGS--------QENLLKPSGLLD------------RVYQEIAILKKLDHLNVVKLVEVLDDPAEDNLHMVFELVPKGPVMEVPTDSPLSEEMAHLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNEFEGNDALLSNSAGTPAFMAPETLTDQDQRFSGKALDIWAMGVTLFCFVFGKCPFHDDYILGLHEKIRSMSVEFP 341          

HSP 2 Score: 66.6254 bits (161), Expect = 9.267e-78
Identity = 33/87 (37.93%), Postives = 51/87 (58.62%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS ++KDL+T+ML+K+PE RITL +IK HPWVT +G    P +  H +      +   +   + P  +  ++    M R+RSF NP
Sbjct:  345 EISEQLKDLITRMLDKVPETRITLAEIKLHPWVTVDGTDLLPLEEDHCTVVEVTEEEVQNSVKLVP-SLSAVILVKSMLRKRSFSNP 430          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Match: camkk1a (calcium/calmodulin-dependent protein kinase kinase 1, alpha a [Source:ZFIN;Acc:ZDB-GENE-050327-62])

HSP 1 Score: 217.624 bits (553), Expect = 2.570e-65
Identity = 100/186 (53.76%), Postives = 134/186 (72.04%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            L PL R+YQE+AI KKLD+ +IVKL EV+D+   DN++M+FE ++ GPVM V    P SE+  R YFRDIV G++YLH+ KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA+G+TL+CF++GK  F     + L++ I +K +  P T
Sbjct:  165 LGPLERVYQEIAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVMEVPSDSPFSEDQARHYFRDIVLGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSDNRQSFSGKALDVWAMGVTLYCFVYGKCPFIDEYILALHNKIKSKVVEFPDT 350          

HSP 2 Score: 52.7582 bits (125), Expect = 2.570e-65
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S  +K L+++ML+K P+ RIT+ +IK  PWVT++G    P + +H +      +   +     P  +  ++    M R+RSF NP
Sbjct:  353 VSEGLKSLVSRMLDKNPDTRITIPEIKVDPWVTQDGKDPLPLEEEHCTVVEVTEEEVQNSVKFVP-SLSAVILVKAMLRKRSFGNP 437          

HSP 3 Score: 56.9954 bits (136), Expect = 6.618e-8
Identity = 28/64 (43.75%), Postives = 46/64 (71.88%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDEN-LYALKIISKRKLMKSSGY 605
            T ES  +S + D +  +Q+NQYK+  ++G+G+YG VKL  + D++  YA+K++SK+KLMK  G+
Sbjct:   83 TIESKRVSIS-DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKYYAMKVVSKKKLMKQYGF 145          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Match: camkk1a (calcium/calmodulin-dependent protein kinase kinase 1, alpha a [Source:ZFIN;Acc:ZDB-GENE-050327-62])

HSP 1 Score: 216.853 bits (551), Expect = 4.712e-65
Identity = 100/186 (53.76%), Postives = 134/186 (72.04%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            L PL R+YQE+AI KKLD+ +IVKL EV+D+   DN++M+FE ++ GPVM V    P SE+  R YFRDIV G++YLH+ KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA+G+TL+CF++GK  F     + L++ I +K +  P T
Sbjct:  118 LGPLERVYQEIAILKKLDHLNIVKLVEVLDDPAEDNLHMVFELMQKGPVMEVPSDSPFSEDQARHYFRDIVLGIEYLHYQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSDNRQSFSGKALDVWAMGVTLYCFVYGKCPFIDEYILALHNKIKSKVVEFPDT 303          

HSP 2 Score: 52.373 bits (124), Expect = 4.712e-65
Identity = 27/86 (31.40%), Postives = 47/86 (54.65%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S  +K L+++ML+K P+ RIT+ +IK  PWVT++G    P + +H +      +   +     P  +  ++    M R+RSF NP
Sbjct:  306 VSEGLKSLVSRMLDKNPDTRITIPEIKVDPWVTQDGKDPLPLEEEHCTVVEVTEEEVQNSVKFVP-SLSAVILVKAMLRKRSFGNP 390          

HSP 3 Score: 56.9954 bits (136), Expect = 5.272e-8
Identity = 28/64 (43.75%), Postives = 46/64 (71.88%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDEN-LYALKIISKRKLMKSSGY 605
            T ES  +S + D +  +Q+NQYK+  ++G+G+YG VKL  + D++  YA+K++SK+KLMK  G+
Sbjct:   36 TIESKRVSIS-DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKYYAMKVVSKKKLMKQYGF 98          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Match: fam13b (family with sequence similarity 13 member B [Source:Xenbase;Acc:XB-GENE-983583])

HSP 1 Score: 255.373 bits (651), Expect = 1.555e-81
Identity = 142/354 (40.11%), Postives = 203/354 (57.34%), Query Frame = 3
Query:  306 LKQTPSNQ-LEIENIKVNPLVNAV---LSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDR-DENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            L++ PS   L   N+   P        +SPR+  R      T ES+ +S + D +  VQ+NQYK+  ++G+G+YG VKL  ++ D+  YA+K++SK++L+K  G+ RRPPP                         RG+      Q  P                    + PL R+YQE+AI KKLD+ +IV+L EV+D+   DN+YM+F+    GPVM V    P +E   R YFRDIV G++YLH+ KI+HRDIKPSNLL+  +G +K+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA+G+TL+CF+FGK  F     + L++ I  KP+  P+
Sbjct:   91 LQERPSGGCLPSHNLAYGPYATGPASHISPRIVRRP-----TIESNRVSIS-DSDDCVQLNQYKLQSEIGKGSYGVVKLAYNQSDDKYYAMKVLSKKRLLKQYGFPRRPPP-------------------------RGSKTGSGDQTKP--------------------MAPLDRVYQEIAILKKLDHVNIVRLVEVLDDPAEDNLYMVFDLFRKGPVMEVPSEQPFAEHQARVYFRDIVLGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLLDSGQGFSGKALDVWAMGVTLYCFVFGKCPFMDEFILALHNKIKYKPVEFPE 393          

HSP 2 Score: 69.707 bits (169), Expect = 1.555e-81
Identity = 34/86 (39.53%), Postives = 55/86 (63.95%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S+++KDL+ KML+K PE+RIT+ +IK HPWVT  G    P + +H +  +EV++ E+ +       + T++    M R+RSF NP
Sbjct:  397 VSNDLKDLILKMLDKKPEDRITVPEIKVHPWVTNRGGDPLPLEEEHCT-IVEVTEEEVKNSVKLIPSLTTVILVKAMLRKRSFGNP 481          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Match: fam13b (family with sequence similarity 13 member B [Source:Xenbase;Acc:XB-GENE-983583])

HSP 1 Score: 255.373 bits (651), Expect = 1.945e-81
Identity = 142/354 (40.11%), Postives = 203/354 (57.34%), Query Frame = 3
Query:  306 LKQTPSNQ-LEIENIKVNPLVNAV---LSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDR-DENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            L++ PS   L   N+   P        +SPR+  R      T ES+ +S + D +  VQ+NQYK+  ++G+G+YG VKL  ++ D+  YA+K++SK++L+K  G+ RRPPP                         RG+      Q  P                    + PL R+YQE+AI KKLD+ +IV+L EV+D+   DN+YM+F+    GPVM V    P +E   R YFRDIV G++YLH+ KI+HRDIKPSNLL+  +G +K+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA+G+TL+CF+FGK  F     + L++ I  KP+  P+
Sbjct:   91 LQERPSGGCLPSHNLAYGPYATGPASHISPRIVRRP-----TIESNRVSIS-DSDDCVQLNQYKLQSEIGKGSYGVVKLAYNQSDDKYYAMKVLSKKRLLKQYGFPRRPPP-------------------------RGSKTGSGDQTKP--------------------MAPLDRVYQEIAILKKLDHVNIVRLVEVLDDPAEDNLYMVFDLFRKGPVMEVPSEQPFAEHQARVYFRDIVLGIEYLHYQKIIHRDIKPSNLLLGDDGHIKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLLDSGQGFSGKALDVWAMGVTLYCFVFGKCPFMDEFILALHNKIKYKPVEFPE 393          

HSP 2 Score: 69.707 bits (169), Expect = 1.945e-81
Identity = 34/86 (39.53%), Postives = 55/86 (63.95%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S+++KDL+ KML+K PE+RIT+ +IK HPWVT  G    P + +H +  +EV++ E+ +       + T++    M R+RSF NP
Sbjct:  397 VSNDLKDLILKMLDKKPEDRITVPEIKVHPWVTNRGGDPLPLEEEHCT-IVEVTEEEVKNSVKLIPSLTTVILVKAMLRKRSFGNP 481          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Match: ENSXETT00000001488.1 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:NCBI gene;Acc:100135108])

HSP 1 Score: 258.07 bits (658), Expect = 2.077e-78
Identity = 130/333 (39.04%), Postives = 206/333 (61.86%), Query Frame = 3
Query:  354 NPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            +P+ +   SPR+  R      T ES  +S T  ++  VQ+NQY++  ++G+G+YG VKL  + D+N Y A+K++SK+KLM+ +G+ RRPPP                         RG                  A +  +  ++   + P+ R+YQE+AI +KLD+P++VKL EV+D+   D++YM+FE +  GPVM+V  + PL+E+  R YF+D++ G++YLH+ KI+HRD+KPSNLL+ ++G +K+ DFGVS  F G+D FL +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I  +P+  P
Sbjct:  146 SPVTSPQSSPRLPRRP-----TVESHRVSITGCQD-CVQLNQYQLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPP-------------------------RG------------------AKTATEGGVQ--AMGPIERVYQEIAILRKLDHPNVVKLIEVLDDPSEDHLYMVFELVRRGPVMDVPTTKPLTEDQARFYFQDLIKGIEYLHYQKIIHRDVKPSNLLLGEDGHIKIADFGVSNTFEGNDAFLSNTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLNCFVFGQCPFMDERILALHSKIKNQPLEFP 427          

HSP 2 Score: 56.6102 bits (135), Expect = 2.077e-78
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            IS ++KDLL  ML+K PE RI++ ++K HPWVT+ G    P ++++ +      E  +N I H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  432 ISEDLKDLLLHMLDKNPESRISVPELKLHPWVTKQGLEPLPTEDENCTLVEVTEEEVENSIKHIP----SLATVILVKSMLRKRSFGNP---------FEGSRKEERSMS 528          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Match: ENSXETT00000001514.1 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:NCBI gene;Acc:100135108])

HSP 1 Score: 258.07 bits (658), Expect = 2.732e-78
Identity = 130/333 (39.04%), Postives = 206/333 (61.86%), Query Frame = 3
Query:  354 NPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            +P+ +   SPR+  R      T ES  +S T  ++  VQ+NQY++  ++G+G+YG VKL  + D+N Y A+K++SK+KLM+ +G+ RRPPP                         RG                  A +  +  ++   + P+ R+YQE+AI +KLD+P++VKL EV+D+   D++YM+FE +  GPVM+V  + PL+E+  R YF+D++ G++YLH+ KI+HRD+KPSNLL+ ++G +K+ DFGVS  F G+D FL +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I  +P+  P
Sbjct:  146 SPVTSPQSSPRLPRRP-----TVESHRVSITGCQD-CVQLNQYQLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPP-------------------------RG------------------AKTATEGGVQ--AMGPIERVYQEIAILRKLDHPNVVKLIEVLDDPSEDHLYMVFELVRRGPVMDVPTTKPLTEDQARFYFQDLIKGIEYLHYQKIIHRDVKPSNLLLGEDGHIKIADFGVSNTFEGNDAFLSNTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLNCFVFGQCPFMDERILALHSKIKNQPLEFP 427          

HSP 2 Score: 56.225 bits (134), Expect = 2.732e-78
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            IS ++KDLL  ML+K PE RI++ ++K HPWVT+ G    P ++++ +      E  +N I H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  432 ISEDLKDLLLHMLDKNPESRISVPELKLHPWVTKQGLEPLPTEDENCTLVEVTEEEVENSIKHIP----SLATVILVKSMLRKRSFGNP---------FEGSRKEERSMS 528          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Match: ENSXETT00000001390.1 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:NCBI gene;Acc:100135108])

HSP 1 Score: 244.973 bits (624), Expect = 1.694e-74
Identity = 128/337 (37.98%), Postives = 204/337 (60.53%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            ++  +P+ +   SPR+  R      T ES  +S T  ++  VQ+NQY++  ++G+G+YG VKL  + D+N Y A+K++SK+KLM+ +G+ RRPPP                         RG                  A +  +  ++   + P+ R+YQE+AI +KLD+P++VKL EV+D+   D++YM      G PVM+V  + PL+E+  R YF+D++ G++YLH+ KI+HRD+KPSNLL+ ++G +K+ DFGVS  F G+D FL +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I  +P+  P
Sbjct:  102 SLPYSPVTSPQSSPRLPRRP-----TVESHRVSITGCQD-CVQLNQYQLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPPP-------------------------RG------------------AKTATEGGVQ--AMGPIERVYQEIAILRKLDHPNVVKLIEVLDDPSEDHLYM------GIPVMDVPTTKPLTEDQARFYFQDLIKGIEYLHYQKIIHRDVKPSNLLLGEDGHIKIADFGVSNTFEGNDAFLSNTVGTPAFMAPETLSETRKIFSGKALDVWAMGVTLNCFVFGQCPFMDERILALHSKIKNQPLEFP 381          

HSP 2 Score: 56.6102 bits (135), Expect = 1.694e-74
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            IS ++KDLL  ML+K PE RI++ ++K HPWVT+ G    P ++++ +      E  +N I H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  386 ISEDLKDLLLHMLDKNPESRISVPELKLHPWVTKQGLEPLPTEDENCTLVEVTEEEVENSIKHIP----SLATVILVKSMLRKRSFGNP---------FEGSRKEERSMS 482          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Match: Camkk1 (calcium/calmodulin-dependent protein kinase kinase 1, alpha [Source:MGI Symbol;Acc:MGI:1891766])

HSP 1 Score: 231.876 bits (590), Expect = 1.431e-72
Identity = 130/302 (43.05%), Postives = 180/302 (59.60%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P  EE  R Y RDI+ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  + ++ P+
Sbjct:  118 DTEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQATQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPE 374          

HSP 2 Score: 62.3882 bits (150), Expect = 1.431e-72
Identity = 32/87 (36.78%), Postives = 51/87 (58.62%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            ++S ++KDL+ +ML+K PE RI ++DIK HPWVT++G    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  377 EVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP-SWTTVILVKSMLRKRSFGNP 462          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Match: Camkk1 (calcium/calmodulin-dependent protein kinase kinase 1, alpha [Source:MGI Symbol;Acc:MGI:1891766])

HSP 1 Score: 227.639 bits (579), Expect = 1.430e-67
Identity = 126/297 (42.42%), Postives = 177/297 (59.60%), Query Frame = 3
Query:  465 VQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP  + +T                            Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P  EE  R Y RDI+ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  + ++ P+
Sbjct:    3 VQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPPRGSQAT----------------------------QGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPE 254          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 207.608 bits (527), Expect = 1.148e-64
Identity = 90/182 (49.45%), Postives = 135/182 (74.18%), Query Frame = 3
Query:  804 PLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            P+ ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  229 PIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.4622 bits (145), Expect = 1.148e-64
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 207.608 bits (527), Expect = 1.226e-64
Identity = 90/182 (49.45%), Postives = 135/182 (74.18%), Query Frame = 3
Query:  804 PLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            P+ ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  229 PIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.4622 bits (145), Expect = 1.226e-64
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Match: Camkk2 (calcium/calmodulin-dependent protein kinase kinase 2, beta [Source:MGI Symbol;Acc:MGI:2444812])

HSP 1 Score: 205.297 bits (521), Expect = 6.959e-64
Identity = 90/182 (49.45%), Postives = 135/182 (74.18%), Query Frame = 3
Query:  804 PLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            P+ ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:   24 PIEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 205          

HSP 2 Score: 60.077 bits (144), Expect = 6.959e-64
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  210 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 306          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Match: sp|Q8N5S9|KKCC1_HUMAN (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Homo sapiens OX=9606 GN=CAMKK1 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 2.955e-74
Identity = 131/302 (43.38%), Postives = 182/302 (60.26%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P SEE  R Y RD++ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  +P++ P+
Sbjct:  118 DAEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQAAQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFSEEQARLYLRDVILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDFILALHRKIKNEPVVFPE 374          

HSP 2 Score: 66.6254 bits (161), Expect = 2.955e-74
Identity = 36/87 (41.38%), Postives = 50/87 (57.47%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS E+KDL+ KML+K PE RI + DIK HPWVT+NG    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  377 EISEELKDLILKMLDKNPETRIGVPDIKLHPWVTKNGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP-SWTTVILVKSMLRKRSFGNP 462          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Match: sp|P97756|KKCC1_RAT (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Rattus norvegicus OX=10116 GN=Camkk1 PE=1 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 3.476e-73
Identity = 130/302 (43.05%), Postives = 181/302 (59.93%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L   +R++  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P  EE  R Y RDI+ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  + ++ P+
Sbjct:  118 DTEDCVQLNQYKLQSEIGKGAYGVVRLAYNEREDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQAPQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDTGQSFSGKALDVWATGVTLYCFVYGKCPFIDEYILALHRKIKNEAVVFPE 374          

HSP 2 Score: 65.0846 bits (157), Expect = 3.476e-73
Identity = 34/87 (39.08%), Postives = 51/87 (58.62%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            ++S E+KDL+ KML+K PE RI ++DIK HPWVT++G    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  377 EVSEELKDLILKMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVKNSVKLIP-SWTTVILVKSMLRKRSFGNP 462          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Match: sp|Q8VBY2|KKCC1_MOUSE (Calcium/calmodulin-dependent protein kinase kinase 1 OS=Mus musculus OX=10090 GN=Camkk1 PE=1 SV=1)

HSP 1 Score: 231.876 bits (590), Expect = 8.698e-72
Identity = 130/302 (43.05%), Postives = 180/302 (59.60%), Query Frame = 3
Query:  450 DEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            D E  VQ+NQYK+  ++G+GAYG V+L  +  E+  YA+K++SK+KL+K  G+ RRPPP                         RG   S + Q  P ++ L                 PL R+YQE+AI KKLD+ ++VKL EV+D+   DN+Y++F+ +  GPVM V    P  EE  R Y RDI+ GL+YLH  KIVHRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + D    F+GKALD+WA G+TL+CF++GK  F     + L+  I  + ++ P+
Sbjct:  118 DTEDCVQLNQYKLQSEIGKGAYGVVRLAYNESEDRHYAMKVLSKKKLLKQYGFPRRPPP-------------------------RG---SQATQGGPAKQLL-----------------PLERVYQEIAILKKLDHVNVVKLIEVLDDPAEDNLYLVFDLLRKGPVMEVPCDKPFPEEQARLYLRDIILGLEYLHCQKIVHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDAQLSSTAGTPAFMAPEAISDSGQSFSGKALDVWATGVTLYCFVYGKCPFIDDYILTLHRKIKNEAVVFPE 374          

HSP 2 Score: 62.3882 bits (150), Expect = 8.698e-72
Identity = 32/87 (36.78%), Postives = 51/87 (58.62%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            ++S ++KDL+ +ML+K PE RI ++DIK HPWVT++G    P + +H S      +   +   + P    T++    M R+RSF NP
Sbjct:  377 EVSEDLKDLILRMLDKNPETRIGVSDIKLHPWVTKHGEEPLPSEEEHCSVVEVTEEEVKNSVRLIP-SWTTVILVKSMLRKRSFGNP 462          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Match: sp|Q96RR4|KKCC2_HUMAN (Calcium/calmodulin-dependent protein kinase kinase 2 OS=Homo sapiens OX=9606 GN=CAMKK2 PE=1 SV=2)

HSP 1 Score: 226.483 bits (576), Expect = 2.472e-69
Identity = 123/312 (39.42%), Postives = 188/312 (60.26%), Query Frame = 3
Query:  417 TRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            T ES  +S T  ++  VQ+NQY +  ++G+G+YG VKL  + ++N  YA+K++SK+KL++ +G+ RRPPP         C         Q   P                                     + ++YQE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  145 TVESHHVSITGMQD-CVQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGC--------IQPRGP-------------------------------------IEQVYQEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 410          

HSP 2 Score: 60.077 bits (144), Expect = 2.472e-69
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  415 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Match: sp|O88831|KKCC2_RAT (Calcium/calmodulin-dependent protein kinase kinase 2 OS=Rattus norvegicus OX=10116 GN=Camkk2 PE=1 SV=1)

HSP 1 Score: 222.246 bits (565), Expect = 2.586e-68
Identity = 119/296 (40.20%), Postives = 179/296 (60.47%), Query Frame = 3
Query:  465 VQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            VQ+NQY +  ++G+G+YG VKL  + ++N  YA+K++SK+KL++ +G+ RRPPP         C         Q   P                             I+  Y        QE+AI KKLD+P++VKL EV+D+ + D++YM+FE +  GPVM V    PLSE+  R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G +K+ DFGVS +F G D  L +T+G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FG+  F     + L+  I ++ +  P
Sbjct:  159 VQLNQYTLKDEIGKGSYGVVKLAYNENDNTYYAMKVLSKKKLIRQAGFPRRPPPRGTRPAPGGC--------IQPRGP-----------------------------IEQVY--------QEIAILKKLDHPNVVKLVEVLDDPNEDHLYMVFELVNQGPVMEVPTLKPLSEDQARFYFQDLIKGIEYLHYQKIIHRDIKPSNLLVGEDGHIKIADFGVSNEFKGSDALLSNTVGTPAFMAPESLSETRKIFSGKALDVWAMGVTLYCFVFGQCPFMDERIMCLHSKIKSQALEFP 409          

HSP 2 Score: 60.8474 bits (146), Expect = 2.586e-68
Identity = 36/110 (32.73%), Postives = 58/110 (52.73%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNS---QQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFN 1677
            I+ ++KDL+T+ML+K PE RI + +IK HPWVT +G    P ++++ +      E  +N + H       + T++    M R+RSF NP         FE  R + R  +
Sbjct:  414 IAEDLKDLITRMLDKNPESRIVVPEIKLHPWVTRHGAEPLPSEDENCTLVEVTEEEVENSVKHIP----SLATVILVKTMIRKRSFGNP---------FEGSRREERSLS 510          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Match: A0A1I8GEH0 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 6.636e-91
Identity = 161/353 (45.61%), Postives = 227/353 (64.31%), Query Frame = 3
Query:  282 YKNVYENLLKQTPSNQLEI--ENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTED-EEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIA 1328
            Y++ Y + ++  PS+QL +   ++  +P V+   SP    R      T+ESS +S   + EEG   +NQY++  ++G+G++G VKL     D+NLYA+KI+SK+KL +S+G+FRRPPP               + +   + PS  N   +               S++  +   A  DPL+R+Y+E+A+ KKL++P++VKL EV+D+ + DN+YM+FE +E G VM V    PL EE    YFRDIV GL+YLHF KIVHRDIKPSNLL+  +G +K+ DFGVS +F+G+DI L +T GSPAFLAPECV++    FTG+ALDIWALG+TL+CFL+GKV FD   KI LYHSI 
Sbjct:    9 YQSGYSSPVQPRPSSQLRLICPHLPFSPCVSPNNSP---VRRLVRQPTKESSSVSIEHNFEEGFCMLNQYRLQDEIGKGSFGIVKLAYNSSDDNLYAMKILSKKKLRRSAGFFRRPPP---------------RVLSAGSGPSIDNPSGVDSPS--------LGASSSSLAAVAAAPDPLQRVYREIAMQKKLNHPNVVKLVEVLDDPEQDNLYMVFELVERGQVMEVPTDSPLDEETAWNYFRDIVSGLEYLHFQKIVHRDIKPSNLLLTDDGRIKIADFGVSNEFSGNDILLSNTAGSPAFLAPECVREGQKYFTGRALDIWALGVTLYCFLYGKVPFDKDPKIALYHSIV 335          

HSP 2 Score: 67.3958 bits (163), Expect = 6.636e-91
Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKS 1623
            +S  V DL+ +M+ K PE RITL +IKEH WVT  G++  P + + N   +EV+  ++D C  +  +++T++    + R RSF++P  S
Sbjct:  347 LSEYVIDLMKRMMTKDPETRITLPEIKEHVWVTNFGSFPLPDE-EENCSLVEVTQADVDSCIRRIPKLETLILVKSILRNRSFKHPFGS 434          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Match: A0A1I8JDD7 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 7.973e-91
Identity = 161/353 (45.61%), Postives = 227/353 (64.31%), Query Frame = 3
Query:  282 YKNVYENLLKQTPSNQLEI--ENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTED-EEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIA 1328
            Y++ Y + ++  PS+QL +   ++  +P V+   SP    R      T+ESS +S   + EEG   +NQY++  ++G+G++G VKL     D+NLYA+KI+SK+KL +S+G+FRRPPP               + +   + PS  N   +               S++  +   A  DPL+R+Y+E+A+ KKL++P++VKL EV+D+ + DN+YM+FE +E G VM V    PL EE    YFRDIV GL+YLHF KIVHRDIKPSNLL+  +G +K+ DFGVS +F+G+DI L +T GSPAFLAPECV++    FTG+ALDIWALG+TL+CFL+GKV FD   KI LYHSI 
Sbjct:    9 YQSGYSSPVQPRPSSQLRLICPHLPFSPCVSPNNSP---VRRLVRQPTKESSSVSIEHNFEEGFCMLNQYRLQDEIGKGSFGIVKLAYNSSDDNLYAMKILSKKKLRRSAGFFRRPPP---------------RVLSAGSGPSIDNPSGVDSPS--------LGASSSSLAAVAAAPDPLQRVYREIAMQKKLNHPNVVKLVEVLDDPEQDNLYMVFELVERGQVMEVPTDSPLDEETAWNYFRDIVSGLEYLHFQKIVHRDIKPSNLLLTDDGRIKIADFGVSNEFSGNDILLSNTAGSPAFLAPECVREGQKYFTGRALDIWALGVTLYCFLYGKVPFDKDPKIALYHSIV 335          

HSP 2 Score: 67.3958 bits (163), Expect = 7.973e-91
Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKS 1623
            +S  V DL+ +M+ K PE RITL +IKEH WVT  G++  P + + N   +EV+  ++D C  +  +++T++    + R RSF++P  S
Sbjct:  347 LSEYVIDLMKRMMTKDPETRITLPEIKEHVWVTNFGSFPLPDE-EENCSLVEVTQADVDSCIRRIPKLETLILVKSILRNRSFKHPFGS 434          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Match: A0A267DD88 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000710g5 PE=4 SV=1)

HSP 1 Score: 296.204 bits (757), Expect = 4.478e-90
Identity = 159/352 (45.17%), Postives = 221/352 (62.78%), Query Frame = 3
Query:  276 IFYKNVYENLLKQTPSNQLEIENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTED-EEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            I Y    + +   T   +L   ++  +P V+   SP    R      T+ESS +S   + EEG   +NQY++  ++G+G++G VKL     D+NLYA+KI+SK+KL +S+G+FRRPPP               + +   + PS  N   +               S++  +   A  DPL+R+Y+E+A+ KKL++P++VKL EV+D+ + DN+YM+FE +E G VM V    PL EE    YFRDIV GL+YLHF KIVHRDIKPSNLL+  +G +K+ DFGVS +F+G+DI L +T GSPAFLAPECV++    FTG+ALDIWALG+TL+CFL+GKV FD   KI LYHSI
Sbjct:  234 ISYSTSEDRVTTTTGRQRLICPHLPFSPCVSPNNSP---VRRLVRQPTKESSSVSIEHNFEEGFCMLNQYRLQDEIGKGSFGIVKLAYNSSDDNLYAMKILSKKKLRRSAGFFRRPPP---------------RVLSAGSGPSIDNPSGVDSPS--------LGASSSSLAAVAAAPDPLQRVYREIAMQKKLNHPNVVKLVEVLDDPEQDNLYMVFELVERGQVMEVPTDSPLDEETAWNYFRDIVSGLEYLHFQKIVHRDIKPSNLLLTDDGRIKIADFGVSNEFSGNDILLSNTAGSPAFLAPECVREGQKYFTGRALDIWALGVTLYCFLYGKVPFDKDPKIALYHSI 559          

HSP 2 Score: 67.3958 bits (163), Expect = 4.478e-90
Identity = 32/86 (37.21%), Postives = 54/86 (62.79%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S  V DL+ +M+ K PE RITL +IKEH WVT  G++  P + + N   +EV+  ++D C  +  +++T++    + R RSF++P
Sbjct:  572 LSEYVIDLMKRMMTKDPETRITLPEIKEHVWVTNFGSFPLPDE-EENCSLVEVTQADVDSCIRRIPKLETLILVKSILRNRSFKHP 656          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Match: A0A267DDB4 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000710g1 PE=4 SV=1)

HSP 1 Score: 294.278 bits (752), Expect = 1.920e-89
Identity = 159/353 (45.04%), Postives = 221/353 (62.61%), Query Frame = 3
Query:  276 IFYKNVYENLLKQTPSNQLEIENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTED-EEGLVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIA 1328
            I Y    + +   T   +L   ++  +P V+   SP    R      T+ESS +S   + EEG   +NQY++  ++G+G++G VKL     D+NLYA+KI+SK+KL +S+G+FRRPPP               + +   + PS  N   +               S++  +   A  DPL+R+Y+E+A+ KKL++P++VKL EV+D+ + DN+YM+FE +E G VM V    PL EE    YFRDIV GL+YLHF KIVHRDIKPSNLL+  +G +K+ DFGVS +F+G+DI L +T GSPAFLAPECV++    FTG+ALDIWALG+TL+CFL+GKV FD   KI LYHSI 
Sbjct:   48 ISYSTSEDRVTTTTGRQRLICPHLPFSPCVSPNNSP---VRRLVRQPTKESSSVSIEHNFEEGFCMLNQYRLQDEIGKGSFGIVKLAYNSSDDNLYAMKILSKKKLRRSAGFFRRPPP---------------RVLSAGSGPSIDNPSGVDSPS--------LGASSSSLAAVAAAPDPLQRVYREIAMQKKLNHPNVVKLVEVLDDPEQDNLYMVFELVERGQVMEVPTDSPLDEETAWNYFRDIVSGLEYLHFQKIVHRDIKPSNLLLTDDGRIKIADFGVSNEFSGNDILLSNTAGSPAFLAPECVREGQKYFTGRALDIWALGVTLYCFLYGKVPFDKDPKIALYHSIV 374          

HSP 2 Score: 67.3958 bits (163), Expect = 1.920e-89
Identity = 33/89 (37.08%), Postives = 55/89 (61.80%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKS 1623
            +S  V DL+ +M+ K PE RITL +IKEH WVT  G++  P + + N   +EV+  ++D C  +  +++T++    + R RSF++P  S
Sbjct:  386 LSEYVIDLMKRMMTKDPETRITLPEIKEHVWVTNFGSFPLPDE-EENCSLVEVTQADVDSCIRRIPKLETLILVKSILRNRSFKHPFGS 473          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Match: A0A1I8ITF9 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 275.404 bits (703), Expect = 2.480e-84
Identity = 139/291 (47.77%), Postives = 189/291 (64.95%), Query Frame = 3
Query:  462 LVQINQYKVLRDLGRGAYGFVKLV-EDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQD--CHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
              ++NQY+V   +GRG++G VKL     D+NLYA+KI+SK+KL +S+G+ RRPP        S   D S                S S  +SPQ                    DPL R+Y+E+AI KKLD+P++VKL EV+D+ + DN+YM+FE ++ G V+ V    PLSE   R YFRD + GL+YLHF KI+HRDIKPSNLL+ K+G +K+ DFGVS +F+G+D+FL  T GSPAFLAPECV++     +F+G+A DIWALG+TL+CFL+G+V FD   ++ LYHSI
Sbjct:  168 FCRLNQYRVQHQIGRGSFGIVKLAYSASDDNLYAMKILSKKKLRRSAGFARRPP--------SRVSDGS----------------STSAGQSPQ--------------------DPLFRVYREIAIQKKLDHPNVVKLIEVLDDPEQDNLYMVFELVQRGNVLEVPTEQPLSEAQARAYFRDTLLGLEYLHFQKIIHRDIKPSNLLLTKDGRIKIADFGVSNEFSGEDLFLSGTAGSPAFLAPECVREDQQRRRFSGRATDIWALGVTLYCFLYGRVPFDREPRLALYHSI 414          

HSP 2 Score: 68.9366 bits (167), Expect = 2.480e-84
Identity = 31/86 (36.05%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            IS+E   L+ + ++K PE RITL +IK HPWVTE G    P +  + + ++ V+  E+D C  +  +++T++    + R RSF++P
Sbjct:  428 ISAEAVHLMRRAMDKDPETRITLPEIKSHPWVTEFGWRGLPMERDNCAVRVCVTQEEVDACVRQVAKLETLILVKSILRNRSFKHP 513          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 262.307 bits (669), Expect = 2.826e-84
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK++L++ +G+ RRPPP    S                             +  PQ K                   PL R+YQE+AI KKLD+P++VKL EV+D+   D++YM+FE ++ G VM V    PL+E+ +R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G VK+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ LP+
Sbjct:  165 SLPYSPITSPHSSPRLPRRP-----TVESHRVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPPRGAKSAP---------------------------EGPPQPKG------------------PLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPE 451          

HSP 2 Score: 71.2478 bits (173), Expect = 2.826e-84
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S ++KDLL KML+K PE RIT+  IK HPWVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  455 VSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNCCSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 540          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 261.922 bits (668), Expect = 4.244e-84
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK++L++ +G+ RRPPP    S                             +  PQ K                   PL R+YQE+AI KKLD+P++VKL EV+D+   D++YM+FE ++ G VM V    PL+E+ +R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G VK+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ LP+
Sbjct:  165 SLPYSPITSPHSSPRLPRRP-----TVESHRVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPPRGAKSAP---------------------------EGPPQPKG------------------PLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPE 451          

HSP 2 Score: 70.8626 bits (172), Expect = 4.244e-84
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S ++KDLL KML+K PE RIT+  IK HPWVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  455 VSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNCCSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 540          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 261.922 bits (668), Expect = 4.244e-84
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK++L++ +G+ RRPPP    S                             +  PQ K                   PL R+YQE+AI KKLD+P++VKL EV+D+   D++YM+FE ++ G VM V    PL+E+ +R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G VK+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ LP+
Sbjct:  165 SLPYSPITSPHSSPRLPRRP-----TVESHRVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPPRGAKSAP---------------------------EGPPQPKG------------------PLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPE 451          

HSP 2 Score: 70.8626 bits (172), Expect = 4.244e-84
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S ++KDLL KML+K PE RIT+  IK HPWVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  455 VSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNCCSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 540          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 261.536 bits (667), Expect = 4.575e-84
Identity = 138/338 (40.83%), Postives = 204/338 (60.36%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK++L++ +G+ RRPPP    S                             +  PQ K                   PL R+YQE+AI KKLD+P++VKL EV+D+   D++YM+FE ++ G VM V    PL+E+ +R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G VK+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ LP+
Sbjct:  165 SLPYSPITSPHSSPRLPRRP-----TVESHRVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPPRGAKSAP---------------------------EGPPQPKG------------------PLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKQGAVMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPE 451          

HSP 2 Score: 71.2478 bits (173), Expect = 4.575e-84
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S ++KDLL KML+K PE RIT+  IK HPWVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  455 VSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNCCSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 540          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2-like [Source:NCBI gene;Acc:103036346])

HSP 1 Score: 246.514 bits (628), Expect = 1.354e-79
Identity = 134/340 (39.41%), Postives = 200/340 (58.82%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQTN 1358
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK++L++ +G+ RRPPP    S                             +  PQ K                   PL R+YQE+AI KKLD+P++VKL EV+D+   D+++M+   +    VM V    PL+E+ +R YF+D++ G++YLH+ KI+HRDIKPSNLLV ++G VK+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ LP  +
Sbjct:  165 SLPYSPITSPHSSPRLPRRP-----TVESHRVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKRLLRQAGFPRRPPPRGAKSAP---------------------------EGPPQPKG------------------PLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLHMVCMCVYRA-VMEVPTDKPLNEDQSRFYFQDLLRGIEYLHYQKIIHRDIKPSNLLVGEDGHVKIADFGVSNQFEGADALLTSTVGTPAFLAPETLSETRKNFSGKALDVWAMGVTLYCFIFGVCPFMDERILSLHQKIKTQPVELPDAD 452          

HSP 2 Score: 71.2478 bits (173), Expect = 1.354e-79
Identity = 35/86 (40.70%), Postives = 53/86 (61.63%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +S ++KDLL KML+K PE RIT+  IK HPWVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  453 VSDDLKDLLFKMLDKNPETRITVPQIKVHPWVTRHGAEPLPPEDDNCCSLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 538          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006410.1 (pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 gene:ENSPMAG00000005688.1 transcript:ENSPMAT00000006410.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 2.390e-27
Identity = 68/185 (36.76%), Postives = 107/185 (57.84%), Query Frame = 3
Query:  783 IKDAYLDP--LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDP-LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTL-GSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            I    L+P  L+++++EV I K L++P+IVKL+EVI+      +Y++ E+  GG V +   +   + E+  R  FR IV  + Y H   IVHRD+K  NLL+D +  +K+ DFG S +FT  +    DT  GSP + APE  Q    K+ G  +D+W+LG+ L+  + G + FD +N  +L   +
Sbjct:   70 IDKTQLNPTSLQKLFREVRIMKCLNHPNIVKLYEVIE--TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKNIVHRDLKAENLLLDVDMHIKIADFGFSNEFTLVNKL--DTFCGSPPYAAPELFQG--KKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELREKV 248          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 115.931 bits (289), Expect = 5.374e-27
Identity = 69/186 (37.10%), Postives = 107/186 (57.53%), Query Frame = 3
Query:  783 IKDAYLDP--LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDP-LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFT-GDDIFLQDTL-GSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            I    L+P  L+++++EV I K L++P+IVKL EVI+      +Y++ E+  GG V +   +   + E+  R  FR IV  + Y H   IVHRD+K  NLL+D +  +K+ DFG S +FT G  +   DT  GSP + APE  Q    K+ G  +D+W+LG+ L+  + G + FD +N  +L   +
Sbjct:   85 IDKTQLNPSSLQKLFREVRIMKILNHPNIVKLFEVIE--TEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKL---DTFCGSPPYAAPELFQG--KKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 263          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 100.908 bits (250), Expect = 5.920e-27
Identity = 68/207 (32.85%), Postives = 106/207 (51.21%), Query Frame = 3
Query:  699 RGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIY---QEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN--VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLL-VDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRN 1301
            RG+   + L R     +++         I  + LDP+   +   QEV   K + +P++V+L+EVID      +Y+I E  +GG + +  +     L EEL + YF  +V  + Y H   +VHRD+KP N++  +K GLVKL DFG S  F      L  + GS A+ APE +     ++   A+DIW+LG+ L+  + G   F   N
Sbjct:   24 RGHFAVVKLAR-----HVFTGEKVAVKVIDKSKLDPMATSHLFQQEVRCMKLVQHPNVVRLYEVID--TQTKLYLILELADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQ-PGTKLATSCGSLAYSAPEILLG--DEYDAPAVDIWSLGVILYMLVCGHPPFQEAN 220          

HSP 2 Score: 38.1206 bits (87), Expect = 5.920e-27
Identity = 14/33 (42.42%), Postives = 22/33 (66.67%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWV 1452
             IS E KDL+ +ML + P  R +L +++ HPW+
Sbjct:  238 HISRECKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 112.079 bits (279), Expect = 1.700e-26
Identity = 66/176 (37.50%), Postives = 103/176 (58.52%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDP-LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFT-GDDIFLQDTL-GSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            L+++++EV I K L++P+IVKL EVI+      +Y++ E+  GG V +   +   + E+  R  FR IV  + Y H   IVHRD+K  NLL+D +  +K+ DFG S +FT G  +   DT  GSP + APE  Q    K+ G  +D+W+LG+ L+  + G + FD +N  +L   +
Sbjct:  109 LQKLFREVRIMKVLNHPNIVKLFEVIEM--EKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKL---DTFCGSPPYAAPELFQG--KKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 277          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003561.1 (pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 gene:ENSPMAG00000003167.1 transcript:ENSPMAT00000003561.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 6.004e-22
Identity = 53/171 (30.99%), Postives = 96/171 (56.14%), Query Frame = 3
Query:  819 YQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDT-LGSPAFLAPECVQDCHGK-FTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            ++E  I    ++P +V+L       DH  +YM+ E++ GG ++N+  +  + E+  R Y  ++V  LD +H    +HRD+KP N+L+DKNG +KL DFG   +   + +   DT +G+P +++PE ++   G  + G+  D W++G+ L+  L G   F + + +  Y  I
Sbjct:  122 WEERDIMAFANSPWVVQLFYAF--QDHRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTAEVVLALDAIHSMGFIHRDVKPDNMLLDKNGHLKLADFGTCMKMDTEGMVRCDTAVGTPDYISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKI 290          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Match: TOS3 (Protein kinase; related to and functionally redundant with Elm1p and Sak1p for the phosphorylation and activation of Snf1p; functionally orthologous to LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome; TOS3 has a paralog, SAK1, that arose from the whole genome duplication [Source:SGD;Acc:S000003147])

HSP 1 Score: 144.436 bits (363), Expect = 6.409e-37
Identity = 71/197 (36.04%), Postives = 115/197 (58.38%), Query Frame = 3
Query:  813 RIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPV-------MNVGFSDP--LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSF---------QFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            R+ QE+ + K+  + ++V+L+E++++ +   +Y++ E+   GPV       M +    P  L+ + +RK   D+V GL+YLH   I HRDIKPSNLL+  NG VK+ DFGV+          Q + + +     LG+PAF APE            A+DIW+LG+T++C LFGK+ F++ + ++L+ SI  KP+  P
Sbjct:  100 RVNQEIEVMKRCHHENVVELYEILNDPESTKVYLVLEYCSRGPVKWCPENKMEIKAVGPSILTFQQSRKVVLDVVSGLEYLHSQGITHRDIKPSNLLISSNGTVKISDFGVAMSTATGSTNIQSSHEQLLKSRALGTPAFFAPELCSTEKEYSCSSAIDIWSLGVTIYCLLFGKLPFNANSGLELFDSIINKPLEFP 296          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Match: SAK1 (Upstream serine/threonine kinase for the SNF1 complex; plays a role in pseudohyphal groth; partially redundant with Elm1p and Tos3p; members of this family have functional orthology with LKB1, a mammalian kinase associated with Peutz-Jeghers cancer-susceptibility syndrome; SAK1 has a paralog, TOS3, that arose from the whole genome duplication [Source:SGD;Acc:S000000931])

HSP 1 Score: 127.102 bits (318), Expect = 9.212e-32
Identity = 80/225 (35.56%), Postives = 119/225 (52.89%), Query Frame = 3
Query:  783 IKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPV-------MNVGFSDP--LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSF----------QFTGDDIFLQDTLGSPAFLAPECVQDCHGK-------------FTGKA----LDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            IK + +    +I +E+AI KK  + H+V+L EV+D+     +Y++ E+   G V       M      P  LS + TR+  R +V GL+YLH+  I+HRDIKP+NLL+  +G VK+ DFGVS             + D++ L  T+G+PAF APE    C G+             F G      +DIWA+G+TL+C LFG + F S  ++ L+  I   P+  P
Sbjct:  178 IKSSKISENDKIKREIAIMKKCHHKHVVQLIEVLDDLKSRKIYLVLEYCSRGEVKWCPPDCMESDAKGPSLLSFQETREILRGVVLGLEYLHYQGIIHRDIKPANLLISGDGTVKISDFGVSLAASSTNSSDSSESLDELELAKTVGTPAFFAPEM---CLGEDAFTRYNLTKENLFRGSCISFMIDIWAVGVTLYCLLFGMLPFFSDFELKLFEKIVNDPLKFP 399          

HSP 2 Score: 27.335 bits (59), Expect = 9.212e-32
Identity = 11/26 (42.31%), Postives = 18/26 (69.23%), Query Frame = 1
Query: 1405 PEERITLNDIKEHPWVTENGNWAFPH 1482
            P++R+T+  IK+HP+V+    W F H
Sbjct:  433 PQKRMTIPAIKKHPFVS----WDFDH 454          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Match: KIN2 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN2 has a paralog, KIN1, that arose from the whole genome duplication [Source:SGD;Acc:S000004086])

HSP 1 Score: 113.62 bits (283), Expect = 1.545e-30
Identity = 64/178 (35.96%), Postives = 100/178 (56.18%), Query Frame = 3
Query:  810 RRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIF-----LQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            +R  +E ++ + L +PHI +L E+   ++H   YM+FE++ GG +++ +     L E   RK+ R I   L YLH N IVHRD+K  N+++  +G +K+IDFG+S      +IF     L    GS  F APE ++     +TG  +DIW+ G+ L+  + GKV FD  N   L+  I
Sbjct:  168 KRTVREASLGQILYHPHICRLFEMCTMSNH--FYMLFEYVSGGQLLDYIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLS------NIFDYRKQLHTFCGSLYFAAPELLKA--QPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSILHEKI 335          

HSP 2 Score: 36.965 bits (84), Expect = 1.545e-30
Identity = 17/45 (37.78%), Postives = 25/45 (55.56%), Query Frame = 1
Query: 1345 YLKQISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFP 1479
            Y   +S EV  LLT+M+   P  R TL ++ EHPW+    ++  P
Sbjct:  342 YPSHLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNRGYDFKAP 386          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Match: KIN1 (Serine/threonine protein kinase involved in regulation of exocytosis; localizes to the cytoplasmic face of the plasma membrane; KIN1 has a paralog, KIN2, that arose from the whole genome duplication [Source:SGD;Acc:S000002529])

HSP 1 Score: 107.842 bits (268), Expect = 3.861e-28
Identity = 61/182 (33.52%), Postives = 99/182 (54.40%), Query Frame = 3
Query:  810 RRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            +R  +E ++ + L +PHI +L E+   ++H   YM+FE++ GG +++ +     + E   RK+ R I   L YLH N IVHRD+K  N+++  +  +K+IDFG+S  +      L    GS  F APE ++     +TG  +D+W+ G+ L   + GKV FD  N   L+  I    +  PQ
Sbjct:  189 KRTIREASLGQILYHPHICRLFEMCTLSNH--FYMLFEYVSGGQLLDYIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNIYDSRKQ-LHTFCGSLYFAAPELLKA--NPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSVLHEKIKQGKVEYPQ 365          

HSP 2 Score: 34.6538 bits (78), Expect = 3.861e-28
Identity = 18/45 (40.00%), Postives = 24/45 (53.33%), Query Frame = 1
Query: 1345 YLKQISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFP 1479
            Y + +S EV  LL+KML   P+ R TL  + EH W+    N   P
Sbjct:  363 YPQHLSIEVISLLSKMLVVDPKRRATLKQVVEHHWMVRGFNGPPP 407          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Match: GIN4 (Protein kinase involved in bud growth and assembly of the septin ring; proposed to have kinase-dependent and kinase-independent activities; undergoes autophosphorylation; similar to Hsl1p; GIN4 has a paralog, KCC4, that arose from the whole genome duplication [Source:SGD;Acc:S000002915])

HSP 1 Score: 108.227 bits (269), Expect = 1.371e-27
Identity = 59/160 (36.88%), Postives = 96/160 (60.00%), Query Frame = 3
Query:  816 IYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFS-DPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFD 1292
            I +E+ I K L++P++++L++V  ET+ D +Y++ E+ E G + N+     PL E    ++FR I+ G+ Y H   IVHRD+KP NLL+D    +K+ DFG++   T +   L+ + GSP + APE V      + G A D+W+ G+ L   L G++ FD
Sbjct:   78 IEREIIIMKLLNHPNVLRLYDVW-ETNTD-LYLVLEYAEKGELFNLLVERGPLPEHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALET-EGKLLETSCGSPHYAAPEIVSGI--PYQGFASDVWSCGVILFALLTGRLPFD 232          

HSP 2 Score: 32.7278 bits (73), Expect = 1.371e-27
Identity = 15/33 (45.45%), Postives = 21/33 (63.64%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWV 1452
            +IS E +DL+ K+L   PE RI   DI +HP +
Sbjct:  257 EISREAQDLIRKILTVDPERRIKTRDILKHPLL 289          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Match: EDO35522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL93])

HSP 1 Score: 202.601 bits (514), Expect = 7.460e-65
Identity = 90/180 (50.00%), Postives = 133/180 (73.89%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIIL 1346
            L  + +E+AI KK+D+P++V+L+EV+D+   DN+Y++FE ++ G VM V    PL +E  R +FR++V G++YLH +KIVHRDIKPSNLLV ++G +K+ DFGV+  F GDD  L  T GSPAF+APE +Q    K++GKA+D+WA+G+TL+CF+FGK  F+  N++ LY  I TK ++ 
Sbjct:   52 LENLQREIAILKKVDHPNVVRLNEVLDDPAEDNLYLVFELMDKGDVMEVP-GPPLQQETARTHFRELVLGVEYLHHHKIVHRDIKPSNLLVSESGSIKIADFGVADVFEGDDALLSKTAGSPAFMAPESLQTSRDKYSGKAVDVWAMGITLYCFVFGKCPFEDENRMGLYEKIRTKDVVF 230          

HSP 2 Score: 64.3142 bits (155), Expect = 7.460e-65
Identity = 32/83 (38.55%), Postives = 52/83 (62.65%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSF 1605
            ++ +++DLL +ML K P+ERIT+ +IKEHPWVT  G+   P   Q N   IE++D +I +      +I+T++    M R ++F
Sbjct:  236 LNPKLEDLLLRMLTKNPKERITIPEIKEHPWVTRGGSDPLP-STQENCSHIEITDEDIANSVRTIPKIKTLILVKSMLRYKTF 317          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Match: EDO36169 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJE6])

HSP 1 Score: 117.087 bits (292), Expect = 9.274e-29
Identity = 65/178 (36.52%), Postives = 104/178 (58.43%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFS-DPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGK-FTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            LD + +I +E+   K   +PHI+KL++VI      +++M+ E++ GG +         L E+  R++F+ I+ G+DY H + +VHRD+KP NLL+D    +K+ DFG+S   T D  FLQ + GSP + APE +    GK + G  +DIW+ G+ L+  L G + FD  +   L+  I
Sbjct:   59 LDVVGKIRREIQNLKLFRHPHIIKLYQVISTPT--DIFMVMEYVSGGELFEYILKHGKLEEKDARRFFQQIISGVDYCHRHMVVHRDLKPENLLLDSQLNIKIADFGLSNIMT-DGEFLQTSCGSPNYAAPEVIS---GKLYAGPEVDIWSAGVILYALLCGTLPFDDEHIPTLFRKI 230          

HSP 2 Score: 28.8758 bits (63), Expect = 9.274e-29
Identity = 18/43 (41.86%), Postives = 22/43 (51.16%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWV-TENGNWAFP 1479
             +SS    LL  MLN  P +R T+  IKE  W  TE   + FP
Sbjct:  240 HLSSGPASLLNAMLNVDPIKRATVQFIKEDDWFKTELPGYLFP 282          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 119.013 bits (297), Expect = 7.303e-28
Identity = 69/184 (37.50%), Postives = 108/184 (58.70%), Query Frame = 3
Query:  783 IKDAYLDP--LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDP-LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            I    L+P  L+++++EV I K LD+P+IVKL+EVI ETD   +Y++ E+  GG V +   +   + E+  R  FR IV  + Y H   ++HRD+K  NLL+D +  +K+ DFG S +FT  +  L    GSP + APE  Q    K+ G  +D+W+LG+ L+  + G + FD +N  +L   +
Sbjct:   69 IDKTQLNPSSLQKLFREVRIMKFLDHPNIVKLYEVI-ETDK-TLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNK-LDTFCGSPPYAAPELFQG--KKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERV 247          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Match: EDO44439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVS7])

HSP 1 Score: 112.464 bits (280), Expect = 4.976e-27
Identity = 67/190 (35.26%), Postives = 106/190 (55.79%), Query Frame = 3
Query:  786 KDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDI-FLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            K+A    L R+ +E+   K L + HI +L+ VI ETD +N+YM+ E+ +GG + + +   D L E+  R +FR I+  + Y+H     HRD+KP NLL+D+   +KLIDFG+  +  G     L+   GSPA+ APE +      + G  +D+W++G+ L+  + G + FD  N   LY  I      +P
Sbjct:   47 KEALGHDLPRVQRELEAMKDLCHQHICQLYHVI-ETD-ENIYMVLEYAQGGELFDYIVAKDRLKEDEARGFFRQIISAVAYIHEKGYAHRDLKPENLLLDEEQNIKLIDFGLVAKPEGGMTEQLETCCGSPAYAAPELISGL--PYFGNEVDLWSMGVLLYALVCGFLPFDDDNTYKLYRLIQKGEYEIP 232          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 107.457 bits (267), Expect = 4.809e-26
Identity = 69/202 (34.16%), Postives = 110/202 (54.46%), Query Frame = 3
Query:  696 SRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDP-LSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGK-FTGKALDIWALGMTLHCFLFGKVAFDS 1295
             +GN   + L      K+  A    + S + D   D L ++ +EV + KKL +PHI+KLHEV+ ET+   +Y++ E+   G + +   +   + E+  +  F  IV  ++Y H   IVHRD+K  NLL+D++  +K+ DFG S  F  D   L+   GSP + APE  +   GK + G  +DIW+LG+ L+  + G + FD 
Sbjct:   27 GKGNFAVVKLATHCITKSKVAVKIIDKSQLDD---DNLTKVKREVKVMKKLAHPHIIKLHEVM-ETER-MLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMNIKIADFGFSNIFQADKK-LKTWCGSPPYAAPELFE---GKEYLGPEVDIWSLGVVLYVLVCGALPFDG 219          

HSP 2 Score: 29.6462 bits (65), Expect = 4.809e-26
Identity = 12/34 (35.29%), Postives = 22/34 (64.71%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTE 1458
            +S+E + L+  ML + P +R T+  I++H W+ E
Sbjct:  240 MSTECEHLIRHMLVRDPVKRFTIPQIRQHKWMAE 273          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2 [Source:NCBI gene;Acc:101173723])

HSP 1 Score: 258.455 bits (659), Expect = 2.918e-82
Identity = 135/338 (39.94%), Postives = 202/338 (59.76%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK+KLM+ +G+ RRP P                         RG   + +L   P +                    PL R+YQE+AI KKLD+P++VKL EV+D+   D++YM+FE ++ G VM V    P  E+  R YF+D++ G++YLH+ KI+HRD+KPSNLLV ++G +K+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ +P+
Sbjct:  156 SLPYSPITSPHSSPRLPRRP-----TVESHSVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPAP-------------------------RG---ARALPEGPTQPK-----------------GPLERVYQEIAILKKLDHPNVVKLVEVLDDPSEDHLYMVFELVKKGAVMEVPTDKPFGEDQARFYFQDLLRGIEYLHYQKIIHRDVKPSNLLVGEDGHIKIADFGVSNQFEGSDALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVFGVCPFMDERILSLHQKIKTQPVGIPE 442          

HSP 2 Score: 68.1662 bits (165), Expect = 2.918e-82
Identity = 42/126 (33.33%), Postives = 67/126 (53.17%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFNCQLSQN-SHPLGDQIIQST 1731
            IS ++KDLL KML K PE RIT+  IK H WVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP         F+  R + R   C  +Q  ++P+  + ++S 
Sbjct:  446 ISDDLKDLLFKMLEKNPETRITVPQIKVHSWVTRHGAEPLPPEDDNCCTLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP---------FDWGRKEERSSLCAPAQTPTNPVSGEGVRSV 562          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Match: si:ch73-62l21.1 (calcium/calmodulin-dependent protein kinase kinase 2 [Source:NCBI gene;Acc:101173723])

HSP 1 Score: 234.187 bits (596), Expect = 1.124e-74
Identity = 131/338 (38.76%), Postives = 194/338 (57.40%), Query Frame = 3
Query:  342 NIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLY-ALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            ++  +P+ +   SPR+  R      T ES  +S T D +  VQ+NQYK+  ++G+G+YG VKL  + D+N Y A+K++SK+KLM+ +G+ RRP P                         RG   + +L   P +                    PL R+YQE+AI KKLD+P++VKL EV     H  M  +   ++ G VM V    P  E+  R YF+D++ G++YLH+ KI+HRD+KPSNLLV ++G +K+ DFGVS QF G D  L  T+G+PAFLAPE + +    F+GKALD+WA+G+TL+CF+FG   F     + L+  I T+P+ +P+
Sbjct:  121 SLPYSPITSPHSSPRLPRRP-----TVESHSVSIT-DLQDCVQLNQYKLKDEIGKGSYGVVKLAYNEDDNTYYAMKVLSKKKLMRQAGFPRRPAP-------------------------RG---ARALPEGPTQPK-----------------GPLERVYQEIAILKKLDHPNVVKLVEV----SHLTMLKL---VKKGAVMEVPTDKPFGEDQARFYFQDLLRGIEYLHYQKIIHRDVKPSNLLVGEDGHIKIADFGVSNQFEGSDALLTSTVGTPAFLAPEALSETRKNFSGKALDVWAMGVTLYCFVFGVCPFMDERILSLHQKIKTQPVGIPE 400          

HSP 2 Score: 67.3958 bits (163), Expect = 1.124e-74
Identity = 35/86 (40.70%), Postives = 51/86 (59.30%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            IS ++KDLL KML K PE RIT+  IK H WVT +G    P ++ +    IEV++ E+++       + T++    M R+RSF NP
Sbjct:  404 ISDDLKDLLFKMLEKNPETRITVPQIKVHSWVTRHGAEPLPPEDDNCCTLIEVTEEEVENSVKHIPSLATVILVRTMLRKRSFGNP 489          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Match: camkk1b (calcium/calmodulin-dependent protein kinase kinase 1-like [Source:NCBI gene;Acc:101160011])

HSP 1 Score: 221.476 bits (563), Expect = 1.402e-69
Identity = 126/314 (40.13%), Postives = 184/314 (58.60%), Query Frame = 3
Query:  417 TRESSLMSTTE-DEEGLVQINQYKVLRDLGRGAYGFVKLVEDR-DENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            T E+  +S T+ D +  VQ+NQYK+ +++G+G+YG VKL  D   E  YA+K++SK+KLM+  G+ R PP             N +Q  Y      +G L                               PL +IY+E+AI KKLD+ ++V L EV+D+ D D ++M FE +   PVM +   +PL E   R YFRD+V G++Y H++KI+HRDIKPSNLL+  +G +K+ DFGVS +F G D  L  T G+PAF+APE + +    F+GKALD+WA+G+TL+CF+FGK  F     + L++ I  KP+  P+
Sbjct:   73 TIETKRVSITDADLQDCVQMNQYKLKKEIGKGSYGVVKLAYDEGSEQYYAMKVVSKKKLMRQCGFLRLPPA------------NLQQDGY-----PKGML-------------------------------PLDKIYREIAILKKLDHHNVVNLVEVLDDPDEDGLHM-FE-LMTRPVMEIPTDEPLKEGQARFYFRDLVLGIEY-HYHKIIHRDIKPSNLLLGDDGHLKIADFGVSNEFEGTDDLLSTTAGTPAFMAPETMTEHFQFFSGKALDVWAMGVTLYCFVFGKCPFYDEYIVSLHNKIKNKPVEFPE 335          

HSP 2 Score: 63.1586 bits (152), Expect = 1.402e-69
Identity = 32/87 (36.78%), Postives = 52/87 (59.77%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNP 1614
            +IS E+K L+ +ML+K P  RIT+ +IK HPWVTEN     P + +H  + +EV++ ++ +       +  ++    M R+RSF NP
Sbjct:  337 EISDELKHLIERMLDKNPATRITVPEIKLHPWVTENSLNPLPLEEEH-CKAVEVTEEDVQNSVKLIPSLSAVILVKAMLRKRSFSNP 422          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Match: camkk1a (calcium/calmodulin dependent protein kinase kinase 1 [Source:NCBI gene;Acc:101171272])

HSP 1 Score: 225.713 bits (574), Expect = 2.676e-69
Identity = 102/186 (54.84%), Postives = 136/186 (73.12%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            L PL R+YQE+AI KKLD+ +IVKL EV+D+   DN++M+FE +  GPVM V    P SEE  R YFRDI+ G++YLH+ KI+HRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + + H  F+GKALD+WA+G+TL+CF+FGK  F     + L++ I TKP+  P+T
Sbjct:  177 LGPLERVYQEIAILKKLDHVNIVKLVEVLDDPSDDNLHMVFELMPKGPVMEVPAEHPFSEEQARLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSEKHKSFSGKALDVWAMGVTLYCFVFGKCPFIDEYILALHNKIKTKPVDFPET 362          

HSP 2 Score: 57.7658 bits (138), Expect = 2.676e-69
Identity = 39/121 (32.23%), Postives = 62/121 (51.24%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDP-RNQTREFNC--QLSQNSHPL 1707
            +IS  ++ L+ +ML+K P+ RIT+ +IK   WVT+ G    P + +H S  +EV++ EI +       +  ++    M R+RSF NP         FE P R + R  +    L  +S PL
Sbjct:  364 EISEALRTLILRMLDKNPDTRITIPEIKVDQWVTKGGTEPLPLEEEHCS-VVEVTEEEIQNSVKFVPSLSAVILVKAMLRKRSFSNP---------FESPSRREERSMSAPGSLLMDSWPL 474          

HSP 3 Score: 59.6918 bits (143), Expect = 7.106e-9
Identity = 32/78 (41.03%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  375 LSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGY 605
            +SPR++ R      T ES  +S + D +  +Q+NQYK+  ++G+G+YG VKL  + D++  YA+K+ SK+KLMK  G+
Sbjct:   86 ISPRVSHRP-----TVESKRVSIS-DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKHYAMKVFSKKKLMKQCGF 157          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Match: camkk1a (calcium/calmodulin dependent protein kinase kinase 1 [Source:NCBI gene;Acc:101171272])

HSP 1 Score: 225.328 bits (573), Expect = 2.884e-69
Identity = 102/186 (54.84%), Postives = 136/186 (73.12%), Query Frame = 3
Query:  798 LDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            L PL R+YQE+AI KKLD+ +IVKL EV+D+   DN++M+FE +  GPVM V    P SEE  R YFRDI+ G++YLH+ KI+HRDIKPSNLL+  +G VK+ DFGVS QF G+D  L  T G+PAF+APE + + H  F+GKALD+WA+G+TL+CF+FGK  F     + L++ I TKP+  P+T
Sbjct:  177 LGPLERVYQEIAILKKLDHVNIVKLVEVLDDPSDDNLHMVFELMPKGPVMEVPAEHPFSEEQARLYFRDIILGIEYLHYQKIIHRDIKPSNLLLGDDGHVKIADFGVSNQFEGNDALLSSTAGTPAFMAPETLSEKHKSFSGKALDVWAMGVTLYCFVFGKCPFIDEYILALHNKIKTKPVDFPET 362          

HSP 2 Score: 57.7658 bits (138), Expect = 2.884e-69
Identity = 31/90 (34.44%), Postives = 52/90 (57.78%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKS 1623
            +IS  ++ L+ +ML+K P+ RIT+ +IK   WVT+ G    P + +H S  +EV++ EI +       +  ++    M R+RSF NP +S
Sbjct:  364 EISEALRTLILRMLDKNPDTRITIPEIKVDQWVTKGGTEPLPLEEEHCS-VVEVTEEEIQNSVKFVPSLSAVILVKAMLRKRSFSNPFES 452          

HSP 3 Score: 59.6918 bits (143), Expect = 7.214e-9
Identity = 32/78 (41.03%), Postives = 52/78 (66.67%), Query Frame = 3
Query:  375 LSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENL-YALKIISKRKLMKSSGY 605
            +SPR++ R      T ES  +S + D +  +Q+NQYK+  ++G+G+YG VKL  + D++  YA+K+ SK+KLMK  G+
Sbjct:   86 ISPRVSHRP-----TVESKRVSIS-DSQDCIQLNQYKLKSEIGKGSYGVVKLAYNEDDDKHYAMKVFSKKKLMKQCGF 157          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Match: SMESG000070678.1 (SMESG000070678.1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 418/420 (99.52%), Postives = 418/420 (99.52%), Query Frame = 3
Query:   96 MKRVDLEDNVIDNENEKIIQSNYNDATPENVVENNISAARVEWNFSVSRPSFSVPESNTSIFYKNVYENLLKQTPSNQLEIENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 1355
            MKRVDLEDNVIDNENEKIIQSNYNDATPENVVE NISAARVEWNFSVSRPSFSVPESNTSIFYKNVYENLLKQTPSNQLEIENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVS QFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT
Sbjct:    1 MKRVDLEDNVIDNENEKIIQSNYNDATPENVVEKNISAARVEWNFSVSRPSFSVPESNTSIFYKNVYENLLKQTPSNQLEIENIKVNPLVNAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVEDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSCQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQT 420          

HSP 2 Score: 168.703 bits (426), Expect = 8.736e-45
Identity = 79/80 (98.75%), Postives = 80/80 (100.00%), Query Frame = 1
Query: 1354 QISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMAR 1593
            +ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMAR
Sbjct:  422 EISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHCTVKPVRIQTIVSALMMAR 501          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Match: SMESG000067484.1 (SMESG000067484.1)

HSP 1 Score: 256.914 bits (655), Expect = 6.948e-79
Identity = 142/312 (45.51%), Postives = 202/312 (64.74%), Query Frame = 3
Query:  420 RESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVED-RDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            R+ S +S TED   +V +NQY++ + +G+G+YG V+L  + +D N YA+K +SK+KLMKSSG F RPPP+R +++S                       S    +SPQR +                 DPL++IY+E+A +KKL++ +IVKL EV+D+   + +YM+FE++E GPVM +G   P  E   RKY  D + GL+YLH+ KI+HRDIKP+NLL+ K  ++K+ DFGVS +FTGDD++L  T+GSPAF+APE V+D    FTGKALDIWALG+TL+ FLFGKV  ++ N+  LY  I   PI+ P+
Sbjct:  135 RDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSM----------------------SSMGTKSPQRAS-----------------DPLQKIYKEIAFHKKLNHTNIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPE 407          

HSP 2 Score: 58.151 bits (139), Expect = 6.948e-79
Identity = 33/104 (31.73%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQH-NSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQT 1665
            +S  V DLL KML+K P ERI + +IK H W+T +G    P + ++     I+V+++E+ +      R++T++   M+ +++SF NP + F +  +  + +N T
Sbjct:  411 VSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR-FGSVSRINETKNGT 513          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Match: SMESG000067484.1 (SMESG000067484.1)

HSP 1 Score: 256.529 bits (654), Expect = 1.106e-78
Identity = 142/312 (45.51%), Postives = 202/312 (64.74%), Query Frame = 3
Query:  420 RESSLMSTTEDEEGLVQINQYKVLRDLGRGAYGFVKLVED-RDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNSRQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILPQ 1352
            R+ S +S TED   +V +NQY++ + +G+G+YG V+L  + +D N YA+K +SK+KLMKSSG F RPPP+R +++S                       S    +SPQR +                 DPL++IY+E+A +KKL++ +IVKL EV+D+   + +YM+FE++E GPVM +G   P  E   RKY  D + GL+YLH+ KI+HRDIKP+NLL+ K  ++K+ DFGVS +FTGDD++L  T+GSPAF+APE V+D    FTGKALDIWALG+TL+ FLFGKV  ++ N+  LY  I   PI+ P+
Sbjct:  133 RDVSSISVTEDSNRIVHLNQYQIRQQIGQGSYGLVQLAYNSKDSNYYAMKSLSKKKLMKSSGLFNRPPPIRKSTSSM----------------------SSMGTKSPQRAS-----------------DPLQKIYKEIAFHKKLNHTNIVKLIEVLDDPSQEFLYMVFEYVENGPVMEIGKDSPFPEIKARKYIIDTLLGLEYLHYQKIIHRDIKPANLLLSKLDVIKISDFGVSNEFTGDDVYLSSTVGSPAFMAPESVRDGDHCFTGKALDIWALGITLYAFLFGKVPLENCNRFLLYQMIINNPILYPE 405          

HSP 2 Score: 57.7658 bits (138), Expect = 1.106e-78
Identity = 33/104 (31.73%), Postives = 61/104 (58.65%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQH-NSQQIEVSDNEIDHCTVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQT 1665
            +S  V DLL KML+K P ERI + +IK H W+T +G    P + ++     I+V+++E+ +      R++T++   M+ +++SF NP + F +  +  + +N T
Sbjct:  409 VSVGVMDLLHKMLDKNPLERIKIPNIKVHQWITNDGKNQLPTEAENCGFASIDVNEDEVANSIRFVPRLETVIKIKMLLKQKSFANPLR-FGSVSRINETKNGT 511          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Match: SMESG000055720.1 (SMESG000055720.1)

HSP 1 Score: 122.094 bits (305), Expect = 7.077e-35
Identity = 68/183 (37.16%), Postives = 112/183 (61.20%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGVSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGK-FTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSIATKPIILP 1349
            LRR  Q + +++   +PHI+KL++VI  +   +++MI E++ GG + + +  S  L+E+  RK+F+ IV G+DY H +K+VHRD+KP NLL+D    VK+ DFG+S     D  FL+ + GSP + APE +    GK + G  +D+W+ G+ L+  L G + FD  +  +L+  I +    +P
Sbjct:   68 LRREIQNLWLFR---HPHIIKLYQVI--STPTDIFMIMEYVSGGELFDHIVKSGKLNEKDARKFFQQIVSGVDYCHRHKVVHRDLKPENLLLDSQKNVKIADFGLS-NIMQDGEFLRTSCGSPNYAAPEVIS---GKLYAGPEVDVWSCGVILYALLCGTLPFDDEHIPNLFKKIKSGLFHMP 241          

HSP 2 Score: 45.8246 bits (107), Expect = 7.077e-35
Identity = 23/60 (38.33%), Postives = 39/60 (65.00%), Query Frame = 1
Query: 1339 LFYL-KQISSEVKDLLTKMLNKIPEERITLNDIKEHPW-VTENGNWAFPHKNQHNSQQIE 1512
            LF++   +SS VKDLL KML   P +R+T+ +I++HPW + +  N+ FP +   ++  I+
Sbjct:  237 LFHMPDYLSSNVKDLLKKMLTVDPVKRVTVEEIRKHPWFIIDLPNYLFPQERDEDASIID 296          
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Match: SMESG000004364.1 (SMESG000004364.1)

HSP 1 Score: 110.923 bits (276), Expect = 2.399e-28
Identity = 56/175 (32.00%), Postives = 103/175 (58.86%), Query Frame = 3
Query:  807 LRRIYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMN-VGFSDPLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFGV-SFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHCFLFGKVAFDSRNKIDLYHSI 1325
            L ++ +E++I K +++PH++ L++V +   +  +Y++ EH+ GG + + +     LS +  RK+F+ I+  LD+ H + I HRD+KP NLL+D    +++ DFG+ S Q  G    L+ + GSP +  PE ++    K+ G+  D+W+ G+ L+  L G + FD  N  +L   +
Sbjct:   56 LMKVEREISIMKLIEHPHVLGLYDVYENRRY--LYLVLEHVSGGELFDYLVKKGRLSVKEARKFFKQIISALDFCHCHCICHRDLKPENLLLDDKLNIRVADFGMASLQPEGS--MLETSCGSPHYACPEVIRG--EKYDGRKADVWSCGVILYALLVGALPFDDDNLRNLLEKV 224          

HSP 2 Score: 34.6538 bits (78), Expect = 2.399e-28
Identity = 12/38 (31.58%), Postives = 25/38 (65.79%), Query Frame = 1
Query: 1357 ISSEVKDLLTKMLNKIPEERITLNDIKEHPWVTENGNW 1470
            + ++ ++L+  M+   P++RI L D+  HPWVT + ++
Sbjct:  235 VPADCQNLMRSMIEVNPKKRINLEDVLRHPWVTADNDF 272          
The following BLAST results are available for this feature:
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMKK16.714e-7543.38calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK19.124e-7543.38calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK25.045e-7039.42calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK25.480e-7039.42calcium/calmodulin dependent protein kinase kinase... [more]
CAMKK25.615e-7039.42calcium/calmodulin dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ckk-19.162e-6939.74Calcium/calmodulin-dependent protein kinase kinase... [more]
ckk-11.314e-6838.44Calcium/calmodulin-dependent protein kinase kinase... [more]
sad-14.528e-3032.97Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
sad-16.846e-3034.09Serine/threonine kinase SAD-1 [Source:UniProtKB/S... [more]
aak-22.695e-2735.005'-AMP-activated protein kinase catalytic subunit ... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG176987.199e-5933.72gene:FBgn0040056 transcript:FBtr0333912[more]
CG176983.054e-5531.75gene:FBgn0040056 transcript:FBtr0333914[more]
CG176981.507e-4942.78gene:FBgn0040056 transcript:FBtr0111166[more]
CG176986.682e-3831.80gene:FBgn0040056 transcript:FBtr0333913[more]
sff1.220e-3035.33gene:FBgn0036544 transcript:FBtr0089527[more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camkk1b5.053e-7841.85calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b9.267e-7841.85calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b9.267e-7841.85calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1a2.570e-6553.76calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1a4.712e-6553.76calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fam13b1.555e-8140.11family with sequence similarity 13 member B [Sourc... [more]
fam13b1.945e-8140.11family with sequence similarity 13 member B [Sourc... [more]
ENSXETT00000001488.12.077e-7839.04calcium/calmodulin-dependent protein kinase kinase... [more]
ENSXETT00000001514.12.732e-7839.04calcium/calmodulin-dependent protein kinase kinase... [more]
ENSXETT00000001390.11.694e-7437.98calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camkk11.431e-7243.05calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk11.430e-6742.42calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk21.148e-6449.45calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk21.226e-6449.45calcium/calmodulin-dependent protein kinase kinase... [more]
Camkk26.959e-6449.45calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8N5S9|KKCC1_HUMAN2.955e-7443.38Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|P97756|KKCC1_RAT3.476e-7343.05Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|Q8VBY2|KKCC1_MOUSE8.698e-7243.05Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|Q96RR4|KKCC2_HUMAN2.472e-6939.42Calcium/calmodulin-dependent protein kinase kinase... [more]
sp|O88831|KKCC2_RAT2.586e-6840.20Calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GEH06.636e-9145.61Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8JDD77.973e-9145.61Protein kinase domain-containing protein OS=Macros... [more]
A0A267DD884.478e-9045.17Protein kinase domain-containing protein OS=Macros... [more]
A0A267DDB41.920e-8945.04Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8ITF92.480e-8447.77Protein kinase domain-containing protein OS=Macros... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-62l21.12.826e-8440.83calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.14.244e-8440.83calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.14.244e-8440.83calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.14.575e-8440.83calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.11.354e-7939.41calcium/calmodulin-dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000006410.12.390e-2736.76pep scaffold:Pmarinus_7.0:GL476370:17405:31068:-1 ... [more]
MARK35.374e-2737.10microtubule affinity regulating kinase 3 [Source:H... [more]
snrka5.920e-2732.85SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
MARK31.700e-2637.50microtubule affinity regulating kinase 3 [Source:H... [more]
ENSPMAT00000003561.16.004e-2230.99pep scaffold:Pmarinus_7.0:GL478057:5187:43749:1 ge... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
TOS36.409e-3736.04Protein kinase; related to and functionally redund... [more]
SAK19.212e-3235.56Upstream serine/threonine kinase for the SNF1 comp... [more]
KIN21.545e-3035.96Serine/threonine protein kinase involved in regula... [more]
KIN13.861e-2833.52Serine/threonine protein kinase involved in regula... [more]
GIN41.371e-2736.88Protein kinase involved in bud growth and assembly... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355227.460e-6550.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361699.274e-2936.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307687.303e-2837.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO444394.976e-2735.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460354.809e-2634.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch73-62l21.12.918e-8239.94calcium/calmodulin-dependent protein kinase kinase... [more]
si:ch73-62l21.11.124e-7438.76calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1b1.402e-6940.13calcium/calmodulin-dependent protein kinase kinase... [more]
camkk1a2.676e-6954.84calcium/calmodulin dependent protein kinase kinase... [more]
camkk1a2.884e-6954.84calcium/calmodulin dependent protein kinase kinase... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase kinase 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070678.18.736e-4599.52SMESG000070678.1[more]
SMESG000067484.16.948e-7945.51SMESG000067484.1[more]
SMESG000067484.11.106e-7845.51SMESG000067484.1[more]
SMESG000055720.17.077e-3537.16SMESG000055720.1[more]
SMESG000004364.12.399e-2832.00SMESG000004364.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016333 ID=SMED30016333|Name=Calcium/calmodulin-dependent protein kinase kinase 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2248bp
TGCAAGGTTGTTAGAAAAATAATTAATTTTAAGATGAAAAAAATTTTAAT
TTAAAGTTCTTCAAGATGCGATCGTCCCAAAAAAACATCTTTAAAATGAA
GAGAGTCGATTTGGAAGATAATGTAATTGATAATGAAAATGAAAAAATAA
TTCAATCAAATTACAATGATGCCACACCAGAAAATGTAGTTGAAAATAAT
ATTTCAGCAGCACGAGTTGAGTGGAATTTCTCAGTTTCGAGACCTTCATT
TTCTGTTCCAGAATCCAACACGTCAATATTTTATAAAAACGTTTACGAGA
ATCTTTTGAAACAAACTCCTTCCAATCAATTAGAAATAGAAAACATAAAA
GTGAATCCTTTGGTTAACGCAGTATTGAGTCCTAGGATGAATTTCAGGGC
TTCGAAAAGTCTTTCAACTCGAGAAAGTAGTCTGATGTCGACAACTGAAG
ATGAAGAGGGTCTCGTTCAAATAAACCAGTATAAAGTGCTTCGAGATCTT
GGAAGAGGTGCCTATGGATTTGTGAAATTGGTTGAAGATCGAGATGAAAA
TTTATATGCATTGAAAATTATTTCGAAGAGAAAACTCATGAAATCTTCTG
GTTATTTCAGGAGGCCTCCTCCACTAAGAAATACGAGCACGTCTTCTTTT
TGTGAGGACAACTCTCGTCAAACTATGTATCAGAGTAATAGTCCTTCAAG
AGGTAACCTGGACTCTCTATCTCTTCAAAGGTCCCCACAAAGAAAGAATC
TCTGGGCTGCTAATTCAACAAACGATTCCTCGATTAAGGATGCTTATTTA
GATCCGTTACGACGCATTTATCAAGAAGTCGCTATATATAAGAAACTGGA
CAATCCTCATATTGTAAAGCTCCATGAGGTTATAGACGAGACTGATCATG
ATAATATGTATATGATATTTGAACATATCGAAGGAGGACCAGTGATGAAT
GTAGGATTTTCTGACCCTTTATCTGAAGAATTAACTCGAAAATATTTCAG
AGACATTGTTTGTGGTCTGGACTATTTGCACTTCAATAAAATAGTCCATC
GTGATATCAAACCATCAAATTTGTTGGTGGACAAGAATGGTCTCGTTAAA
TTAATTGATTTTGGTGTTAGTTTCCAATTTACTGGGGATGACATTTTTCT
TCAAGACACGCTTGGCTCCCCAGCTTTTCTGGCTCCGGAGTGCGTTCAAG
ATTGCCATGGTAAATTCACTGGAAAGGCGCTTGACATTTGGGCTTTGGGA
ATGACTCTTCATTGCTTTCTGTTTGGAAAGGTCGCGTTTGACAGTCGGAA
CAAAATTGATTTATATCATTCAATCGCAACAAAGCCAATTATTTTACCTC
AAACAAATTAGTTCGGAAGTAAAAGATCTTTTAACAAAAATGCTCAACAA
AATACCTGAAGAACGAATTACTTTGAATGATATCAAAGAGCATCCGTGGG
TTACAGAAAATGGAAATTGGGCTTTCCCACACAAAAATCAGCACAATAGT
CAACAAATAGAAGTCTCAGACAATGAAATTGATCATTGTACAGTGAAACC
AGTTCGTATACAAACTATCGTGTCAGCTTTAATGATGGCCAGACGTAGGT
CGTTTAGGAATCCGAAAAAAAGCTTTGATAATTTCATCAAGTTTGAAGAT
CCAAGAAATCAAACTAGAGAATTCAATTGCCAATTGTCACAAAATAGCCA
CCCGTTGGGTGATCAAATTATTCAGTCGACATTCGACGATTTGTCTCAGT
TGGATCAGTCAAAATCACAACACATAAAACCGGATCCAACTTCTCCAGGA
GGAGAAATAAATTCCAATCCAACAACGTCTCAAAATTTGGACACGCTCCG
AGTTCTATGGAAGGAACTCTTCAAATCTCGAAGAAAGATCGCGGACTAAC
ATAACCAACTTCTACAAATGGATCGAGAAATGCAAAAGATCAAGGCGATG
TGGATGGAACCATCGCGGGCAGAACTAACCTATCAGAGCCTAACCACCGC
CCAAAAGGGATGGGTAGAAGAAAACAGATGGCCCAAAACCAAAAACCTCA
AATCAGGAGCTTAGAGGTAGCACTGTCGGCTTGCCAAGAAGGCAACGCAG
TGACATACCCTCTGGTTTTGCTTCAGTGCAAATACCATACCGGGAATCCA
AAACCATGGTCCAGCAGGCAGTACCCAAACGACCTCATCCCCGACCTGGA
AAGCAGAGCAAGCAAAACGACGATTACAAAAATCAACGTAAAATTATC
back to top

protein sequence of SMED30016333-orf-1

>SMED30016333-orf-1 ID=SMED30016333-orf-1|Name=SMED30016333-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=170bp
MLNKIPEERITLNDIKEHPWVTENGNWAFPHKNQHNSQQIEVSDNEIDHC
TVKPVRIQTIVSALMMARRRSFRNPKKSFDNFIKFEDPRNQTREFNCQLS
QNSHPLGDQIIQSTFDDLSQLDQSKSQHIKPDPTSPGGEINSNPTTSQNL
DTLRVLWKELFKSRRKIAD*
back to top

protein sequence of SMED30016333-orf-2

>SMED30016333-orf-2 ID=SMED30016333-orf-2|Name=SMED30016333-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=432bp
MRSSQKNIFKMKRVDLEDNVIDNENEKIIQSNYNDATPENVVENNISAAR
VEWNFSVSRPSFSVPESNTSIFYKNVYENLLKQTPSNQLEIENIKVNPLV
NAVLSPRMNFRASKSLSTRESSLMSTTEDEEGLVQINQYKVLRDLGRGAY
GFVKLVEDRDENLYALKIISKRKLMKSSGYFRRPPPLRNTSTSSFCEDNS
RQTMYQSNSPSRGNLDSLSLQRSPQRKNLWAANSTNDSSIKDAYLDPLRR
IYQEVAIYKKLDNPHIVKLHEVIDETDHDNMYMIFEHIEGGPVMNVGFSD
PLSEELTRKYFRDIVCGLDYLHFNKIVHRDIKPSNLLVDKNGLVKLIDFG
VSFQFTGDDIFLQDTLGSPAFLAPECVQDCHGKFTGKALDIWALGMTLHC
FLFGKVAFDSRNKIDLYHSIATKPIILPQTN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR011009Kinase-like_dom_sf
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR008271Ser/Thr_kinase_AS
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0004683calmodulin-dependent protein kinase activity
GO:0005515protein binding
GO:0005516calmodulin binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0018105peptidyl-serine phosphorylation
GO:0018107peptidyl-threonine phosphorylation
GO:0035556intracellular signal transduction
GO:0045860positive regulation of protein kinase activity
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol