Cubilin (intrinsic factor-cobalamin receptor)

Overview
NameCubilin (intrinsic factor-cobalamin receptor)
Smed IDSMED30016328
Length (bp)11274
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cubilin (intrinsic factor-cobalamin receptor) (SMED30016328) t-SNE clustered cells

Violin plots show distribution of expression levels for Cubilin (intrinsic factor-cobalamin receptor) (SMED30016328) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cubilin (intrinsic factor-cobalamin receptor) (SMED30016328) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cubilin (intrinsic factor-cobalamin receptor) (SMED30016328) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016328

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 28

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30016328SMESG000068883.1 SMED_29161_V2_1GPL14150_gene_modelsPMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30016328SMESG000068883.1 SMED_29161_V2_1GPL14150PMID:23318641
Chen et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
Smed sexual biotypeSMED30016328SMESG000078113.1 SMESG000077700.1 SMESG000077543.1 SMESG000073202.1 SMESG000068883.1 SMESG000065750.1 SMESG000065674.1 SMESG000063581.1 SMESG000061682.1 SMESG000057238.1 SMESG000056863.1 SMESG000055411.1 SMESG000051647.1 SMESG000051412.1 SMESG000051204.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000042145.1 SMESG000041707.1 SMESG000039936.1 SMESG000038929.1 SMESG000038659.1 SMESG000035066.1 SMESG000034883.1 SMESG000028188.1 SMESG000026760.1 SMESG000022177.1 SMESG000017179.1 SMESG000016928.1 SMESG000016676.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000062819.1 Contig12485newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000078113.1 SMESG000077700.1 SMESG000077543.1 SMESG000073202.1 SMESG000068883.1 SMESG000065750.1 SMESG000065674.1 SMESG000063581.1 SMESG000061682.1 SMESG000057238.1 SMESG000056863.1 SMESG000055411.1 SMESG000051647.1 SMESG000051412.1 SMESG000051204.1 SMESG000047714.1 SMESG000046897.1 SMESG000045052.1 SMESG000044505.1 SMESG000042145.1 SMESG000041707.1 SMESG000039936.1 SMESG000038929.1 SMESG000038659.1 SMESG000035066.1 SMESG000034883.1 SMESG000028188.1 SMESG000026760.1 SMESG000022177.1 SMESG000017179.1 SMESG000016928.1 SMESG000016676.1 SMESG000013251.1 SMESG000012925.1 SMESG000008868.1 SMESG000062819.1 Contig12485uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068882.1 SMESG000068883.1 SMESG000003971.1 Contig12484newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068882.1 SMESG000068883.1 SMESG000003971.1 Contig12484uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30016328SMESG000068883.1 dd_Smed_v4_4575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016328SMESG000068883.1 dd_Smed_v4_4575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016328SMESG000068883.1 dd_Smed_v4_4575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016328SMESG000068883.1 dd_Smed_v4_4575_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 SMESG000068882.1 Contig42995newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 SMESG000068882.1 Contig42995uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig35073newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig35073uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig38525newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig38525uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig30820newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig30820uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig49508newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig49508uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig37261newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016328SMESG000068883.1 Contig37261uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30016328SMESG000068883.1 SMESG000068882.1 Contig42995newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30016328SMESG000068883.1 SMESG000068882.1 Contig42995uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
protonephridiaSMED30016328SMESG000068883.1 dd_Smed_v6_4575_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30016328SMESG000068883.1 Contig35073newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016328SMESG000068883.1 Contig35073uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
protonephridiaSMED30016328SMESG000068883.1 dd_Smed_v4_4575_0_1dd_Smed_v4PMID:30962434
Cote et al., 2019
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Human
Match: CUBN (cubilin [Source:HGNC Symbol;Acc:HGNC:2548])

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 938/3813 (24.60%), Postives = 1612/3813 (42.28%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIP--INLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITACNQNMYFNKKFIVNRFM-------VHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI--PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREML--------SENHLK-VENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFY-AETRKIAISFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIH-DNQTK--RFCGNHAKSGPTVT---HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEKLSNS-FTCFYSIKVPQFKKILI---NITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIK-----INHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--------FPITSSSGRIESKNEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGK--MANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTL-ILSAEGYRYPGFLIRW---NPPVDENFKKI--GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII--CNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGC---FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEV--FGSGAT----ISFSYNSDQPSLCGSNIYPNNNES-----GVITIENVNISL-CQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM---SNYRVE-IG----YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCG-LNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRI---IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYL---------PGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFM--GELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL---GNNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISW 11188
            PR+ ++ GN++F T S+++I F T + G+I+LND DLS    +I+K           K+   EL  S + +     +++ + +   N K+  LE +   +++ +    C++NPC NG  C++ ++SF CICP  +KG  C+ DVNEC   SGT   CQNG  C NT+GS+ C C  +  G  C    + C   S    C HG C         +P + C+CD+GW   P +  C  D DEC     PCS    V C NT G   C  CP G++GNG+ C DINEC       +  P  ECVN  G+  C+      +    +C L ++C  +NGGC  +A+CS+    +   +CTC PGY+G+G G NGCV +S N+       C+    C NG  C  +++G+ C+C  G+ G  C   IN +CLSNPCLNGG C     + + C C  L++G  C+    VCG + +  N       F+   P         C W I +   + L+I      L+ + +C  E++Q+++      +   +G++C   +S P    ++ + L        +++   GF ++        +  +C     G         G  +SP +P  Y    +C             V     TL L +   +C + DYL+I    R+  +        F   F V           +HFHSDS+  ++   F   +  + S   CG   T +P   +  P +  P      C + +KQ    ++                +  +  E+        ++I  +  E L        + +H+K + N  +I FK    +    F+   + ACG+ +  + +     +S  +P  Y G   C +  +  +++ I ++F  F+I   + C+ D+++I  S+      +++YC  +    IT   N     + +TF  +S+    GF AK S  D      LT          H N         Y     CTW I    +  I  +F+ FHLE H NC  DYLE+   D++T   R+CG      P++T   + L++ FV+D+ ++ EGF++ +  +     C + +    G  T+P       + + C Y I V   + I +   N ++ E+ G+ +      +         +G    +N+ PT      I + SN   + +   Q      F+   + SS    CG    ++ G   SPNYP+    ++ C W ++S+ G    ++     + H  + ++D   + +  +     +T       +C ++   +      S+ +  +     + R F+  Y Q CE        + I  S G     +E  ++C+W + +  G+ +      FDL    N     ++ + D    +  + CG  L     T+S+  +++   TD      V R  +G  +++   GC           + S   G   S  FPN    N +C W  +T PG S++L     ++E    C+   +L  +         + Q C +      + + S+ +   ++F +    NG  R F  +++     C        G I SPNYP+ Y  N  CSW ++V  +  + L   DF+ E    +   +  +  +++ + +L   CG+  +AN I     S  N + ++F++  +  +RGF+A++ + CGG  +   S   + SP +P  Y  P+   C W + A      + + F     E    +  C+ D  + I++G   ++ ++   C     HPI   S+   L+ +  S+     F        S CGG FY+ +G+F SP YP+    +++CV+ I +SPG+ + LS   F  E++      DF++IR G N T  L+GR+   S   NY+       ++W+R  S G    +   F A +  I  N      +G +ASP +   Y  ++   WTV   +S  +     +  +   + N  C    L IYD  +  A++   +CG+     +     +T    S       GFL+ W   + P D     I  G C   ++  +    L SP +P+    R  CTW I    +  +++ +LS D+ES   C Y++  +   G  N     +     V CG            Y+F    I + +D      GF  S+ K+C   + +   G + + +YP     N NC++ +L    L   ++       P  +  C  G   +L                N   CGS+    L    T+ + + V    + S+E +  GF+I Y  K   CGG   +    DS     + N  H  P   +C W   +PP TR+Q+ FE+     +   C  ++L   DG  +    +    FCG +  +S ++ G V+ + F++ +  ++  F+ K  I  CGG +  + G + S  +P L Y     C W + G S   + ++F D +L     C K  + +     S N ++   C ++  D I T  +T  + F T+   T  GF+L++      CGG+         S NYP        C W+I     +RI +    L++  +  C     I   G+   S  L  +C+S   + EI +  + ++V  F  G+      + SY S + ++CG ++ PN  E      G   + N + +L C++ + N  +   ++S+   D          F  +     +  V +F  G  +   M+      K    +  P  +V +   +N RVE IG    Y F+ CGG+     G I SP YP  Y   T C  L+ AP+   I LT     +E H  C +D + +R     +SP   + CG  NP    T+    N++ ++F+SD S+   GF   +N       C GI  +  G+I+SP++P+ +P N RC+WT    +   + ++F   F L  +    C    +++    +     LL+  CGN+ P  P+ +  N  + VF +      +GF A + S CG  +    G I+S N       ++ C Y+I    N L VV +   F                 +G ++         P   +CG        +    +   Y+        + F  R +    V  FS      ++ +P +  + Y ++ +  +        +  +     D+  S   C++D+++    ++ S   +  FCG+    +    + ++L+V F++D   ++   G+      T GP  GCGGY+  +  T+    S D D+NG+Y+ NL C W I AP    + + F  N+ +LE  S    C YD++ +YDG      +  T CG        +  N + + F +D  +++ GF  T+T +          T   Q + S   PN+S  D+ F     +I +     + ITV  L++ +S +C+ +   +QD+   H N   +FC  + S   VF SS    ++ ++ G + N NS    R   +Y++  CNR      G + +        Y ++  C +TL  P  N     +F    +E S  C  D+++   G       +L K CG+ +P    + ++ + + F +D   +  GY+I +     PS  CGG +Y D G  TSPG+   Y  +  C W +   +   +   F  + +   G+      T Y   +    S G     YCG       F   S+   +++ +      + FR++W
Sbjct:   42 PRMATERGNLVFLTGSAQNIEFRTGSLGKIKLNDEDLSECLHQIQKN----------KEDIIELKGSAIGL----PQNISSQIYQLNSKLVDLERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGS-VARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCST--LVQCFNTQGSFYCGACPTGWQGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGCHPDASCSSTLGSLP--LCTCLPGYTGNGYGPNGCVQLS-NI-------CLSHP-CLNG-QCIDTVSGYFCKCDSGWTGVNCTENIN-ECLSNPCLNGGTCVDGV-DSFSCECTRLWTGALCQVPQQVCGESLSGIN-----GSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGD--SSSAFQLGRFC--GSSLPHELLSSDNALYFHL-YSEHLRNGRGFTVR-----WETQQPECGGILTGPY-------GSIKSPGYPGNYPPGRDCVWIVVTS--PDLLVTFTFGTLSL-EHHDDC-NKDYLEI----RDGPLYQDPLLGKFCTTFSVPPLQTTGPFARIHFHSDSQ--ISDQGFHITYLTSPSDLRCGGNYT-DPEGELFLPELSGPFTHTRQCVYMMKQPQGEQI---------------QINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGV----IRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFITSVYN----FLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPN--------VYPHGINCTWHILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIP--PSLTSSGNSLMLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPT------IISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTG--CGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQ------LCGDEKPPLIRSSGDSMFIKLRTDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSEN-QHCNWTIRATTGNTVNYTFLAFDLEHHINCST-DYLELYDGPRQM-GRYCGVDLPPPGSTTSS-KLQVLLLTD-----GVGRREKGFQMQWFVYGC---------GGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEYHSRCNFD-VLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSING--RGFNASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEP---QDSCIMAYDGLSSTMSRLARTCGREQLANPI----VSSGNSLFLRFQSGPSRQNRGFRAQFRQACGG-HILTSSFDTVSSPRFPANY--PNNQNCSWIIQAQPPLNHITLSFTHFELE---RSTTCARD-FVEILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGGTFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQD-CSRDFVEIREG-NATGHLVGRYCGNSFPLNYS--SIVGHTLWVRFISDGSG--SGTGFQATFMKIFGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDI-EEIQN--CYYDKLRIYDGPSIHARLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAP-DGVLPTIAPGACGGFLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDS-TVELNILSLDIESHRTCAYDSLVIR-DGDNN-----LAQQLAVLCGREIPGPIRSTGEYMF----IRFTSDSSVTRAGFNASFHKSC-GGYLHADRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTL---FTSDNQMFVQFISDHSNEGQ--GFKIKYEAKSLACGGNVYI-HDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPIL--SKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRVPGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDNHTSGN-ILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSL-PNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFED----------FYLESHQDCQFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPIIGQYCGNSNP---RTIQSGSNQLVVTFNSDHSLQGGGFYATWN--TQTLGCGGIFHSDNGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNF-LIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAP-GPVITPSNTFTAVFQSQ-EAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQYDNNMNCTYVIEA--NPLSVVLL--TFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCGDEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSG----IITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDVVPS-TSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLV-FKTD--SFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTF---ASPDSDSNGMYDKNLNCVWIIIAPVNKVIHLTF--NTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISS---PNSSDPDVPFSICTWVIDSPPHQQVKITVWALQL-TSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASAVPVFYSSMSTAMVIFKSG-VVNRNS----RMSFTYQIADCNRDYHKAFGNLRSPG--WPDNYDNDKDCTVTLTAPQ-NHTISLFFHSLGIENSVECRNDFLEVRNGS-NSNSPLLGKYCGTLLPNPVFSQNNELYLRFKSDSVTSDRGYEIIWT--SSPS-GCGGTLYGDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSG----PYCGGDTSIAPFVASSNQVFIKFHADYARRPSAFRLTW 3621          

HSP 2 Score: 234.958 bits (598), Expect = 1.722e-60
Identity = 373/1620 (23.02%), Postives = 648/1620 (40.00%), Query Frame = 2
Query: 4472 GVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFD----IIEMESSINCSEGPILRAWENEIVDENYVFQACNRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEM----SGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILD-FETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMESN--QFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFE--GGSNNPNCSSDNSLTIIEGIGNNSS--VKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAIS----YILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYK---FNDSVWIRLRSQGGDFTNHIKFLAKY-----HINYNTEFRSDYGVLASPQFGHV--YNQDTEITWTVFA--ESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV---FCGSGVIDSAIFTPPVTL---ILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGS-KNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKK---ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILA--MNINKTL----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDF-----EELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG-KTNSIFTI-GNVLTILFKN--MDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDL--DENCSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKY---FFEDFMCGG-------EYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRA--------RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNS-----DQPSLCG----SNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFV---SKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSE--LCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            G+I S ++P +  +N++C W+     G ++ + F+    I   +SS N  +  +LR   +                    S  + +S +  +++F S +   G  + F+  YE  + +C   +    + S G + SPN+P+ YP +  C W L       I L+  D F+ E +  C  +Y+E+   +++D   L   CG     + +   S    M ++FR+D++ +  GFKAKY    CGG R+  +S   + +  P  P+   L    CEW+L       GL   +  + FE     N+  C  D     +E   N++S  +    C  +    I   SN   ++ +   +   + F+  +      CGGD     G FTSP YPN       C + I    G  I L           S    +++  F  IR+   +   L       +EI++     K   F D      R  GG       F A Y      +   +   +  G   SP +  V  Y+++    WT+    + +  +   F+ F +    D   C    L     + D  +    CG       +  P   +    ++ E   + GF  +++   D    +IGD          + ++TSPNYPN   +   C+  +   +   + +    FD+E    C +++ TV   GS ++PI    +Y     CG   NS     Q+   N + +T+ +D      GF  ++      C   F +   G++++  +P    EN  C++   +H   ++ ++     L P  +G+C N F+K+ A    ++K L    CG N+ P   P+IT S+     +F   S E+   GF   +  +   CG     + +       ++ N      + + C +   + P + + + F     E        C    +    G +  +        CG +  +  TI G VL   + N  + DF  F+   +I SCGG+ +   G I SP Y   +YP    C++ I+      I L F D D+    +CS   L +     + + ++   C S    ++ +  +++ ++FKT++  T KG+K+ +         CGG        ++ P+ + N   Y K L+    C W I   V+K I +      +     R R          G    + L    C S +    I + + +   F S  T+    +N+     D P  CG    +   P N  S   +  +V  S+C + I + P  +  ++++    T   C+  Y     S  G+G     +  G   +     YS  +   V   IF+ G  V   N R+   Y+ + C     ++FG ++SPG+P+ Y ++ DC   + AP+N  I L   +L +E+ ++C  D L +R     +SP   K CG    NP+ ++      N + L F SD   S  G+ I +   +    C G ++   GS  SP YP  YP+N  C W +  P G  V++ F   + +       C  + L + D    +  S    CG      P  +S NQ+ + F  D+      F   + S
Sbjct: 2101 GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEG--QGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSKFCGTS---LPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGG-RVPGQSGVVESIGHPTLPYRDNL---FCEWHLQ------GLSGHYLTISFEDFNLQNSSGCEKD----FVEIWDNHTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIV-FNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGS----RPYGG-------FTASYTSSEDAVCGGSLPNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQD---CQFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSF-TDCGGIQIGD----------SGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPIIG--QY-----CG---NSNPRTIQSGS-NQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSD-NGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCG-NVAPG--PVITPSN-TFTAVFQ--SQEAPAQGFSASFVSR---CG-----SNFTGPSGYIISPNYPKQYDNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFA--TVCGDEMPAPLTIAGPVLLNFYSNEQITDFG-FKFSYRIISCGGVFNFSSGIITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGM-YDKNLN----CVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMP--CGGTYNATWTPQNISSPNSSDPDVPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHG-NSRFQFCGRNASAVPVFYSSMSTAMV---IFKSG--VVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFSQ-----NNELYLRFKSDSVTSDRGYEIIWT--SSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINF---YFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSNQVFIKFHADYARRPSAFRLTWDS 3623          

HSP 3 Score: 206.068 bits (523), Expect = 8.544e-52
Identity = 238/989 (24.06%), Postives = 397/989 (40.14%), Query Frame = 2
Query: 8276 NMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPAD-TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFF--GCRYHDNQIQIDLEDQNGNYLP-GQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDT-NVLIVRF--QSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYD-GYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLG-----NNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSS--FTVEYKSLTGGVGAGFRISWSPV 11197
            N   + V    +   CGG+LT  +G IKSPGYP  YP   DC W+++   ++++  T  TL LEHH DCN D+L IR    +  P   K C     S   L       R+ FHSD  +S  GF I Y   +P+D  C G   + EG +  P    P+    +C + +  P+G ++ + F    +L+  S  + +Y  +R    +  TLL ++CGN   S+ I S  N + + F  D +     F A Y+  CG      +G I S     +  G  TC + I   +   QV+ +    F  G   H     +++   +    P  ++ CG       I    +   V   ++   +N+ F A++  ++        +    +++P  P+ Y H  N TW       ++  +   +  +E  Y+ C  D++      S +S   +CG   +I P +  + N L++ F   SD+++      + A    T      C       +GT+    +   +    +E    C ++I    G  + V F N S+       +G    D + I DG     P++    G +   +I + SN ++L F +D    +SGF   +    S       +T  S    SP YP    Y        + ++      +  KD  +    NC+LD   + D    + + + + C       +  SS D + I+     +        R F+  Y     N      +  I+    +    YS N  CN T+     N    + F  F+LE    C+ DY++   G     +Y     CG  +PP   T SS++ ++ +TD     + G+ + + V       CGGE+   +G  +SPGF   Y  + EC W I+    S I+    D  +      N   LE   Y   DF    +  +  + C     +   Q+ S+     + +K+     G GF  SW  V
Sbjct:  575 NGRGFTVRWETQQPECGGILTGPYGSIKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPLLGKFC--TTFSVPPLQTTGPFARIHFHSDSQISDQGFHITY-LTSPSDLRCGGNYTDPEGELFLPELSGPFTHTRQCVYMMKQPQGEQIQINFTH-VELQCQSDSSQNYIEVR----DGETLLGKVCGNGTISH-IKSITNSVWIRFKIDASVEKASFRAVYQVACGDEL-TGEGVIRSPFFPNVYPGERTCRWTI--HQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSF-ITSVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLEFHYN-CTNDYLEVYDTDSETSLGRYCGK--SIPPSLTSSGNSLMLVFVTDSDLAYEGFLINYEAISAAT-----ACLQDYTDDLGTF-TSPNFPNNYPNNWE----CIYRITVRTGQLIAVHFTNFSL----EEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLWLKFKSDQIDTRSGFSAYWDG--SSTGCGGNLTTSSGTFISPNYPMPY-YHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGD-EKPPLIRSSGDSMFIK-----LRTDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYP-NPYSENQHCNWTIRATTGN-TVNYTFLAFDLEHHINCSTDYLELYDGPRQMGRY-----CGVDLPPPGSTTSSKLQVLLLTDGVGRREKGFQMQWFV-----YGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEYHSRCNFDVLE--IYGGPDF----HSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAV 1506          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Human
Match: TLL1 (tolloid like 1 [Source:HGNC Symbol;Acc:HGNC:11843])

HSP 1 Score: 168.318 bits (425), Expect = 6.878e-41
Identity = 171/669 (25.56%), Postives = 272/669 (40.66%), Query Frame = 2
Query: 7274 DFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEY-STVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPED----EGTLSM-FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLI 9118
            D +  R   +  +CG  L    G ++SP +P  YP  + CIW++S      I L F   DL ++  C    + V      ++ ++   C     ++ T   S + I F++++    KGF   Y   + +CGGE    E ++ S NYP        C WKI V  S  + +  +  +           G+  ++    I+    +E  + +     +EV            S+   L G                      C Y+    PED      TL M F+SD T    +   F +       E  +    GC +R      +TLG       +PG E+       E     + CGGLLT+  G I +PG+P++YP N +C W ++AP    I +  +   LE +  C YD++ I      +S    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       NG + +                   G I SPN+P  YPS   C W I    G+++ L F   F++E+     C YD L + D  +    +L  LCGN  P +P+ ++ N+M + F +D +   +GF A + + CGG    + +  ++ S A     NY G + CE+L+
Sbjct:  336 DIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVY---EAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEH----QENPGIASKARESLILIWKPIERHD-NCAYDYLEVRDG--------TSENSPLIGR--------------------FCGYD---KPEDIRSTSNTLWMKFVSDGT---VNKAGFAANFFKEEDECAKPDRGGCEQR----CLNTLGSY-QCACEPGYELGPDRRSCE-----AACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAE--VPEVITSQFNNMRIEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFS-EFEIEQH--QECAYDHLEVFDGETEKSPILGRLCGNKIP-DPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLL 944          

HSP 2 Score: 107.842 bits (268), Expect = 2.906e-22
Identity = 156/693 (22.51%), Postives = 244/693 (35.21%), Query Frame = 2
Query: 4403 YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRID----DGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE------------ESL------------CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGD----------------------FYLDD------------------GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSD---YGVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSG 6109
            Y+   C ET             NG + S  FPN   +   C W     PG  + L F  +++  S  C        W + I   +  ++    +     D    ++ S+    +++F S+++  G  + F   YE     C  E+  +EG IQSPNYP+ Y     C W + V ES  + L    FE E            ESL            C YDY+E+    + +   +   CG           S +N + +KF +D TV+  GF A +F+                                            CGGL   +  N  + +P +P  Y  P+  C W +VA T +  + + F F   EG   N  C  D  + I  G+ + S +    C       I S  + +++  KS  T     FKA +      C  D                      F L D                  GL TSP +P+      +C + I  +PG  I L+  EF  E       +D +++ +G  E S +LGR     + +    T N  F     +R  S          F A +        +++     + +  QFG + Y    +  W + +E   +L+ +F  F V    D   C    + ++D      V    FCGSG
Sbjct:  344 YRCPACGETL---------QESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLC--------WYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVG--KGFAAVYEAI---CGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDK---PEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKL--NGTITTPGWPKEYP-PNKNCVWQVVAPT-QYRISVKFEFFELEG---NEVCKYD-YVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQH-QECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMF-----VRFVSDAS--VQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEAD---CGYDYVELFDGLDSTAVGLGRFCGSG 992          

HSP 3 Score: 105.531 bits (262), Expect = 1.621e-21
Identity = 78/253 (30.83%), Postives = 118/253 (46.64%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKP-----------YPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRI---IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI 9025
            K + C   +    G I SP +P+KYP   +C W I A     I+L      +E H +C YDHL +   E   SP   +LCG N I +  ++   N+M + F SD SV + GF   +     +  C G        +K+ + P+            YP  + C W +    G ++ L+F+  F++E  +   C YD + +   +DS AV L    CG+ PP   I S  + + + F TD   N +GFH +YKSI
Sbjct:  793 KEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCG-NKIPDPLVATG-NKMFVRFVSDASVQRKGFQATH-----STECGG-------RLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQT-FEVEEEA--DCGYDYVELFDGLDSTAVGL-GRFCGSGPPEE-IYSIGDSVLIHFHTDDTINKKGFHIRYKSI 1026          

HSP 4 Score: 105.145 bits (261), Expect = 1.764e-21
Identity = 147/681 (21.59%), Postives = 246/681 (36.12%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-----------DKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDL---------------------PPLQNGQC-YSFVRISD-----------------------RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTK--------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINC------------SEGPILRAWENEIVDENYVFQACN-RIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK----FQGTY---------------EFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSP------NYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNG 5440
            CG     + G+++SP +P   P+ T+C W +  TPG++I++    +    + ++ LC             K+P+L      K   ++ S   ++M +    S + + +  A+        Y   C   I  + G+I+S N       ++ C WK++      + +    F+                      P  ++  C Y ++ + D                        SNTL  K   +  +N+   ++N+  + E    +       +     +  YQ   C   +   P                NG I +  +P     N +C W       + + +KF+  E+E +  C            SE  +   +    V E    Q  N RI+      +  S   F   FFS  D     NGG +       G+Y               +     CE ++    G+I SPN+P+ YP    C+W +       I L   +FE E+   C YD++E+F         L  LCG   N I     +  N+M ++F +D +V  +GF+A +   CGG   A    + L S       NYP         CEW LV   SE G R+   F  FE      +C  D  + + +G+ + +      C   P   I S G
Sbjct:  349 CGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTM---DLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTD-SRMWIEFRSSSNWVGKGFAAV-------YEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANF-FKEEDECAKPDRGGCEQRCLNTLGSYQC-ACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTV--SKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCG---NKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVD-----CEWLLV---SERGSRLELSFQTFE-VEEEADCGYD-YVELFDGLDSTAVGLGRFCGSGPPEEIYSIG 1001          

HSP 5 Score: 102.064 bits (253), Expect = 1.476e-20
Identity = 155/725 (21.38%), Postives = 258/725 (35.59%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFET----EESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNL-VANTSEIGLRIFFYFMGFEG-GSNNP---------------------NCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKA----------------------------------AYGVG------SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKYHINYNTEF------------------RSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKD 6622
            +C   +  S G + SP +PN YP    C W + V     I   +L+F T    + SLC YDY+E+          L   CG     + T   S ++ M I+FR+      +GF A Y   CGG     E    + SPNYP  Y  P   C W + V+ +  +GL     F  FE     NP                     NC+ D  L + +G   NS +    C       I   SN  ++K +   T   A F A                                   Y +G       + CGG     +G  T+P +P     + +CV+ +       I +  E F  E       +D+++I +G +  S L G+F          S+  N    +K +++V  +              +  GG     +  +  Y       F                   S  G++ SP +   Y    E TW + A    +++  F +F + +   + +C   +L ++D   +        CG+ + D  + T     +  +S    +  GF    +           +C   +KA ++ + L S       NYP     +  C W ++++R   L++   +F++E   +C Y ++   F G  +       +     CGS    E       + +S+ I +  D+     GF + YK   Y D
Sbjct:  348 ACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKI---VLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLT---STDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQ--IQSPNYPDDYR-PMKECVWKITVSESYHVGLT----FQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYD-YLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGN-EVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQ---HQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHST----------ECGGRLKAESKPRDLYSHAQFGDNNYPG----QVDCEWLLVSERGSRLELSFQTFEVEEEADCGY-DYVELFDGLDSTAVGLGRF-----CGSGPPEEI----YSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPD 1030          

HSP 6 Score: 96.6709 bits (239), Expect = 8.071e-19
Identity = 126/584 (21.58%), Postives = 211/584 (36.13%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERS----------------------YDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVA--------FINP--------------------TPGPMLG---------CGGYM---NATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPS---------QNHLIKTVTNF-----------------------------SQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRR--FQISYELYTCNRTEKAYSGR-IVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDP 10843
            +++PN+P  Y       W       Y   +  +S + E                        +D C YD++     +S +S  I  FCG           +N L ++F SD +   N  GF A           P                     PG  LG         CGG +   N T+ T G  K         Y  N  C WQ+ AP  + + V FE     LEG      C+YD++ I+ G  S   +    CG +  + IT+Q N M + F +D  + K GFK  F +            Q+  + T+ ++                             S L+ SP +P+  P       E I+A     I +   + +I     C+ D   + D   +    + + C +   + + +++ +K+ +++       ++ A+ +R  FQ ++      R +     R + +   F    Y   + C   L++   + R +  F+ F +E  + C YDY++   G        L + CGS  P    +    V + F TD +IN  G+ I Y   R P
Sbjct:  473 IQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCG-YDKPEDIRSTSNTLWMKFVSDGT--VNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKE--------YPPNKNCVWQVVAPTQYRISVKFE--FFELEGNEV---CKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWE-ISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPL-VATGNKMFVRF-------VSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGS-RLELSFQTFEVEEEADCGYDYVELFDG-LDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYP 1029          

HSP 7 Score: 89.7373 bits (221), Expect = 8.589e-17
Identity = 75/274 (27.37%), Postives = 123/274 (44.89%), Query Frame = 2
Query: 2639 SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRA----------------KVSVFDCGGSFFLT--NKLIIGYPESHLNESTYDEET--------------QYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT-HKLVIRFVSDNSVSGEGF 3337
            S E ACG  +     +     +  +P+ Y  N +CV+Q  A T+ +I++ F  F++  +  CK+D+++I SG S+   L  ++C     E+IT   N+    + I FKS++T +  GF+A                +    +  GS+     N  ++   +    E+  +++               +Y   K CTWEI+      I   F +F +E H  CAYD+LE+      K     R CGN        T +K+ +RFVSD SV  +GF
Sbjct:  636 SCEAACGGLLTKLNGT---ITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAEVPEVITSQFNN----MRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGF 902          

HSP 8 Score: 83.5741 bits (205), Expect = 7.698e-15
Identity = 80/374 (21.39%), Postives = 145/374 (38.77%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVX--XXXXXXXXXDAIFCGNLTNISPFMIDT--NVLIVRFQSD--ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTY------------------------------GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             + TP +P  Y  N N  W   AP  Y  S+     ++E + + C YD+V      +S +     FCG      P +I +  N + + F+SD  +S       F +  +       GC      T+G+Y                              G+I S +  +   Y +   C W+I+A  GH +K+ F    I          C YDH+ ++DG     P++  LCG+   D +    N M++ F +D ++Q+ GF+ T +        +K  +    L    ++ +N+         L+ +     + ++ +  ++    +C  D   + D        + +FC S   E ++ S  D V+I +  
Sbjct:  651 TITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGN-EVCKYDYVEIWSGLSSESKLHGKFCGAEV---PEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDK--YPSRKECTWEISATPGHRIKLAFSEFEIEQHQE-----CAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHST--ECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIY-SIGDSVLIHFHT 1010          

HSP 9 Score: 78.5666 bits (192), Expect = 2.499e-13
Identity = 70/267 (26.22%), Postives = 114/267 (42.70%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDI---FYVFDQFH--------------------LESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S     S  +P  Y   +HC+++       KI ++F   D+   S C +D+I++         L  R+C     E++T   +    ++ I F+S+S + G GF A      CGG         I   E  +    Y ++  Y   K C W+IT      +   F  F+Q H                    +E H NCAYDYLE + D  ++      RFCG +  +   + ++ L ++FVSD +V+  GF   F+
Sbjct:  348 ACGETL---QESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDS----RMWIEFRSSSNWVGKGFAAVYEAI-CGGE--------IRKNEGQIQSPNYPDD--YRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLE-VRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFF 595          

HSP 10 Score: 77.411 bits (189), Expect = 6.066e-13
Identity = 87/377 (23.08%), Postives = 146/377 (38.73%), Query Frame = 2
Query: 4139 CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH-------------------------------EGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQAC-NRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY 5143
            C W++ +    +I ++ + F+L    N  C Y +V I       + L  K CG ++     TS    +RIE  +D +      +AH                                G VL      C E       E    + +G+I S  +P+   +  +C W     PG  +KL F   E+E    C+    L  ++ E      + + C N+I D     + ++ +  +++F S  D +   + FQ T+   +  C   +          ++  F    YP  + C W L  +    + L    FE EE   C YDYVE+F  +++  V L   CG           S+ + +LI F TD T++ +GF  +Y
Sbjct:  667 CVWQVVAPTQYRISVKFEFFELE--GNEVCKYDYVEIWSGLSSESKLHGKFCGAEV-PEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEA----ECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDH-LEVFDGETEKSPILGRLCGNKIPD----PLVATGNKMFVRFVS--DASVQRKGFQATH---STECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGP---PEEIYSIGDSVLIHFHTDDTINKKGFHIRY 1023          

HSP 11 Score: 75.8702 bits (185), Expect = 1.562e-12
Identity = 53/233 (22.75%), Postives = 104/233 (44.64%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C ++  A    +I ++F +F+I    EC +D +++    +    +  R C     + +    N    K+ + F S+++    GF+A  S  +CGG     +K    Y  +   ++ Y  +        C W + +   + +   F  F +E   +C YDY+EL     +      RFCG    SGP     ++   ++I F +D++++ +GF +R+ +++
Sbjct:  810 SPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGN----KMFVRFVSDASVQRKGFQATHST-ECGGRLKAESKPRDLYSHAQFGDNNYPGQVD------CEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCG----SGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIR 1027          

HSP 12 Score: 73.1738 bits (178), Expect = 9.593e-12
Identity = 59/246 (23.98%), Postives = 101/246 (41.06%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAV--PSQNHLIK 10129
            ++ +PN+P  Y      TW  +A  G+   +     +IE+  + C YD +      +  S  +   CGN     P +   N + VRF SD S      GF A  +        CGG + A      +       +N  Y   + C+W + +  G  +++ F+   +  E       C YD++ ++DG DS    +   CG    + I +  + + + F TD  I K GF + + ++  P   H  K
Sbjct:  807 LITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQE-CAYDHLEVFDGETEKSPILGRLCGNKIP-DPLVATGNKMFVRFVSDAS--VQRKGFQATHSTE------CGGRLKAESKPRDLYSHAQFGDNN-YPGQVDCEWLLVSERGSRLELSFQTFEVEEEAD-----CGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDTTHTKK 1036          

HSP 13 Score: 65.0846 bits (157), Expect = 3.136e-9
Identity = 92/440 (20.91%), Postives = 162/440 (36.82%), Query Frame = 2
Query: 2246 SRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEAF--CTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFD-----------------------INDDSECKFDFIKISGSNSGH--LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAK-----------------------VSVFDCG-------GSFFLTNKLIIGYPESHLNES--TYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVTHK---LVIRFVSDNSVSGEGFIMRFYTVK 3361
            S+ D+   R  +R         CG T+    N  + SP  P    ++  C W++  T   +++    T + +    C       E+      ++  +     + L E     ++  +I F+         F    E  CG  +  +E    + QS NYP +Y     CV++   +E+  + ++F  F+                       I     C +D++++    S +  L  R+C  +K E I   SN     + + F S+ T    GF A                        +  + C        G    + +   G   + LN +  T     +Y  NK C W++       I   F+ F LE +  C YDY+E+     ++     +FCG  A+    +T +   + I F SDN+VS +GF   F++ K
Sbjct:  333 SKGDIAQARKLYRCPA------CGETL-QESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLC--WYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEG---QIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSN----TLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCG--AEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDK 754          

HSP 14 Score: 64.3142 bits (155), Expect = 5.074e-9
Identity = 121/629 (19.24%), Postives = 223/629 (35.45%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNV-LIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIF--------ENNSISLEGRS----------RVGGCRYDHITI----------------YDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKS----------------------GFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQ--------------------------------VGPMENINSATDRRFQISYELYTCNRTE---KAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS---GVITSPGFGTNYYESG-ECSWNIKLVSNSYIKWRFTDMQL 10996
            L +P FP+ Y    +  W  +   G    +N  ++D+ +S   C YD++         S  +  FCG+   +   +  T+  + + F+S  +      GF A           CGG +    G    I+S +  ++  Y     C W+I     + V + F        EN  I+ + R           R   C YD++ +                YD P+  R    TL      D    ++      F  +    K                       G++L       +      +T  +  + +P +P   P +   + +++A  +   I++  +  ++  +  C  D   I  + L  E+K+  KFC +   E V  S  + + I+++                                V  M +        F +    + C   E   K +S   +        KY     C    I+  P  R +  F  F +E+   CAYD+++   GE  E+  +L ++CG+ IP   V   +++ + FV+D S+   G+  T+      S +CGG +  +S    + +   FG N Y    +C W +     S ++  F   ++
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKSPLLGRFCGD--KLPEVLTSTDSRMWIEFRSSSNWVGK--GFAAVYEAI------CGGEIRKNEGQ---IQSPNYPDD--YRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQY-RISVKFEFFELEGNEVCKYDYVEIW-SGLSSESKLHGKFCGAEVPE-VITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWE-ISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGET-EKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATH------STECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEV 961          

HSP 15 Score: 60.8474 bits (146), Expect = 6.060e-8
Identity = 30/100 (30.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 8381 YPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADT 8680
            YP   DCEWL+++     ++L+ QT  +E   DC YD++ +    +  +    + CG  P   E +    + + + FH+D +++K GF I Y  I   DT
Sbjct:  934 YPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGP--PEEIYSIGDSVLIHFHTDDTINKKGFHIRYKSIRYPDT 1031          

HSP 16 Score: 60.4622 bits (145), Expect = 8.565e-8
Identity = 57/216 (26.39%), Postives = 83/216 (38.43%), Query Frame = 2
Query: 5432 SNGHYLKVILKSTSGNAIFKAAYGVGSST------------------CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHI--KFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQF 6013
            S G +L  IL S   N I  A   +G  T                  CG      +G  +SP +PN       C++ +  +PG  I L+        + S   +D+I++R+G    S LLGRF    L E+   T     +  +WI  RS     +N +   F A Y      E R + G + SP +   Y    E  W +    S  +  TF  F
Sbjct:  305 SRGMFLDTILPSRDDNGIRPA---IGQRTRLSKGDIAQARKLYRCPACGETLQESNGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKSPLLGRFCGDKLPEVLTST-----DSRMWIEFRSS----SNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSF 507          

HSP 17 Score: 59.3066 bits (142), Expect = 1.754e-7
Identity = 117/630 (18.57%), Postives = 219/630 (34.76%), Query Frame = 2
Query: 6275 LTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF---ILRSHFLNYIL-------------------NLTALDLPPPTNGKCVNGFLKIL-AMNINKTL----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEEC-----GGRHE-----LTRYQ-----------DSRIVDMNSNRLHM-------TPHFIE-------CKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKV--------------------------------------------KIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPER--------ELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQ 7801
            L+SP +PN   +   C W +     E + +   + DL  S  C Y+   V +    K+P+            G     +     T   + + I +++       GF   Y+  C  + R   EG +Q+  YP+     K C +   +  S+ +                       +L  +  P   +  C   +L++    + N  L    CG + P D++   +N+ W+     G  +     +GF   + K+++EC     GG  +     L  YQ           D R  +     L         TP + +       C W   +P   R+ + FE   +    +C   ++  + G ++ ++  G   FCG      I +  N + I FK+ +  S    K                                             K   C   +H   G I SPN+P  YP    C W+IS      I+L F + +++++  C+  +L V   +  ++ ++   C +   D +    + + + F ++    RKGF+  +  E   CGG      +        +    NYP  +     C W +  +   R+ +  +  ++ +
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLL-----------GRFCGDKLPEVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKN-EGQIQSPNYPDDYRPMKECVWKITVSESYHVGLTFQSFEQEHQENPGIASKARESLILIWKPIERHDNCAYDYLEVRDGTSENSPLIGRFCGYDKPEDIRST-SNTLWMKFVSDGTVNK----AGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHG--KFCGAEVPEVITSQFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYMCQCRNGFVLHDNKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILGRLCGNKIPDPLVATGNKMFVRFVSDASVQRKGFQATHSTE---CGGRLKAESKPRDLYSHAQFGDNNYPGQVD----CEWLLVSERGSRLELSFQTFEVEE 963          

HSP 18 Score: 55.8398 bits (133), Expect = 1.861e-6
Identity = 67/265 (25.28%), Postives = 111/265 (41.89%), Query Frame = 2
Query: 6887 VNLFGNFSSESRYSGFQIMYSK---KDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKI---GSCGGLLHR----RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            VN  G++  + R +GF +  +K   K+ EC    E   +  S ++  + N     P   EC W  ++ PG R+++ F E  I +   C    L  FDG T  +  +G    CG    + +   GN + + F  + D S  R   +      CGG L      R  Y  +     NYP    C W +     S + L+F   +++E  +C    + +    +S    +   C S    +IY+   +V I F T+    +KGF ++Y
Sbjct:  769 VNTMGSYMCQCR-NGFVLHDNKHDCKEAEC----EQKIHSPSGLI-TSPNWPDKYPSRKECTWEISATPGHRIKLAFSEFEIEQHQECAYDHLEVFDGETEKSPILG--RLCGNKIPDPLVATGNKMFVRF--VSDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQVDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVELFDGLDSTAVGLGRFCGSGPPEEIYSIGDSVLIHFHTDDTINKKGFHIRY 1023          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Human
Match: TLL2 (tolloid like 2 [Source:HGNC Symbol;Acc:HGNC:11844])

HSP 1 Score: 165.236 bits (417), Expect = 5.691e-40
Identity = 174/705 (24.68%), Postives = 271/705 (38.44%), Query Frame = 2
Query: 8306 YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHA--------------------------QYKSICGGVYDL----RQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYH---DNQIQIDLE----DQNGN------------------YLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHD-------------ENVKVFSDF----KRPYVL-----------------------KTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
            YK   CG  L ++ G   +PG+P  YP  + C W I       I L   ++ L     C YD++ +R      +P   + CG + I  E L    +R+ + F S  ++   GF   Y       TC G +    G I+SPNYP  Y  +  C W I V EG+ V LTF+  F++ER    +C YD L + D  +    L+   CG   P + + SS N++ + F +D + N  GF A                           YK  C   Y+L    +  E+          G+IT     PGW         YP    C +      Q +I L+    +  GN                   L G R CG    ++    S ++++ + + N  +    FRA +  D             E V  F  +    +  Y L                        +PN+P  Y      TW  ++  G+   +     +IE+  + C YD +       + +  +  FCG+     P +   + + +RF SD S      GF A ++ T      CGG + A V T  +       +N  Y +   C W I A  G+ V++ F    +  E       C YD++  YDG DS+ P +   CG   ++ I +  + + + F TD  I K GF   +T+   Q+ L
Sbjct:  346 YKCPACGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCG-DKIP-EPLVSTDSRLWVEFRSSSNILGKGFFAAYEA-----TCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQA-FEIERHD--SCAYDYLEVRDGPTEESALIGHFCGYEKPED-VKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITS----PGWPKE------YPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHG-RFCGSETPEVITSQSNNMRVEFKSDNT-VSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQE-CAYDHLEMYDGPDSLAPILGRFCGS-KKPDPTVASGSSMFLRFYSDAS--VQRKGFQA-VHSTE-----CGGRLKAEVQTKELYSHAQFGDNN-YPSEARCDWVIVAEDGYGVELTFRTFEVEEEAD-----CGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTSTKFQDAL 1011          

HSP 2 Score: 136.346 bits (342), Expect = 5.926e-31
Identity = 158/700 (22.57%), Postives = 282/700 (40.29%), Query Frame = 2
Query: 7043 PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDD-FSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCN-SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRC-----TWKINVDVSKRIIVKVKKLKMNQGCFRIRARGV----GY-------RSVLLYIICAS------NLENFEID----TKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGT-GCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPK----PYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            P +  C W  +  PG ++ ++F  + +    +C   ++   DG       +G   FCG      + +  + L + F++  +            +CGG +++  G I SPNYP +Y P   C+W+I+     ++ LTF   +++  ++C+   L V      E+A+I   C      D+ +  + + + F ++    + GF   +F              +E++  ++P       RC     ++K   D    +    K  ++  G F  +  G     G+       ++ +  ++  +        E FE++     K   +EV  SG +     +      CGS   P      VIT ++ N+ + ++   N     G  + F SD       N       G    E V  FG+  C  RN  +           + + G +            K + C   ++   G + SP +P+KYP   +C W I +     ++LT     +E H +C YDHL +    +  +P   + CG         S   + M L F+SD SV + GF   +     +  C G +     + +  ++ +     YPS  RC+W I   +GY V LTF+  F++E  +   C YD +   D   ++   L   CG+  P   I S+ + + + F TD   N +GFHA+Y S
Sbjct:  372 PSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLG--RFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFF--------------KEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVR-SGLSPDAKLHG---RFCGSET-PE-----VITSQSNNMRV-EFKSDNTVSKRGFRAHFFSDKDECAKDN-------GGCQHECVNTFGSYLCRCRNGYW-----------LHENGHDC-----------KEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVAS--GSSMFLRFYSDASVQRKGFQAVH-----STECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRT-FEVEEEA--DCGYDYMEAYDGYDSSAPRLGRFCGS-GPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTS 1004          

HSP 3 Score: 130.954 bits (328), Expect = 2.317e-29
Identity = 90/300 (30.00%), Postives = 134/300 (44.67%), Query Frame = 2
Query: 8261 PGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGI-----------------IFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG 9034
            PG E+       E+      CGG +T+  G I SPG+P++YP N +C W ++AP    I L  +   LE +  C YD + +R     D+    + CG    + E ++   N MR+ F SD +VSK GF    +F +  D C                       NG                  I + EG++ SPN+P  YPS   C W I    G++V LTF   F++E+     C YD L + D   +   +L   CG+  P +P  +S + M L F +D +   +GF A + + CGG
Sbjct:  605 PGYELAADKKMCEVA-----CGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSE--TPEVITSQSNNMRVEFKSDNTVSKRGF--RAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFN-EFEIEQH--QECAYDHLEMYDGPDSLAPILGRFCGSKKP-DPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGG 891          

HSP 4 Score: 106.686 bits (265), Expect = 6.328e-22
Identity = 138/667 (20.69%), Postives = 260/667 (38.98%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH---EGIVLEYQTQG-----CMETF-----YYDPHESDYSTK--------------NGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINC-----------------------SEGP-ILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCG--KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGG-LRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS 5467
            CG     T G+ ++P +P   P+ ++C W I  TPG++I++    +    + +++LC      ++    +K   +   C ++I +  V  +  + V F++ ++   + F   Y   C   +   +G+I+S N    Y     C W+++   G  + +    F++    +   Y ++ + D     + L+   CG +      +SSN  + ++  +D S +     A+   E     +   G     C+ T        DP     + K              NG I S  +P     N +C W       + + L+F++ E+E +  C                       SE P ++ +  N +  E   F++ N +          S   F   FFS  D     NGG +                     +  ++     C H++S  EG + SPN+P+ YP    C+WN+       + L   +FE E+   C YD++E++   ++    L   CG  K    + +G S     M ++F +D +V  +GF+A +   CGG L+  +++ +      +       +  C+W +VA   E G  +   F  FE      +C  D  +   +G  +++      C   P   I S G  L +  ++
Sbjct:  351 CGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSM---DLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIE-RHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNR-LWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPEVITSQSNNMRVE---FKSDNTV----------SKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVASGSS-----MFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVIVA---EDGYGVELTFRTFE-VEEEADCGYD-YMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRT 989          

HSP 5 Score: 101.293 bits (251), Expect = 2.694e-20
Identity = 92/375 (24.53%), Postives = 153/375 (40.80%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXX--XXXDAIFCGNLTNISPFMI--DTNVLIVRFQSDISHYENHTGFVA-FINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCK-------------------------------WQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRY-PNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             + +P +P  Y  N N  W   AP  Y  S+     ++E + D C YDFV   +  S        FCG+ T   P +I   +N + V F+SD  +  +  GF A F +         GG  +  V T+G       +   L+EN   CK                               W I++  GH VK+ F  N   +E       C YDH+ +YDGPDS  P++   CG  + D      + M+L F +D ++Q+ GF+   +        +K      +L    ++  NN P + R    +I A +   + +T +  ++    +C  D     D       ++ +FC S   E ++ S+ D ++I+++ 
Sbjct:  630 TITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFVEVRSGLSPDAKLHGRFCGSET---PEVITSQSNNMRVEFKSD--NTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTF--NEFEIEQHQE---CAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHST--ECGGRLKAEVQTKELYSHAQFGDNNYPSEAR-CDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIY-SAGDSLMIRFRT 989          

HSP 6 Score: 100.138 bits (248), Expect = 6.779e-20
Identity = 150/705 (21.28%), Postives = 254/705 (36.03%), Query Frame = 2
Query: 4352 RSTHSNVIRAHEGIVLE----YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQA--CNRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGD----------------------FYLD------------------DGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYG---VLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSGVIDSAIFTPPVTLIL 6154
            R T    +R  +G + +    Y+   C ET              G   +  FPN   +   C W     PG  + L F  +++  S  C        W + + V + Y  +A    R   D     + S+    +++F S+++  G  + F   YE T   C  +M+   G IQSPNYP+ Y  +  C W + V E   + L    FE E    C YDY+E+      +   + H CG           S +N + +KF +D +++  GF A +F+                                            CGG    +  N  + SP +P  Y   +  C W +VA       RI   F  FE   N+  C  D  + +  G+  ++ +    C       I S  + ++V  KS  T     F+A +      C  D                      ++L                   +G   SP +P+      +C + I ++ G  + L+  EF  E       +D +++ +GP+  + +LGRF    +      +     S+++R  S          F A +        +++     + +  QFG + Y  +    W + AE    ++ TF  F V    D   C    +  YD  YD+       FCGSG ++  I++   +L++
Sbjct:  325 RPTIGQRVRLSQGDIAQARKLYKCPACGETL---------QDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLC--------WYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILG--KGFFAAYEAT---CGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEK---PEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKL--NGTITSPGWPKEYPT-NKNCVWQVVAPAQ---YRISLQFEVFELEGNDV-CKYD-FVEVRSGLSPDAKLHGRFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQH-QECAYDHLEMYDGPDSLAPILGRFCGSKKPDPTVAS---GSSMFLRFYSDAS--VQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEAD---CGYDYMEAYD-GYDSSAPRLGRFCGSGPLEE-IYSAGDSLMI 985          

HSP 7 Score: 95.5153 bits (236), Expect = 1.592e-18
Identity = 127/598 (21.24%), Postives = 231/598 (38.63%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF------TAVPS----QNHLIKT----------------------------VTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQI----------------------SYELYTC-------------NRTEKAYSGRIVNVENFKQK-----KYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLD---SGVITSPGFGTNYYES-GECSWNI 10945
               P FP+ Y   ++  W  +   G    +N  S+D+ +S   C YD+V         +  +  FCG+     P +   + L V F+S  +      GF A    T      CGG MN   G    I+S +  ++  Y  +  C W+I    G  V + F+   I      R   C YD++ + DGP     +I   CG ++ + + + SN +++ F +D +I K+GF   F       + P     ++  + T                            +T  +  + SP +P   P +   + +++A  +   I++  +  ++  +  C  D F+   + L  + K+  +FC S + E V  S  + + ++++     + N+ + R F+                       ++  Y C             +  E   + +I +VE          KY     C   + + A + R +  F  F +E+   CAYD+++   G P     +L + CGS  P   V + S + + F +D S+   G+   +      S +CGG +  +     + +   FG N Y S   C W I
Sbjct:  362 FSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRL-CWYDYVEVRDGYWRKAPLLGRFCGDKIP-EPLVSTDSRLWVEFRSSSNILGK--GFFAAYEAT------CGGDMNKDAGQ---IQSPNYPDD--YRPSKECVWRITVSEGFHVGLTFQAFEIE-----RHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQY-RISLQFEVFELEGNDVCKYD-FVEVRSGLSPDAKLHGRFCGSETPE-VITSQSNNMRVEFK-----SDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGH-RVKLTFNEFEIEQHQECAYDHLEMYDG-PDSLAPILGRFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVH------STECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVI 923          

HSP 8 Score: 86.6557 bits (213), Expect = 7.903e-16
Identity = 78/287 (27.18%), Postives = 127/287 (44.25%), Query Frame = 2
Query: 2624 PEFQISA-----EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAK-------------------VSVFD-----CGGSFFLTN----------KLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            P ++++A     E ACG  +     +     S  +P+ Y  N +CV+Q  A  + +I++ F  F++  +  CK+DF+++ SG S    L  R+C     E+IT  SN+    + + FKS++T +  GFRA                    V+ F      C   ++L               I   E  L    + +  +Y   + CTW I++     +   F++F +E H  CAYD+LE+     +      RFCG+  K  PTV     + +RF SD SV  +GF
Sbjct:  605 PGYELAADKKMCEVACGGFITKLNGT---ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPEVITSQSNN----MRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPD--KYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRFCGS-KKPDPTVASGSSMFLRFYSDASVQRKGF 881          

HSP 9 Score: 82.8037 bits (203), Expect = 1.233e-14
Identity = 92/467 (19.70%), Postives = 176/467 (37.69%), Query Frame = 2
Query: 9830 CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGEL---IAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQ---------------------------------VGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENF-----KQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            C W+I+   G   K++    S+ L  +SR+  C YD++ + DG     P++   CGD   + + +  + +++ F +  NI   GF   + A    +     +   +  ++SP YP+    D R   E    I  +E  H+ +T +  +I    +C+ D   ++D   +    I  FC     E V  SS +++ +++                                  V  + +   A D  ++++ +   C   E A  G I  +          K+Y  N  C   ++ PA   R    F+ F LE +  C YD+++   G   + + +  + CGS  P    + S+ + + F +D +++  G+   +  ++D   K                                     C  +I    G + SP +   Y    EC+WNI   +   +K  F + ++
Sbjct:  377 CVWRISVTPGE--KIVLNFTSMDLF-KSRL--CWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAYEATCGGD-----MNKDAGQIQSPNYPD----DYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDV-KSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMC---EVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPA-QYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAK-LHGRFCGSETPEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEI 823          

HSP 10 Score: 82.8037 bits (203), Expect = 1.308e-14
Identity = 67/245 (27.35%), Postives = 111/245 (45.31%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNE-LITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR------FCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + +T  F +  +P  Y   SHCV++       KI ++F   D+     C +D++++         L  R+C     E L++ +S     ++ + F+S+S   G GF A      CGG     NK         +    Y ++  Y  +K C W IT      +   F  F +E H +CAYDYLE + D  T+       FCG    +   + +++L ++FVSD S++  GF   F+
Sbjct:  350 ACGETL---QDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDS-----RLWVEFRSSSNILGKGFFAAYEA-TCGGDM---NK-----DAGQIQSPNYPDD--YRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLE-VRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFF 574          

HSP 11 Score: 81.6481 bits (200), Expect = 2.682e-14
Identity = 125/561 (22.28%), Postives = 211/561 (37.61%), Query Frame = 2
Query: 3716 YSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPV-LKFVTAKKEINIVCSEQITKM----HVFEE----------QSVHVIFQNLASTKYRFRLYY-----TQDCEFP----ITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDR---SNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH---EGIVLEYQTQGC----METFY---------YDPHESDYSTKN-----------GVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFT-NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            +++ +  CG       G I SPNYP     +  C W I  + G  + +                   +R G  +E+ L    C  + P  +K  + +  +  V    I K     + F+E             H     L S K      Y      + CE      IT  +G I S      Y     C W++ +    +I +Q + F+L    N  C Y FV +         L  + CG++      TS +  +R+E  +D +      RAH   +         GC    + TF          Y  HE+ +  K            G + S  +P+   +  +C WN  +  G  VKL F+  E+E    C+    L  ++        + + C       ++   SS    +L+F+S  D +   + FQ  +        + E+   E    +    N YP   RC W +  ++   + L    FE EE   C YDY+E +   ++   +L   CG  +  ++  +S+  + ++I+FRTD T++ +GF A+Y  T
Sbjct:  457 FAAYEATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE--GNDVCKYDFVEVRSGLSPDAKLHGRFCGSET-PEVITSQSNNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAY-DHLEMYDGPDSLAPILGRFCGSKKPDPTVASGSS---MFLRFYS--DASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCG--SGPLEEIYSA-GDSLMIRFRTDDTINKKGFHARYTST 1005          

HSP 12 Score: 73.1738 bits (178), Expect = 1.174e-11
Identity = 61/252 (24.21%), Postives = 110/252 (43.65%), Query Frame = 2
Query: 2645 EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI-SGSNS-GHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            E  C + ++  E +     S N+P  Y     C +   +    ++ ++F +F+I    EC +D +++  G +S   +  R+C G+K    T+ S      + + F S+++    GF+A V   +CGG      +    Y  +   ++ Y  E +      C W I       +   F  F +E   +C YDY+E      +      RFCG    SGP     +    L+IRF +D++++ +GF  R+ + K
Sbjct:  773 EAGCAHKISSVEGT---LASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILGRFC-GSKKPDPTVASG---SSMFLRFYSDASVQRKGFQA-VHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEAR------CDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCG----SGPLEEIYSAGDSLMIRFRTDDTINKKGFHARYTSTK 1006          

HSP 13 Score: 71.2478 bits (173), Expect = 4.132e-11
Identity = 90/395 (22.78%), Postives = 156/395 (39.49%), Query Frame = 2
Query: 10121 LIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDI--------------------------TYVVNRDPS-----------IKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFR 11179
            L  T  NFS    +P +PN  P     +   I+    + I +    + +  S  C  D   ++D   +    + +FC     E + +S+  ++ ++++     + ++   + F  +YE  TC       +G+I +       + S   +  +T+   +        F+ F +ER  +CAYDY++   G P E+  ++   CG   P    ++S+R+ M FV+D SIN  G+                            +Y    DP            + CGG I   +G ITSPG+   Y  +  C W +   +   I  +F   +L  N   +       DFV+V  G   +  L  ++CG     E     S++  VE+KS       GFR
Sbjct:  355 LQDTTGNFS----APGFPNGYPSYSHCVWR-ISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPL-VSTDSRLWVEFR-----SSSNILGKGFFAAYEA-TCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITV---SEGFHVGLTFQAFEIERHDSCAYDYLEVRDG-PTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLGSYKCACDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCK------YDFVEVRSGLSPDAKLHGRFCG-SETPEVITSQSNNMRVEFKSDNTVSKRGFR 726          

HSP 14 Score: 70.4774 bits (171), Expect = 6.303e-11
Identity = 118/542 (21.77%), Postives = 202/542 (37.27%), Query Frame = 2
Query: 6275 LTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVE------------FTGSKNP----IFSFIEYVAMVKCGSLNNSEF--NVFQTY--------------LFNSIKITYKADEFDPFPGFKLSY-KKACY---KDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMYSKKDEEC-----GGRHE--------LTRYQDSRIVDMNSNRLHMT----------------------PHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSYFR---LKVKIGSCGGLL----HRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTW-DIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            + SPNYP+     + C W I       + +   +F++E    C Y+   V             F G + P      S   ++  V  GS+N + F  N F+                  N++  +YK       PG++L+  KK C      F   L G++ +  +P +   NKNC + + +    Y ++L         N  C   F+++ +       ++   CGS  P     +IT+ S    N+   F S++  S  GF+  +    +EC     G +HE        L R ++   +  N +                           P   EC W+ +S  G R+++ F E  I +   C    L  +DG  +    +G   FCG      T+ +  ++  +   D S  R     V    CGG L      ++ Y  +     NYP  + C W I       + LTF   +++E  +C    +      +S    +   C S    +IY+   ++ I F+T+    +KGF  +Y
Sbjct:  475 IQSPNYPDDYRPSKECVWRITVSEGFHVGLTFQAFEIERHDSCAYDYLEVRDGPTEESALIGHFCGYEKPEDVKSSSNRLWMKFVSDGSINKAGFAANFFKEVDECSWPDHGGCEHRCVNTLG-SYKCA---CDPGYELAADKKMCEVACGGFITKLNGTITSPGWPKEYPTNKNCVWQVVAP-AQYRISLQFEVFELEGNDVCKYDFVEVRSGLSPDAKLHGRFCGSETPE----VITSQS---NNMRVEFKSDNTVSKRGFRAHFFSDKDECAKDNGGCQHECVNTFGSYLCRCRNGYWLHENGHDCKEAGCAHKISSVEGTLASPNWPDKYPSRRECTWNISSTAGHRVKLTFNEFEIEQHQECAYDHLEMYDGPDSLAPILG--RFCGSKKPDPTVASGSSMFLRFYSDASVQRKGFQAVHSTECGGRLKAEVQTKELYSHAQFGDNNYPSEARCDWVIVAEDGYGVELTFRTFEVEEEADCGYDYMEAYDGYDSSAPRLGRFCGSGPLEEIYSAGDSLMIRFRTDDTINKKGFHARY 1002          

HSP 15 Score: 55.0694 bits (131), Expect = 3.886e-6
Identity = 44/176 (25.00%), Postives = 75/176 (42.61%), Query Frame = 2
Query: 7232 TIGNVLTILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            TIG  + +   +  D +  R   K  +CG  L    G  ++P +P  YP  S C+W+IS      I L F   DL ++  C    + V      +  ++   C     + + +  S + + F++++    KGF   Y   +  CGG+ +    ++ S NYP        C W+I V
Sbjct:  327 TIGQRVRL---SQGDIAQARKLYKCPACGETLQDTTGNFSAPGFPNGYPSYSHCVWRISVTPGEKIVLNFTSMDLFKSRLCWYDYVEVRDGYWRKAPLLGRFCGDKIPEPLVSTDSRLWVEFRSSSNILGKGFFAAY---EATCGGDMNKDAGQIQSPNYPDDYRPSKECVWRITV 496          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Human
Match: BMP1 (bone morphogenetic protein 1 [Source:HGNC Symbol;Acc:HGNC:1067])

HSP 1 Score: 156.762 bits (395), Expect = 2.648e-37
Identity = 172/705 (24.40%), Postives = 267/705 (37.87%), Query Frame = 2
Query: 8306 YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFH--------------------------AQYKSICGGVYDL----RQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRY-------HDNQIQIDLEDQNGN------------------YLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN-------------VKVFSDF----KRPYVLK-----------------------TPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
            YK   CG  L +S G   SP YP  Y  +  C W I       I L   +L L     C YD++ +R      +P   + CG      E +    +R+ + F S  +    GF   Y  I     C G +    G I+SPNYP  Y  +  C W I V EG+ V LTF+  F++ER    +C YD L + D  S + TL+   CG   P + I S+ +++ L F +D + N  GF                             YK  C   Y+L    R+ E           GSIT     PGW         YP    C +       +   +Q D  +  GN                   L G + CG  + ++      ++++ + + N   K   F+A +  D++             V  F  +    +  +VL                        +PN+P  Y      TW  ++  G+   +    +DIE S   C YD +         +  +  FCG+     P +   + + +RF SD S      GF A           CGG + A V T  +       +N  Y   + C+W I A  G+ V+++F+   +  E       C YD++ ++DG DS  P +   CG    + + +  + + + F +D  I K GF L +T+   Q+ L
Sbjct:  317 YKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSK--LPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAI-----CGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQ-SFEIERHD--SCAYDYLEVRDGHSESSTLIGRYCGYEKPDD-IKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITS----PGWPKE------YPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHG-KFCGSEKPEVITSQYNNMRVEFKSDNTVSKK-GFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIE-SQPECAYDHLEVFDGRDAKAPVLGRFCGS-KKPEPVLATGSRMFLRFYSDNS--VQRKGFQA------SHATECGGQVRADVKTKDLYSHAQFGDNN-YPGGVDCEWVIVAEEGYGVELVFQTFEVEEE-----TDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTL 982          

HSP 2 Score: 144.05 bits (362), Expect = 1.927e-33
Identity = 148/601 (24.63%), Postives = 236/601 (39.27%), Query Frame = 2
Query: 7649 MCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNIS-------------------------------------LCQYNIHNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSN--AVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLIPGWENH 9136
             CG    D     +S  YP   S  + C W+I+V   ++II+    L + +   C+   +  R G   ++ L    C S L    + T S + +E   S   +   + +   ++CG ++           YP++     + I  + +S                                     + +Y  +  P+D  + S      F+SD +    +   F       + E       GC +R      +TLG        PG E+     R E     + CGG LT+  G I SPG+P++YP N +C W ++AP    I L       E +  C YD + +R     DS    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       +G + +                 T G+I SPN+P  YPS   C W I    G++V LTF +  D+E  S   C YD L + D       +L   CG+  P  P+ ++ ++M L F +D +   +GF A + + CGG    D++  ++ S A     NY G + CE++I   E +
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGS---INKAGFAVNFFKEVDECSRPNRGGCEQR----CLNTLGSY-KCSCDPGYELAPDKRRCE-----AACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSE--KPEVITSQYNNMRVEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTF-MEMDIE--SQPECAYDHLEVFDGRDAKAPVLGRFCGSKKP-EPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY 900          

HSP 3 Score: 125.561 bits (314), Expect = 9.304e-28
Identity = 156/682 (22.87%), Postives = 263/682 (38.56%), Query Frame = 2
Query: 8678 TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWEN-HLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQ---RICG----------KSREKITIMHSKSIKIVYTARNFHLK--------NYNFRARYLH---------DENVKVFSDFKRPYV------------LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDT--NVLIVRFQSD--------ISHY---------------------------ENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY 10471
             C   + ++ G+  SP YP  Y +++ C W I V  G K+ L F    DL R+ L  C YD + + D       L    CG+  P  PI S+ +++ + F +  N   +GF A Y++ICGG      G I S N       S  C + I   E  H+ + +     F    HD+     LE ++G+        R CG           SR  +  +   SI     A NF  +              R L+         D   ++  D +R               + +P +P  Y  N N  W   AP  Y  S+     + E + D C YDFV   +  +  S     FCG+     P +I +  N + V F+SD         +H+                           +  +GFV   N       GC   + +T GT   I S +  +   Y +   C W I++  GH VK+ F    I  +       C YDH+ ++DG D+  PV+   CG  + + +    + M+L F +D ++Q+ GF+ +          ++       L    ++ +N+         +I A E   + +  +  ++    +C  D   + D       ++ ++C S   E V+ S+ D V++++      + ++ T + F + Y
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNF-TSLDLYRSRL--CWYDYVEVRDGFWRKAPLRGRFCGSKLP-EPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTF---QSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTADSKLHGKFCGSE---KPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGT---ITSPNWPDK--YPSKKECTWAISSTPGHRVKLTFMEMDIESQPE-----CAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHAT--ECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVY-SAGDSVLVKFH-----SDDTITKKGFHLRY 973          

HSP 4 Score: 108.612 bits (270), Expect = 1.615e-22
Identity = 143/674 (21.22%), Postives = 255/674 (37.83%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLC-NDKNPVLKFVTAKKEI-NIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQ----------------LLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIV--LEYQTQGCMETFYYDPHE-------SDYSTK-NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCS----------------EGPILRAWENEIVDENY-----VFQACNRIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK----FQGTYEFTNYS---------------CEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCG--KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAY 5500
            CG     + G+ +SP YP    A+ +C W I  TPG++I++    +    +  ++LC  D   V      K  +    C  ++ +  V  +  + V F++ ++   + F   Y   C   +    G I+S N        + C W++    G  + +    F++    +   Y ++ + D    S+TL+ + CG +                + + +   + + +      D  +  N     +  +  L      C   +   P +         + TK NG I S  +P     N +C W       + + L+FD  E E +  C                  G    + + E++   Y      F++ N +          S   F   FFS  D     NGG ++      G+YE    S               C+H+++ + G I SPN+P+ YP    C+W +       + L  ++ + E +  C YD++E+F   +     L   CG  K    + TG     + M ++F +D++V  +GF+A +   CGG   A    + L S         P G+ CEW +VA   E G  +   F  FE      +C  D  + + +G  + +      C   P   + S G    V++K  S + I K  +
Sbjct:  322 CGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSL---DLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIE-RHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTV----------SKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATG-----SRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVA---EEGYGVELVFQTFE-VEEETDCGYD-YMELFDGYDSTAPRLGRYCGSGPPEEVYSAGD--SVLVKFHSDDTITKKGF 969          

HSP 5 Score: 97.4413 bits (241), Expect = 4.454e-19
Identity = 145/669 (21.67%), Postives = 240/669 (35.87%), Query Frame = 2
Query: 4403 YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQACNRIDDGKSII---IQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKA----------------------AYGVGSSTCGGDFYLDD------------------GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSG 6109
            Y+   C ET              G   S ++PN   A++ C W     PG  + L F  +++  S  C        W + + V + +  +A  R     S +   I S+    +++F S+++  G  + F   YE     C  ++    G IQSPNYP+ Y  +  C W ++V E   + L    FE E    C YDY+E+    +     +   CG           S ++ + +KF +D +++  GF   +F+                                            CGG    +  N  + SP +P  Y  P+  C W LVA T     RI   F  FE   N+  C  D  + +  G+  +S +    C       I S  + ++V  KS  T     FKA                       +G     C   F L D                  G  TSP +P+      +C + I ++PG  + L+  E   E+      +D +++ +G +  + +LGRF    +             +++R  S   +      F A +      + R+D     + +  QFG + Y    +  W + AE    ++  F  F V    D   C    + ++D  YD+       +CGSG
Sbjct:  317 YKCPACGETL---------QDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLC--------WYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVG--KGFFAVYEAI---CGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEK---PDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKL--NGSITSPGWPKEYP-PNKNCIWQLVAPTQ---YRISLQFDFFETEGND-VCKYD-FVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPE-CAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLAT---GSRMFLRFYSD--NSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETD---CGYDYMELFD-GYDSTAPRLGRYCGSG 942          

HSP 6 Score: 95.1301 bits (235), Expect = 1.927e-18
Identity = 148/703 (21.05%), Postives = 251/703 (35.70%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGV-------------------------GS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKYHINYNTEF------------------RSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYP-NFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKD 6622
            +C   +  S G   SP YPN Y  ++ C W + V     I L     +   S LC YDYVE+              CG     +     S ++ + ++FR+      +GF A Y   CGG     +    + SPNYP  Y  P  +C W +  +    G  +   F  FE   ++ +C+ D  L + +G   +S++    C       I S     ++ LK  S  +I KA + V                         GS                   + CGG     +G  TSP +P     + +C++ +       I L  + F  E       +DF+++R+G    S L G+F          S+  N    +K +++V  +              +  GG   + +     Y     + F                   S  G + SP +   Y    E TW + +    +++ TF +  +  +    +C   +L ++D   DAK      FCGS   +  + T     +   S    +  GF                +C   ++A  +T+ L S       NYP   D     C W I+ +    +++   +F++E   +C Y+   + F G  +       Y     CGS    E  V+     +S+ + + +D+     GF L Y    ++D
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSK---LPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGG--DVKKDYGHIQSPNYPDDYR-PSKVCIWRIQVSE---GFHVGLTFQSFEIERHD-SCAYD-YLEVRDGHSESSTLIGRYCGYEKPDDIKSTSS--RLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQP---ECAYDHLEVFDGR-DAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGF----------QASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVD-----CEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMEL-FDGYDSTAPRLGRY-----CGSGPPEE--VYSA--GDSVLVKFHSDDTITKKGFHLRYTSTKFQD 980          

HSP 7 Score: 94.7449 bits (234), Expect = 2.942e-18
Identity = 127/600 (21.17%), Postives = 228/600 (38.00%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXX--XXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLT----------------------------------FTAVPSQNHLIKT----VTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQI-------------------------SYELYT-----------------CNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLD---SGVITSPGFGTNYYESG-ECSWNI 10945
              +P +P+ Y  + +  W  +   G    +N  S+D+ RS   C YD+V               FCG+     P +   + L V F+S  +      GF A           CGG +      YG I+S +  ++  Y  + +C W+I    G  V + F++  I      R   C YD++ + DG   +  +I   CG ++ D I + S+ ++L F +D +I K+GF +                                   +   P +          +T  +  + SP +P   P +   + +L+A  +   I++     +   +  C  D F+   + L  ++K+  KFC S   E V  S ++ + ++++     + N+ + + F+                          SYE                    C+    + SG I +  N+  K Y     C    I+  P  R +  F   ++E    CAYD+++   G   +   VL + CGS  P   +   SR+ + F +D S+   G+  ++      + +CGG++  D     + +   FG N Y  G +C W I
Sbjct:  333 FSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRL-CWYDYVEVRDGFWRKAPLRGRFCGSKLP-EPIVSTDSRLWVEFRSSSNWVGK--GFFAVYEAI------CGGDVKKD---YGHIQSPNYPDD--YRPSKVCIWRIQVSEGFHVGLTFQSFEIE-----RHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQY-RISLQFDFFETEGNDVCKYD-FVEVRSGLTADSKLHGKFCGSEKPE-VITSQYNNMRVEFK-----SDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITS-PNWPDK-YPSKKECTWA-ISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAP-VLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASH------ATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVI 894          

HSP 8 Score: 92.8189 bits (229), Expect = 1.130e-17
Identity = 67/244 (27.46%), Postives = 110/244 (45.08%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSG-PTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + ST  F S  YP  YS + HCV++       KI ++F   D+     C +D++++         L  R+C     E I    +    ++ + F+S+S + G GF A      CGG         +     H+    Y ++  Y  +KVC W I       +   F  F +E H +CAYDYLE + D  ++      R+CG        + + +L ++FVSD S++  GF + F+
Sbjct:  321 ACGETL---QDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDS----RLWVEFRSSSNWVGKGFFAVYEAI-CGGD--------VKKDYGHIQSPNYPDD--YRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLE-VRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFF 545          

HSP 9 Score: 91.6633 bits (226), Expect = 2.462e-17
Identity = 142/692 (20.52%), Postives = 254/692 (36.71%), Query Frame = 2
Query: 5516 TCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF--YTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIK--FLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKK-IGDCE-----------------YIIKA-------------TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV------------EFTGSKNPIFSFIEYVAM-VKCGSLNNSEFNVFQTYLFNSIKI--------------TYKADEFDPFPGF-----KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMT---PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQ 7339
             CG       G F+SP YPN  +  + CV+ I  +PG  I L+        +     +D++++R+G    + L GRF    L E    T     +  +W+  RS     +N +   F A Y      + + DYG + SP +   Y       W +       +  TF  F + R   +  C    L + D + ++      +CG    D    T     +  +S       GF + +   VDE  +   G CE                 Y +               T     +TSP +P      + C W ++      + +Q   F+ E +  CKY+   V            +F GS+ P     +Y  M V+  S N      F+ + F+                  T+ + E     GF     K   K+A          G++ +  +P+K    K CT+ + S    + + LT +++   +  +C    L++      K       CGS  P   +P++   S + +  + + S + +  GFQ  ++    ECGG+       D +  D+ S+        P  ++C+W   +  G  +++ F+   V     C   ++  FDG  +   ++G     G    +++ G+ + + F + D  +   F L+         LH R+
Sbjct:  321 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRS-RLCWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVST-----DSRLWVEFRSS----SNWVGKGFFAVYEAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIER---HDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISST-PGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKP---EPVLATGSRMFLRFYSDNSVQRK--GFQASHAT---ECGGQVRA----DVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTKFQDTLHSRK 986          

HSP 10 Score: 84.7297 bits (208), Expect = 3.559e-15
Identity = 73/273 (26.74%), Postives = 121/273 (44.32%), Query Frame = 2
Query: 2645 EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV-------------SVFDCGGSFF-----LTNKLIIGYPESHLNESTYDEET--------------QYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            E ACG  +     S     S  +P+ Y  N +C++Q  A T+ +I++ F  F+   +  CK+DF+++ SG +    L  ++C   K E+IT   N+    + + FKS++T +  GF+A                  DC  +F        +  ++   +    E+  D +               +Y   K CTW I++     +   F +  +ES P CAYD+LE+      K     RFCG+  K  P +    ++ +RF SDNSV  +GF
Sbjct:  588 EAACGGFLTKLNGS---ITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNN----MRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGS-KKPEPVLATGSRMFLRFYSDNSVQRKGF 852          

HSP 11 Score: 78.1814 bits (191), Expect = 3.063e-13
Identity = 99/502 (19.72%), Postives = 186/502 (37.05%), Query Frame = 2
Query: 9812 YENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNN-SPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV----------FISSHDKVIIQYQVGPMENINSAT-------DRRFQISYELYTCN------------RTEKAYSGRIVNVEN-----FKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-----KYCG 11086
            Y  ++ C W+I+   G   K+I    S+ L  RSR+  C YD++ + DG     P+    CG    + I +  + +++ F +  N    GF   + A+   +     V      ++SP YP++  P  +      I  +E  H+ +T +  +I    +C+ D   ++D   +    I ++C     + +          F+S        + V   + ++  +       ++R   +   Y C+            R E A  G +  +          K+Y  N  C   L+ P    R    F +F  E +  C YD+++   G   + + +  K CGS  P    +  + + + F +D +++  G+   +  ++D   K                                     C  ++   SG ITSP +   Y    EC+W I       +K  F +M + +    +P C    D ++V  G  A      ++CG
Sbjct:  342 YSAHMHCVWRISVTPGE--KIILNFTSLDLY-RSRL--CWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGD-----VKKDYGHIQSPNYPDDYRPSKVCIW--RIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPT-QYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK-LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIES----QPEC--AYDHLEVFDGRDAKAPVLGRFCG 823          

HSP 12 Score: 77.411 bits (189), Expect = 5.677e-13
Identity = 53/230 (23.04%), Postives = 104/230 (45.22%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI-SGSNS-GHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTKRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +   +    ++ ++F++ DI    EC +D +++  G ++   +  R+C   K E +    +    ++ + F S+++    GF+A  +  +CGG      K    Y  +   ++ Y           C W I       +  VF  F +E   +C YDY+EL   +D+   R  G +  SGP     +    ++++F SD++++ +GF +R+ + K
Sbjct:  760 SPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGS----RMFLRFYSDNSVQRKGFQASHAT-ECGGQVRADVKTKDLYSHAQFGDNNYPGGVD------CEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRL-GRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRYTSTK 977          

HSP 13 Score: 74.3294 bits (181), Expect = 4.206e-12
Identity = 139/670 (20.75%), Postives = 240/670 (35.82%), Query Frame = 2
Query: 5903 GVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR-RLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVE------------FTGSKNP----IFSFIEYVAMVKCGSLNNSEFNV----------------FQTYLFNSIKITYKADEFDPFPGFKLSYKK----ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITN---------------------------------SSWIIVNLFGNFSSESRYSGFQIMYSKKD-EECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMDDFSYFRLKVKIGS-CGGLLHR----RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            G  +SP++ + Y+      W +     EK+   F    + R RL    C    + + D  +        FCGS + +  + T     +   S+  +   GF   +      + KK                + SPNYP+     + C W I       + +   SF++E    C Y+   V             + G + P      S   ++  V  GS+N + F V                 +    N++  +YK       PG++L+  K    A    F   L GS+ +  +P +   NKNC + L +    Y ++L         N  C   F+++ +       ++   CGS  P  +     N                                      VN FG++  + R SGF +  +K D +E G  H++T    +     + N     P   EC W  +S PG R+++ F E+ I S+  C    L  FDG       +G   FCG  K   +   G+ + + F + +       +    + CGG +      +  Y  +     NYP    C W I       + L F   +++E  +C    + +    +S    +   C S    ++Y+   +V + F ++   T+KGF L+Y
Sbjct:  331 GNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRL----CWYDYVEVRDGFWRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKK------------DYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLG-SYKCS---CDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAP-TQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCR-SGFVLHDNKHDCKEAGCDHKVTSTSGTIT---SPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLG--RFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYMELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTITKKGFHLRY 973          

HSP 14 Score: 70.8626 bits (172), Expect = 5.258e-11
Identity = 89/402 (22.14%), Postives = 161/402 (40.05%), Query Frame = 2
Query: 6641 GSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-----AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHM-TPHFIE-------CKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDDFSY----------------FRLKVKIG------------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLT--FMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC 7654
            G+  + EYPN    + +C + I  +     ILN T+LDL    +  C   ++++         +    CGS +P   +PI++  S     L+  F S S + G +  ++  +  CGG             D+  +  H+ +P++ +       C W      G  + + F+   I R   C   +L   DG +  +  IG   +CG  K + I +  + L +                 FK +D+ S                 ++     G            +CGG L +  G I SP +P  YPP  +CIWQ+   +   I L   F + + ++ C    + V     +++ +    C S   ++ T +Y+ +R+ FK++   ++KGFK  +F +   C
Sbjct:  331 GNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLY--RSRLCWYDYVEVRDGFWRKAPLRGRFCGSKLP---EPIVSTDS----RLWVEFRSSSNWVG-KGFFAVYEAICGG-------------DVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIG--RYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDEC 707          

HSP 15 Score: 62.3882 bits (150), Expect = 2.041e-8
Identity = 127/595 (21.34%), Postives = 208/595 (34.96%), Query Frame = 2
Query: 6260 NQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-AMNINKTL----CGSNIPPDLQPIIT------------NSSWIIVNLFGNFSSESRYS---------------------GFQIMYSKK--DEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTR--MQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMDDFSYFRLKVKI-----------GSC-----------------GGLLHRRQ----------------GYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPER--------ELNSTNYPKTLSWFLRCTWKI 7744
            + T   +SP YPN       C W I     E + +   S DL  S  C Y+   V +    K P+           CGS          + L+    + +++       GF   Y+  C  D +    G +Q+  YP+    +K C + ++     + + LT        +  C   +L++    + + TL    CG   P D++   +            N +   VN F      SR +                     G+++   K+  +  CGG   LT+   S I      + +  P    C W   +P   R  +Q DF E      +C   F+    G T  ++  G   FCG  K   I +  N + + FK+ +  S    K              G C                 G +LH  +                G I SPN+P  YP    C W IS      ++LTFM+ D++    C+  +L V   ++++  V+   C S   + +    S + + F ++    RKGF+  +  E   CGG+     +        +    NYP  +     C W I
Sbjct:  328 DSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGFWRKAPLRGRF-------CGSKLPEPIVSTDSRLW----VEFRSSSNWVGKGFFAVYEAICGGDVKKDY-GHIQSPNYPDDYRPSKVCIWRIQVS-EGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSTLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGF--LTKLNGS-ITSPGWPKEY--PPNKNCIWQLVAPTQYRISLQFDFFE-TEGNDVCKYDFVEVRSGLTADSKLHG--KFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCDHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFMEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGSRMFLRFYSDNSVQRKGFQASHATE---CGGQVRADVKTKDLYSHAQFGDNNYPGGVD----CEWVI 894          

HSP 16 Score: 58.9214 bits (141), Expect = 2.225e-7
Identity = 64/278 (23.02%), Postives = 116/278 (41.73%), Query Frame = 2
Query: 10391 DKVIIQYQV-------GPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-----KYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGFRI 11182
            D ++ +Y+V       G    ++     + +  Y+   C  T +  +G   + E      YS ++ C +  I+  P  +    F   +L RS  C YDY++   G    +  +  + CGS +P   V+  SR+ + F +  +    G+   Y         CGG++  D G I SP +  +Y  S  C W I++    ++   F   ++  + S         D+++V  G+        +YCGY   D+   I S+S  +  K ++ G    AGF +
Sbjct:  284 DTIVPKYEVNGVKPPIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEY--PNGYSAHMHC-VWRISVTPGEKIILNFTSLDLYRSRLCWYDYVEVRDGF-WRKAPLRGRFCGSKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVY------EAICGGDVKKDYGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCA------YDYLEVRDGHSESSTLIGRYCGYEKPDD---IKSTSSRLWLKFVSDGSINKAGFAV 542          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Human
Match: NOTCH2 (notch receptor 2 [Source:HGNC Symbol;Acc:HGNC:7882])

HSP 1 Score: 140.969 bits (354), Expect = 3.823e-32
Identity = 133/405 (32.84%), Postives = 180/405 (44.44%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNT----------------------------DICGHGTCYP----DHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKY-PCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSG-------DGVGENGCVIVSTNVTNRAYRRC-----VRRQLCR-----------NGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            DDC N+ C NG  C+DG N++ C CP  + G+ CTEDV+ECL      + CQNG  C N  G + CVC   WSG  C+  I+ C+ AS T                            D C    C+     D +P N + + C C  G+        C  D+DEC +    PC       CVNT G   CE C  G+ G     +DINEC ++  C  +  C++  G + C C+ G K      C+LE N C++N   C  N  C     R +   C C PG++G       D      C+  +  + +     C         LC            + G CQ  +  +TC C PG+ GA C   I ++C S+PCLN G C  L  N Y+C+CQP  SGVNCE
Sbjct:  262 DDCPNHRCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVDECLL---QPNACQNGGTCANRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASFSCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQ-YICTCPQGYK----GADCTEDVDECAMANSNPCEH--AGKCVNTDGAFHCE-CLKGYAGPRCE-MDINEC-HSDPCQNDATCLDKIGGFTCLCMPGFK---GVHCELEINECQSNP--CVNNGQCVDKVNRFQ---CLCPPGFTGPVCQIDIDDCSSTPCLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYMGAICSDQI-DECYSSPCLNDGRCIDLV-NGYQCNCQPGTSGVNCE 643          

HSP 2 Score: 132.88 bits (333), Expect = 1.114e-29
Identity = 136/449 (30.29%), Postives = 181/449 (40.31%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFV---ACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGM----------------KRRA---NNMCQLENVC-------------------------ETNNGGCSTNAACSANNFRIEGRICTCNPGYSG----------------------DGVGENGC--------VIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFL-FPNHYRCHCQPLFSGVNCENEHIVC-------GGTYAVSN 1567
            DDC  NPC NG  C+DG N+F C+C   F G  C  D+NECL        C+NG  C + + S+ C C   + GV C   IN C+ +S  N   C  G             F CLC  G++       C+ +I+E       CS HP +    CV+  G  RC  CP+G+ G     L +N C+ +  C     CV      QC C  G                  RR     ++CQ   VC                         E  +  C   A CS  +F I G  C C PGY G                      D V    C        ++   N+ +     C R   C NGG C   + G++C+CLPGF G RC   I N+CLSNPC + G+ + +   N Y C C+  F+G +CE    VC       GGT AV++
Sbjct:  913 DDCLANPCQNGGSCMDGVNTFSCLCLPGFTGDKCQTDMNECLS-----EPCKNGGTCSDYVNSYTCKCQAGFDGVHCENNINECTESSCFNGGTCVDGI----------NSFSCLCPVGFT----GSFCLHEINE-------CSSHPCLNEGTCVDGLGTYRCS-CPLGYTGKNCQTL-VNLCSRS-PCKNKGTCVQKKAESQCLCPSGWAGAYCDVPNVSCDIAASRRGVLVEHLCQHSGVCINAGNTHYCQCPLGYTGSYCEEQLDECASNPCQHGATCS--DF-IGGYRCECVPGYQGVNCEYEVDECQNQPCQNGGTCIDLVNHFKCSCPPGTRGLLCEENIDD-----CARGPHCLNGGQCMDRIGGYSCRCLPGFAGERCEGDI-NECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPQMPCLNGGTCAVAS 1323          

HSP 3 Score: 126.331 bits (316), Expect = 1.117e-27
Identity = 130/420 (30.95%), Postives = 171/420 (40.71%), Query Frame = 2
Query:  473 LTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHG---------------------------------CQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHS--------------------PTNPKP---------------FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTC-LDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            +  D+CA+NPC  GA CI+G N F+CICP+      C   VNECL  +  IHG                                 CQNG  C+N +  +RC C   + G  C + I+ C  ASN  +   GTC+ D S                    P +P P               + CLC  GW      + C  DIDEC + K PC  H    C NT G   CE CP GF  +G  C  DI++C  A  C     C++G  T+ C C+ G      + CQ + + E  +  C     CS     +    C C  G+ G        V    N+             C NGGTC   +  F+C C  GF G+ C   I N+C S+PCLN G C       YRC C   ++G NC+
Sbjct:  681 IDIDECASNPCRKGATCINGVNGFRCICPEGPHHPSCYSQVNECLS-NPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNIDEC--ASNPCL-NQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPNPCENAAVCKESPNFESYTCLCAPGWQ----GQRCTIDIDEC-ISK-PCMNHGL--CHNTQGSYMCE-CPPGF--SGMDCEEDIDDCL-ANPCQNGGSCMDGVNTFSCLCLPGF---TGDKCQTD-MNECLSEPCKNGGTCSD---YVNSYTCKCQAGFDG--------VHCENNINE------CTESSCFNGGTCVDGINSFSCLCPVGFTGSFCLHEI-NECSSHPCLNEGTCVDGL-GTYRCSCPLGYTGKNCQ 1061          

HSP 4 Score: 119.783 bits (299), Expect = 9.877e-26
Identity = 112/388 (28.87%), Postives = 169/388 (43.56%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECR-------------VGKYPCSIHPFVACVNTPGDVRCEDCP-------IGFEG-NGFTC------------LDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSAN-NFRIEGRICTCNPGYSGDG--VGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            +L  ++C +NPC N  QC+D  N F+C+CP  F G  C  D+++C         C NGA+C +    + C C+  ++GVLC   I++C    + D C HG C           + C+C+ G+    +   C   IDEC              V  Y C+  P  + VN   ++  +DC        I  +G N ++C            +DI+ECA +  C     C+NG   ++C C +G    +         C +    C +N     N    + G  C C+ G+ G    V +N C+                   C+NGGTC   + G+ C C  GF G  C+  I ++C SNPCLN G C F   + Y CHC   ++G NC+
Sbjct:  492 ELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP-----CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNC----DPDPCHHGQCQ-----DGIDSYTCICNPGY----MGAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNC--EINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECA-SNPCRKGATCINGVNGFRCICPEGPHHPS---------CYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECL----------------SNPCQNGGTCDNLVNGYRCTCKKGFKGYNCQVNI-DECASNPCLNQGTC-FDDISGYTCHCVLPYTGKNCQ 831          

HSP 5 Score: 117.857 bits (294), Expect = 3.814e-25
Identity = 120/412 (29.13%), Postives = 172/412 (41.75%), Query Frame = 2
Query:  464 KEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCN---IP------INSCSNASNTDICGHGTCYP-----------DHSPTNP-----------KPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGEN--GCVIVSTNVTNRAYR-------------------RC------VRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            KE    D C ++PC NG+ C    N F C C   F G+ C  DVNEC  I G    CQ+G  C N  GS++C C   ++G  C+   +P      +N  +     D      C P           D  P +              + C C   W+     + C  D+DEC +   P +      C N  G   C  C  G+ G+  +  +I++CA A +C P   C++   ++ C C +G   +A  +C L++ C +N   C   A C  N    +  ICTC  GY G    E+   C + ++N    A +                   RC           C+N  TC   + GFTC C+PGF G  C   IN +C SNPC+N G C     N ++C C P F+G  C+
Sbjct:  140 KECQWTDACLSHPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNEC-DIPGH---CQHGGTCLNLPGSYQCQCPQGFTGQYCDSLYVPCAPSPCVNGGTCRQTGDFTFECNCLPGFEGSTCERNIDDCPNHRCQNGGVCVDGVNTYNCRCPPQWT----GQFCTEDVDECLL--QPNACQNGGTCANRNGGYGCV-CVNGWSGDDCS-ENIDDCAFA-SCTPGSTCIDRVASFSCMCPEG---KAGLLCHLDDACISNP--CHKGALCDTNPLNGQ-YICTCPQGYKGADCTEDVDECAMANSNPCEHAGKCVNTDGAFHCECLKGYAGPRCEMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEIN-ECQSNPCVNNGQCVDKV-NRFQCLCPPGFTGPVCQ 530          

HSP 6 Score: 108.227 bits (269), Expect = 3.593e-22
Identity = 110/384 (28.65%), Postives = 163/384 (42.45%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWS---LDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLD-INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFR-IEGRICTCNPGYSG-------DGVGENGCVIVSTNVTNRAYRRCVRRQLCRNG--------------------GTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            ++  ++C ++PC N A C+D    F C+C   FKG HC  ++NEC       + C N  +C + +  F+C+C   ++G +C I I+ CS+      C +G    DH    P  ++C C +G++    +     C  D D C  G+    I  +  C+  PG +            G  C D I+EC ++  C  +  C++    YQC C  G              CE N   C++N          I    C C+PG++G       D    N C   +T +      RC+    C  G                    G C   L+G+ C C  G+ G  C  V  N+CLSNPC NGG C+ L  N YRC C+  F G NC+
Sbjct:  454 EMDINECHSDPCQNDATCLDKIGGFTCLCMPGFKGVHCELEINECQS-----NPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP----CLNGAKCIDH----PNGYECQCATGFTGVLCEENIDNC--DPDPCHHGQCQDGIDSYT-CICNPGYM------------GAICSDQIDECYSS-PCLNDGRCIDLVNGYQCNCQPGTSGVN---------CEINFDDCASNPCIHGICMDGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINGVNGFRCI----CPEGPHHPSCYSQVNECLSNPCIHGNCTGGLSGYKCLCDAGWVGINCE-VDKNECLSNPCQNGGTCDNLV-NGYRCTCKKGFKGYNCQ 793          

HSP 7 Score: 70.4774 bits (171), Expect = 9.118e-11
Identity = 104/404 (25.74%), Postives = 147/404 (36.39%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCI-------------DGY------------------------------NSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGH----GTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFV---ACVNTPGDVRCE-DCPIGFEGNGFTC-LDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEF-LFPNHYRCHCQPLFSGVNCENE 1531
            D C  N C NG  C+              G+                              ++++C C   F GK C +  + CL      H C NG+ C      F C C   ++G  C   +N C      DI GH    GTC        P  ++C C  G++              C     PC+  P V    C  T GD   E +C  GFEG+  TC  +I++C N + C     CV+G  TY C+C     +     C  + + C      C     C+  N    G  C C  G+SGD   E        N+ + A+  C        G TC   +  F+C C  G  G  C   +++ C+SNPC  G  C+       Y C C   + G +C  +
Sbjct:   66 DPCEKNRCQNGGTCVAQAMLGKATCRCASGFTGEDCQYSTSHPCFVSRPCLNGGTCHMLSRDTYECTCQVGFTGKEC-QWTDACLS-----HPCANGSTCTTVANQFSCKCLTGFTGQKCETDVNEC------DIPGHCQHGGTCL-----NLPGSYQCQCPQGFT-----------GQYCDSLYVPCAPSPCVNGGTCRQT-GDFTFECNCLPGFEGS--TCERNIDDCPN-HRCQNGGVCVDGVNTYNCRCP---PQWTGQFCTEDVDECLLQPNACQNGGTCANRN---GGYGCVCVNGWSGDDCSE--------NIDDCAFASCTP------GSTCIDRVASFSCMCPEGKAGLLCH--LDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTED 415          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Celegans
Match: ZC116.3 (Probable cubilin [Source:UniProtKB/Swiss-Prot;Acc:Q20911])

HSP 1 Score: 289.271 bits (739), Expect = 2.323e-77
Identity = 479/2153 (22.25%), Postives = 808/2153 (37.53%), Query Frame = 2
Query:  146 NSIDDSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIK-------EKLTYD------------------------DCANNPCHNGAQCIDGYNS-FKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICG-HGTCYPD------HSPTNPKPFKCLCDSGW--SLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINEC-ANAYTCGPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANN---FRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQ-KSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVS----------NEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNS-------TPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI----NFVDREIKITACNQNMYFNKKFIVNRFM-VHFHSD---SRSDVNSTR-FQFRWKKAISQEPCGATITMNPN-----AIIESP----AIPADVEAFCTWKIKQTNS----SRLIRLKGTFE--------------------------------------------NWFD-GDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIF-FKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDIN--DDSECKF---------DFIKISG--SNSGHLDQRYCNGN----KNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIG--YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHP--NCAYDYLEL--------IHDNQTKRFCGNHAKSGPTV---THKLVIRFVSDNSVSGEGFIMRFYTVKRDQYC-YESFESSSGLITNPTLEKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATL------KXXXXXXXXXXXXNVC-PTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRI------LIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVI-------FQNLASTKYRFRLYYTQDCEFPITSS-SGRIESKNEMLR-----YCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPI--RIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKN--GVIQSAQFPNSI----ANID-------CQWNFQTIPGFSVKLKFDIIE-MESSINCSEGPILRAWENEIVDENYV---FQA-CNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMS----------GSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDF-------------------ETEESLCRY------DYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSR----------GFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVA---NTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGS--STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLR 5818
            +S +   R++  +GN+       K+I+F T   G+I +++ D+S L D     +      N       ++  +       +  ++   L ++ H + AL N   ++        +K+  D                         C  N C NG  CI  + + F C+CP +F G  C  D++EC   +GT  GCQN   C N  G F C C   + G LC   +++CS     ++CG HG C          S ++   +KC+CD G+  S D    TC+ D++EC     PC  HP V C+N PG   C  CP G++ +G  C+D+NEC      C P  +C N  G+Y C  C  G      N C  ++ C  N   C   A C   +     +    C C  GY GDG+GE GCV  ++NV         +   C N G C+  S T + C+C  GF G  C     + C +NPC NGG C     N   C C   F G  CE E   CG  +  S          +   E+S+   +   P+ +     +    +  D+F Q          DC++    L      E++++    +C  S+S       TP    +TG++L  +    +       F IK       +E      C   S++      G+   P    +  Q+I C     A  G    V +   ++   D++    D + L+I       D+   +  C+  +          F+ V F S+   S + + + R F  ++K       CGA I  + N      +IESP      P +++  CTWKI  T S    S  + LK TF+                                            N FD G C+             +Q    TC  R     N L V N   +  F          F+I  E  C   VN +       Q+ N+P N      C Y   A +T  I++ FL   +     SEC +         ++++ SG  +++   ++RY        +   +++++     +I +    N  F G     K S   CGG F      I    YPE            +Y+ +  C + +       +   FD F LE  P  +C YD +E+        +H     +FCG  A   P++   T+ + + FVSD SV+G G+  +F  V R   C +     S+ LI +P   K      C Y I V + ++ILI +       +  ++PC   + +      +           + +C P       I++ SN  TI Y      + G F + + Y ++   CG       G +++P YPL    N  C W +    G ++      L  +N   SG        N  +     +   + +   C++++    +  + +  +I       FQ  +   + F  ++T  C   +  + SG I+S     +     +C+W +   +G++I+  +  F +    + + Y    I+  ++ L            TF  ++Y I   +  Y D++    +   H  + L Y +QG       DP    + + N  G  +    P  +     NID       CQ+  Q   G  + LK D ++ +    NC+       +   + D N     FQ  C+ I+      I S T+  +L      D       F  T EF +     +            G +  I SP YP+ Y   ++C++ +       I   +  +                    T    C++        +  +   ++    ++ LC + ++ +QT F    ++ L+ F       S+          GF       CGG+  A    Q +       +Y   +GIC   +       SEI +R+  Y           N SS +++     I     +K     K+  + +       ++++   + NA   A   V +   +CGG+     G   +P     ++   DC + I NS G+++ LSI + + ++  +     +I+IR   N +  L+ R   +S I +  Y    + S+++ LR
Sbjct:   32 DSYETRSRILMVDGNVWLHAGKDKNITFKTTGNGRIYVDETDVSKLPDIASFKQLVGRIEN-----TSQMFTTLKSRQDTQTSAMRVVLNSAKHYLVALRNMTLEVNILKKWKTDKMARDMRRRGLLVKMTRQIIGINKLIAINACDPNKCSNGGTCIPSFGAKFTCLCPPHFTGTTCEADIDECSVYNGTTAGCQNNGTCINNRGGFECQCQSGYHGSLCQYHMSACSKT--FELCGPHGHCIESIVDPTGQSSSDTTTYKCICDWGFKVSSDKNNPTCV-DVNECESN--PC--HPGVDCINLPGSFVCSGCPKGYKTDGNVCIDVNECEGEIRVCSPLSKCHNTLGSYYCDSCPTGYSGDGGN-CVKDDSCVKNK--CHKLATCKVTDDGYSAVGDYTCYCPDGYVGDGIGEEGCVKSASNV--------CQNHNCVNAGKCKPTSDTEYKCECEAGFLGKFCEKT--SPCQTNPCKNGGTC-IAVENSAYCDCPEHFFGRACEEEEEHCGSHFTHSSGNYTFDLQRSNKTELSICDFVFNIPAAN---SAVVMTFTEFDKFTQ----EGSGPTDCAKTDANLTLYDGPEDSSSEFATFCGDSHSVHAPLSDTPITMTSTGAMLRFRGTQGS-------FTIKW----ETVER----KCGYRSSK----PEGIISVP----QNHQDIVCEWFISAPGGKIIEVTIPPVSMHSKDIEK--CDQNSLEIYDGYATYDKHRILETCSSTLESQVVRTTGPFLTVAFISNMLQSDAGLETIRGFVLKYKFTTPDRECGAEIDNDSNDFSFSGVIESPNYGSLYPPNMD--CTWKINGTLSNGSYSGDMVLKLTFDEYDVKSGFSANGPGMHYRSFRRLLPRNEVEYGIAPGFSRVFAYRNLFDMGTCTNDFLKIHDGDGTLVQE---TCNPRR--PPNVLTVNNPAAVLTFHSDSAEQGKGFRIQYEMLCEKRVNGNGT----IQTWNFP-NGGAAGTCTYIIEAPKTHVISVRFLTIGLRVLPMSECFYTPNAVETYENYVEFSGGRTDNALFNRRYVCARYPFVEGAWMSVSAARRL-QIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGTISSPNYPE------------KYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCG--AMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKFEAVSRKTTCDFTLTAPSNNLIFDPQQLKFDK---CTYHIAVHENQRILIKM-------NNMSLPCDKSSLMFRNGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVYK--SINSEGSF-FNLTYETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKYVQSGGFQ--SKKIFGFSGHFTTLCNGIVHEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHHFSI----SQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIPRVIRSRHNSMKLTYSSQG-------DPTNQFWLSWNTLGCSRDITAPQQLIITKENIDPEVDEFECQYKIQAPIGKQINLKIDKMDILPIGTNCTYTKDFSGFAIFMSDSNKSGTPFQTYCSSINQQN---ISSHTNELFLFLSMKKDKLKTNVFFNATVEFVDVPQSSQSDICGQVINLERGKKNYITSPGYPSAYLPGIKCNFLINAPPGYHIEYALEKYYSPYYHDDRKTDKPRFMSPYTANYTCKWYLAYNVGMLSFYEGNSSSSSPVERLCDE-SDTVQT-FELYASQSLVIFEGASNYMSQKSGEGVRDQIGFVLSMIPKCGGVVYAESKPQTI------SLYHEGEGICNVTIKKKDPQDSEINIRLEEY--------TKLNSSSTHTIDDRIDIYVGGVLKYTEMLKATDNTMQEYASDEEMMISVQNANAPHSAIIVVSTDDKSCGGEVRHSQGTIYAP--TRRLDKPFDCGWAISNSNGNTVTLSILDHNLKSTPN-CTDSYIEIRAN-NSSGKLIKRQCDISSIDSTEYE---SQSLYVFLR 2047          

HSP 2 Score: 203.756 bits (517), Expect = 1.980e-51
Identity = 260/1089 (23.88%), Postives = 447/1089 (41.05%), Query Frame = 2
Query: 8249 FIFQPGREVNMSNYRVEIGYKFSRCGGLLTE-SFGYIKSP--GYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNET--------LSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSE----------------LCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF--------FG-CRYHDNQIQIDLEDQN--------GNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLK-NYNFRARYLHD---ENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI---FCGNLTNISPFMIDTNV--LIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCR-----YDHITIYDGPDSARPVIQ-TLC--GDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQ-------NHLIKTVTNFSQLLESPRYPNN--SPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFI-IQD------------ASLKHENKIEKFCES-LSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRT---EKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLER----SSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITY---VVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTD---FVKVSYGNQ-----------ALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISW 11188
            FI Q  R+     + + I  +F +CGG+++  + G I SP  G   KY   + C W++ APE  I+++ I  + + +  +C  DHL I    + D     K C       E         +  H   + L + ++    + G+ I+Y F+N  + C        G+I +P +  K Y ++L C W I VP GY ++L FK  FD+E  +   C  D L I   ++    S                 LCG   P +   S  N++ L F+TD      GF   +++ CG +Y L  G I S          ITC YLI   + +  +   + +F        FG     D+ +QI     +           +P   +  K    +  +  KS   +     +  K +  F+  Y  +   +N+++         + +P FP PY  + +  W          +I    + +E  +D C+ D++ F  +S   ++     FCG +  I  + I T+   L++  ++D +   N  GF   +  + G   GCGG + AT     +    D D N  Y   LLC W I+ P    +++  +   +  E      G R      D + IYDG +   P++   +C  G      + T     ++ F TD +    GF ++++ V S         + IKT+       +  +  N   S    RFM   I   +T+ + +  +   I S      D F+ I+D            A   ++ KI K C + + T  V  ++  ++I+   + P +N  S    +F+ +  L +CNRT       SGR+ +  N+ Q  YS N  C   L   + N +    F  F LE     +  C YDY+    G+     Y     CGS++P + +T+   ++ +  +D S+N+ GYD +Y   V  RD  I+      L+ GVI+S G+   Y +S    + ++  ++      FTD+ + + T L   C+  T+    ++V +  Q           ALK    ++L+ +       F  +  + +   G GF+I W
Sbjct: 2974 FISQLFRDQEGQQFNLTI--EFQKCGGVISSPNTGDITSPNFGSGLKYLPGSKCRWVLEAPEGQIVKVKIVEMQIAYDHECENDHLIIGEGRQADVNTIHKYCHKMDGEQEQKLEDRFKIIKSHGRYLTLIWVTNMKYEEAGWKIQYEFLNENEECGYHTSGMSGTIYTPMFGDKDYENDLECVWDIQVPLGYHINLKFK-DFDVE--TAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKETPLCGIEHPKD-FESESNRVRLNFTTDSQTTARGFRVNWEAECGAIYRLNHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFCASEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSKGFQLAYSINKCGDNIELREGTGFITTVTSPAFPLPYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHD-CSADYIEFFDSSDIMANKTLGKFCGTMDKIPQYRIVTSGPNLLIHMRTDFN--VNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGN--YPPALLCGWTISGPVDSQLQIRID--GVDTEQLEYPPGDRPSPECIDALAIYDGQEFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFNISYSIVDSDCGGWLKATNEIKTLVYKGITSDDNKEMNKERSHQRCRFM---IQGPKTEPVIVNFQQFNIPSKAGDCSDSFVEIRDVGSLQECKHPACAREPNQRKITKLCGTHVPTSHVSNTNTIQIIVSADIMPNKN-QSRPSLKFEYNI-LDSCNRTIDTNTIKSGRLTS-PNYPQV-YSENSTCVTNL--QSSNQKMLLVFNDFTLEEPNNVNKNCDYDYLMLKEGDSNGTYY-----CGSTLPKALMTSGKDLTALLKSDHSLNHAGYDASYYTVVSERDDQIQFADSYELE-GVISSIGYPNGYNKSYTQIFTLRPPNSHDCSIIFTDVSI-SMTQLPEECFQPTEEYLEIEVKFKTQVKKARIRSCTFALKKARELILEADNNDRYIKFAFKSDAKSENDGRGFKIRW 4033          

HSP 3 Score: 89.7373 bits (221), Expect = 4.992e-17
Identity = 176/783 (22.48%), Postives = 280/783 (35.76%), Query Frame = 2
Query: 8123 CSNVYFVSKIGNGLREPVEDFGTGCNE---------RNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKF----SRCGGLLTESFGYIKSPGYPEK-YPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDC------------------NYDHLFIRYAEEFDSPPFRKLCGL-NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLE--RTSL--HTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNH------------NLEGFHAQYK-SICGGVYDLRQG-----EIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQ----IDLEDQNGNYLPGQRICGKSREKIT---IMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLT------WIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLG-----------CGGYMNAT----VGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYD--------GPDSARP----VIQTLCGDDQVDSITTQSNVMYLIFSTDF----NIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYP 10174
            C N + +  IG G +  V      C++          +R     + G+ +  I+    +   + ++++  Y+F      CG   +   G I +P + +K Y ++ +C W I  P    I L  +   +E   +C                  N D+ F+   EE ++P    LCG+ +P   E+ S   NR+RL+F +D   +  GF + +        C  I     G I SP YP  YP+++ C + I  P+   V       FDL   RTS     C  D L+IID+    +L   C + P           + L F +D ++              +GF   Y  + CG   +LR+G      + S    L     + C + I    N  Q+   +       +HD         D  D   N   G + CG + +KI    I+ S    +++   +F++ +  F+   +     K     K           SP   + N        W  + PV     I +  VD E+      Y      +     + AI+ G     SP +             I +  +   F+ F     G   G           CGG++ AT       Y  I S D        ++  C++ I  P    V V F+  +I     S+ G C    + I D         P  AR      I  LCG     S  + +N + +I S D     N  +   K  +  + S N  I T T  S  L SP YP
Sbjct: 3052 CENDHLI--IGEGRQADVNTIHKYCHKMDGEQEQKLEDRFKIIKSHGRYLTLIWVTNMKYEEAGWKIQ--YEFLNENEECGYHTSGMSGTIYTPMFGDKDYENDLECVWDIQVPLGYHINLKFKDFDVETAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKETP----LCGIEHPKDFESES---NRVRLNFTTDSQTTARGFRVNWEA-----ECGAIYRLNHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFCASEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSKGFQLAYSINKCGDNIELREGTGFITTVTSPAFPLPYTKDLDCVWNITTDPNR-QLNIRFEEMKLEAFHDCSADYIEFFDSSDIMANKTLG-KFCG-TMDKIPQYRIVTSGPNLLIHMRTDFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYPPALLCGWTISGPVDSQLQIRIDGVDTEQ----LEYPPGDRPSPECIDALAIYDGQ-EFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFNISYSIVDSDCGGWLKATNEIKTLVYKGITSDDNKEMNKERSHQRCRFMIQGPKTEPVIVNFQQFNIP----SKAGDCSDSFVEIRDVGSLQECKHPACAREPNQRKITKLCGTHVPTSHVSNTNTIQIIVSADIMPNKNQSRPSLKFEYNILDSCNRTIDTNTIKSGRLTSPNYP 3806          

HSP 4 Score: 82.0333 bits (201), Expect = 1.268e-14
Identity = 100/419 (23.87%), Postives = 185/419 (44.15%), Query Frame = 2
Query: 4511 NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPIL-------RAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNF------YLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGS--EGIIQSPNYP-NFY-PHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLV-------KLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFK---AKYFETCGGLRMAMESN---QFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYF--MGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKST--SGNAIFKAAYGVGSSTCGGDFYLDDGL---FTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIE 5650
            N+ C+W  +      ++LKFD +E+E   NC+   +        +  EN+ VD + V + C       +++  ++T NF      ++ F +    +G    F+  Y  T  S EH   G   E  + SPNY  NF+ P   +C ++L ++ +  + ++I+D + +E S C Y+   I     ++LV       K    CGK+    +  F+S    + IK+ +    S +GFK    +    C    + ++ N   + L SP +P    +P+ + CE+ + A     G R+   F    F+   N  NC   + + I +G   +S V  + C       I S  ++L + L ++    +  F A YG+  +TCGG   + + +    TSP +P      + C + +++     I+  ++
Sbjct: 2235 NLHCRWIIRRPMFTGIELKFDYLELEDVQNCAFDFVSFRLQFDDQPEENDDVDLSSVSKHC-------ALVRSNNTFNFSVNRALHIHFVTDRSRHG--IGFKLKYRLTCNSFEHIRPGIFFEHTLTSPNYDGNFHTPSVWKCQYSLIIESNRKVSVEIVDLDIQENSPCSYNNALILGNRFSELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIKYNSGPN-SRKGFKMIIKEQLTECPSGVLHVDDNSPSRVLNSPEFPQ--RIPNSVECEYVMAAPN---GHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATYGI--ATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVD 2636          

HSP 5 Score: 80.8777 bits (198), Expect = 2.520e-14
Identity = 124/531 (23.35%), Postives = 215/531 (40.49%), Query Frame = 2
Query: 6320 CTWTILTDRTEALDIQMLSFDLESSYECKYENFTVE-----FTGSKNPIFSFI---EYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPT------NGKCVNGFLKILAMNINK---TLCGSN-IPPDLQ--------PIITNSSWIIV---NLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHF--IECKWHFTSPPGTRMQIDFEELVISRI-ICNESFLAFFDGSTTFTQKIGGQNFCGKTNSI-----FTIGNVLTILFKNMDDFSY----FRLKV-----KIGSCGGLLHRRQGY--IASP-NYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE-----------NCSKSNLTVIPVKESENAVIWSN-CNSST---WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSW 7720
            C W I       ++++   FD+E++  C  +   +         S N  + F+   E      CG  +  +F        N +++ +  D      GF+++++  C   +R    G + +  YPN    +  CT+++     N ++ +   D    T         C + +L+I+    ++   T C S  +P D            +++ S+  +   N +G   S+    GFQ+ YS    +CG   EL R     I  + S    + P+   ++C W+ T+ P  ++ I FEE+ +     C+  ++ FFD S     K  G+ FCG  + I      T G  L I  +   DF+     F+L V     +   CGG L     +  + SP +   NYPP   C W ISG   S +++     D ++            C  + L +   +E  + ++  + C S T     +YT +    I F+T+   T +GF + Y   D  CGG        L +TN  KTL +
Sbjct: 3154 CVWDIQVPLGYHINLKFKDFDVETAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKETPLCGIEHPKDFESES----NRVRLNFTTDSQTTARGFRVNWEAECGAIYRLN-HGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFCASEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSK----GFQLAYSIN--KCGDNIEL-REGTGFITTVTSPAFPL-PYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHDCSADYIEFFDSSDIMANKTLGK-FCGTMDKIPQYRIVTSGPNLLIHMRT--DFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYPPALLCGWTISGPVDSQLQIRIDGVDTEQLEYPPGDRPSPECIDA-LAIYDGQEFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFNISYSIVDSDCGG-------WLKATNEIKTLVY 3660          

HSP 6 Score: 78.1814 bits (191), Expect = 1.745e-13
Identity = 187/897 (20.85%), Postives = 319/897 (35.56%), Query Frame = 2
Query: 7136 CNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGN---VLTILFKNMDDFSYFRLKVKIGSCGGLLHRR---QGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKE---SENAVIWSNCNSSTWDIYTEYSTVRI---IFKTNTVTTR-----------------------------KGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRI----------IVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVF-------GSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNER-------NRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKF--SRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCN-YDHLFI-RYAEEFDSP-----PFRKLCGLNPISNETLSFHRNRMRLSF-HSDFSVSKNGFVIEYNFINPADTCNGIIFNT-EGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLH----TCHYDSLRIIDS--------------NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIP---GWENHLQV--VYIYPNFFGCRYHDN--QIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKN---YNFRARYLHDENVKVFSDF----------KRPYVLKTPNFPSPYHHNANLTWIFNAPVGY 9484
            C   FL   DG  T  Q+        +  ++ T+ N   VLT    + +    FR++ ++     L  +R    G I + N+P N     +C + I       I + F+            L V+P+ E   + NAV        T++ Y E+S  R    +F    V  R                             KG  L+Y   D  CGG +S     ++S NYP+     + C + + V  SK +          +   K  + ++               LL   C + +      T ++M  VF       G G    F   S + +   +   P+NN   +   + +    C Y+I  +      + M   +N  +PC     + +  NG  E    F +   E        N M    +    V  ++   + +N       + Y+   S CGG +    G + +P YP     N  C+W +       ++  +  L   +  D   +  LF     + FDS        ++ C    +++E ++   N + + +  S    SK  F    +F      CNGI+     GSI+SP YP    SN  C WTI VP+G ++  T    F + + S       C  D L++ D+              N    +++ C    P   I S  N M L +S+  +   + + +     C       Q  I++            C+Y I    G + +L++  + I P    C Y  +     I + D N +  P Q  C    ++    H+  + +  + +   LK    +N    ++ D      SD           K+ Y+  +P +PS Y       ++ NAP GY
Sbjct:  877 CTNDFLKIHDGDGTLVQETCNPR---RPPNVLTVNNPAAVLTFHSDSAEQGKGFRIQYEM-----LCEKRVNGNGTIQTWNFP-NGGAAGTCTYIIEAPKTHVISVRFL---------TIGLRVLPMSECFYTPNAV-------ETYENYVEFSGGRTDNALFNRRYVCARYPFVEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGTISSPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKFEAVSRKTTCDFTLTAPSNNL--IFDPQQLKFDKCTYHIAVHENQRILIKM---NNMSLPCDKSSLMFR--NGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVY---KSINSEGSFFNLTYETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCA-KEMASEPITSDDNELIIKYVQSGGFQSKKIFGFSGHFTT---LCNGIVHEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHH-FSISQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIP-RVIRSRHNSMKLTYSSQGDPTNQFWLSWNTLGCSRDITAPQQLIITKENIDPEVDEFECQYKIQAPIGKQINLKIDKMDILPIGTNCTYTKDFSGFAIFMSDSNKSGTPFQTYCSSINQQNISSHTNELFLFLSMKKDKLKTNVFFNATVEFV-DVPQSSQSDICGQVINLERGKKNYI-TSPGYPSAYLPGIKCNFLINAPPGY 1730          

HSP 7 Score: 72.7886 bits (177), Expect = 7.137e-12
Identity = 197/953 (20.67%), Postives = 356/953 (37.36%), Query Frame = 2
Query: 8156 NGLREPVEDFGTGCNERNRMYS--------FSTLGKVVNFIFQPGR-EVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQ--TLHLEHHLDCNYDHLFI--RYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSK------NGFVIEYNFINPADTCNGII------FNTEGSIKSPNYPKPYPSNLRCNWTIH--VPEG-YKVSLTFKLPFD-----------------------LERTSLH--------------------TCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSI-TCEYLIPGWENH----------LQVVYIYPNFF---GCRYHDNQIQIDLEDQNGNYLPGQRICGK----SREKITIMHSKSIKI-VYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERS-YDGCNYDFVXXXXXXXXXXD-----AIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDL-----DNNGLYENNLL----CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDS--------ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLR--FMGELIAANETDHITITVKDLKIRSSVN-CSL---DQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQY-QVGPMENINSATDRRFQISYELYT-CNR-TEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSS 10648
            +G  +   +F T C + + +++         ++ G ++ F    G   +       + GY+ S+  G+++           P+ + D   CEW I AP   II++TI   ++H +    C+ + L I   YA  +D     + C  + + ++ +      + ++F S+   S        GFV++Y F  P   C   I      F+  G I+SPNY   YP N+ C W I+  +  G Y   +  KL FD                       L R  +                     TC  D L+I D +  TL+ E C    P N +  +     L F +D     +GF  QY+ +C    +   G I + N    N G+  TC Y+I   + H          L+V+ +   F+       ++N ++      +      + +C +        +++  ++ ++I V +  N   K  +   +        VFS       + +PN+P  Y  + +  +           +     D+E +    C YD V   T+  N +        FCG +   S +   TN + V F SD S                GP     G+ NA         + D       NN +++   L    C + IA         + EN  I ++  +    C    +   +GP    P   +L  + ++ +        I + SN + +++ +  N + S F LT+  + S       V   + ++ +P+YP     +L+  +   +   N+       + DL    S   C L   ++    D++L+    ++++C          S  +++II+Y Q G  +     + + F  S    T CN    +A SG I +   +  K YS N  C  T+  P  N R      +F++ + S
Sbjct:  588 DGPEDSSSEFATFCGDSHSVHAPLSDTPITMTSTGAMLRFRGTQGSFTIKWETVERKCGYRSSKPEGIIS----------VPQNHQDIV-CEWFISAPGGKIIEVTIPPVSMHSKDIEKCDQNSLEIYDGYAT-YDKHRILETCS-STLESQVVRTTGPFLTVAFISNMLQSDAGLETIRGFVLKYKFTTPDRECGAEIDNDSNDFSFSGVIESPNYGSLYPPNMDCTWKINGTLSNGSYSGDMVLKLTFDEYDVKSGFSANGPGMHYRSFRRLLPRNEVEYGIAPGFSRVFAYRNLFDMGTCTNDFLKIHDGDG-TLVQETCNPRRPPNVLTVNNPAAVLTFHSDSAEQGKGFRIQYEMLCEKRVN-GNGTIQTWNFP--NGGAAGTCTYIIEAPKTHVISVRFLTIGLRVLPMSECFYTPNAVETYENYVEFSGGRTDNALFNRRYVCARYPFVEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTG--TISSPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYST-TNTMAVVFVSDRS--------------VAGP-----GW-NAKFEAVSRKTTCDFTLTAPSNNLIFDPQQLKFDKCTYHIA---------VHENQRILIKMNNMSLPCDKSSLMFRNGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVYKS-INSEGSFFNLTYETITSG--CGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKYVQSGGFQ-----SKKIFGFSGHFTTLCNGIVHEAISGSIQS-PGYPYKVYS-NQFCTWTIKVPKGN-RIVATVHHFSISQKS 1480          

HSP 8 Score: 69.3218 bits (168), Expect = 8.518e-11
Identity = 102/457 (22.32%), Postives = 181/457 (39.61%), Query Frame = 2
Query: 9719 PGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIY----DGPDSARPV----IQTLCGDDQVDSITTQS--NVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNN--SPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQD-------ASLKHENKIEKFCESLST-ERV-FISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCN----RTEKAYSGRIVNVENFKQKKYSHNLICNLTLITP-APNLRYQFYFKYFNLE--RSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGV---ITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            P  +  CGG +  T         L    +  YE NL C+W I  P    +++ F+   + LE    V  C +D ++      D P+    V    +   C   + ++    S    +++ F TD +    GFKL +    +    I+    F   L SP Y  N  +P   +    LI  +    +++ + DL I+ +  CS +  +I          +    +K  K+C  L   ER+ F S+  ++ I+Y  GP    NS    +  I  +L  C       +     R++N   F Q +  +++ C   +  P    L   F  + F+++  + +    DYI+   G P     V+   CG+  P +  + ++ + M   T +      +  TY +       CGG + +   V   ITSP F   +    +C WN+K  +   I+ +   + L
Sbjct: 2201 PAKVYDCGGDLTPTYEWDYFTNPLPAGQSFGYEENLHCRWIIRRPMFTGIELKFD--YLELED---VQNCAFDFVSFRLQFDDQPEENDDVDLSSVSKHCALVRSNNTFNFSVNRALHIHFVTDRSRHGIGFKLKYRLTCNSFEHIRPGIFFEHTLTSPNYDGNFHTPSVWKCQYSLIIESNR-KVSVEIVDLDIQENSPCSYNNALILGNRFSELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIKYNSGP----NSRKGFKMIIKEQLTECPSGVLHVDDNSPSRVLNSPEFPQ-RIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDG-PTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATYGI-----ATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWL 2640          

HSP 9 Score: 69.3218 bits (168), Expect = 8.590e-11
Identity = 111/549 (20.22%), Postives = 215/549 (39.16%), Query Frame = 2
Query: 4136 YCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRI-----------SDRSNTLLKKSCGNQLLNRTFT-SSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVI--QSAQFPNSIANI------DCQWNFQTIPGFSVKLKFDIIEMESSINCS--EGPILRAWENEIVDENYVF----QACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKF--QGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKI----LDFETEESLCRY-DYVEIFS--PINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMES-NQFLLSPNYPHVYTLPDGICEWNLVA-NTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAI--------------FKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPG 5626
            +C W +     + I ++ D  +L  +QN   + FV              D   + + K C     N TF  S N  + I   TDRS H        GI  + + +    +F +         + G+    +   PN   N        CQ++        V ++   ++++ +  CS     IL    +E+V+ +  +    + C +++ G+ +   S+    ++K+ S  +   G +    +   E  +     + +    ++ SP +P   P+++ C + +       + L       D +  +  C   DY+EI     ++++++ +   CG  A    T FS+  N + +K  T     SR F A Y   TCGG  M  E+    + SP++P+ +  P   C+WN+ + NT  I  ++   ++ +     NPNC+ +  L I +G    + +   +C       + +     ++ ++ TS +                F  A  +    CGG      G  T P YP  +   + C++  +  PG
Sbjct: 2237 HCRWIIRRPMFTGIELKFDYLELEDVQNC-AFDFVSFRLQFDDQPEENDDVDLSSVSKHCALVRSNNTFNFSVNRALHIHFVTDRSRH--------GIGFKLKYRLTCNSFEH--------IRPGIFFEHTLTSPNYDGNFHTPSVWKCQYSLIIESNRKVSVEIVDLDIQENSPCSYNNALILGNRFSELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIKYNSGPNSRKGFKMIIKEQLTECPSGVLHVDDNSPSRVLNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGI--YCGNQAP--STIFST-TNFLYMKLHTSEYGKSRRFVATYGIATCGGTVMVRENVTTHITSPSFPYPFATPVQ-CQWNVKSPNTHMIEAKVDHVWLFY-----NPNCTMEQ-LMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGGRQYCSNKKCGFDVAVTMSGEKCGGRITNLIGTLTPPGYPGKLLSHVKCIWDFKMKPG 2756          

HSP 10 Score: 68.9366 bits (167), Expect = 1.016e-10
Identity = 135/603 (22.39%), Postives = 216/603 (35.82%), Query Frame = 2
Query: 4835 GIIQSPNY-----PNF-----YPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKM----ANFIQTGFSSLNNE---MLIKFRTDHTVSSRGFKAKYF-----ETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEG-------------IGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVG-SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSI--------DLSI--EEFSR-----------ENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINY---NTEFRSDYG---VLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-----NYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDEN---FK-----KIGD---CEYIIKATNQTQILTSP-----NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLE 6388
            G+I SPN      PNF     Y    +C W L+  E   + +KI++ +   +  C  D++ I      D+  +   C KM       ++  F  + +    + + + T+      G+K +Y      E CG     M     + +P +       D  C W++      +G  I   F  F+  +   NC+ D  L   E              +  +   +  LC     HP        +V L  T+ +      + V   + CG  + L+ G+ TSP+YPN    D+ C Y+I     +S+        DL+     F R           +     +LH F      P +     G    L  + + +Y +   D+ + R  S+G        F   Y IN    N E R   G    + SP F   Y +D +  W +  + + +L   F++  +    D   C+   +  +DS     N     FCG+  +D     P   ++ S      P  LI      + N   FK      +G    C   + AT   Q LTSP     NYP        C WTI       L I++   D E
Sbjct: 2998 GVISSPNTGDITSPNFGSGLKYLPGSKCRWVLEAPEGQIVKVKIVEMQIAYDHECENDHLIIGEGRQADVNTIHKYCHKMDGEQEQKLEDRFKIIKSHGRYLTLIWVTNMKYEEAGWKIQYEFLNENEECGYHTSGMSGT--IYTPMFGDKDYENDLECVWDIQV---PLGYHINLKFKDFDVETAE-NCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKETPLCGIE--HPKDFESESNRVRLNFTTDSQTTARGFRVNWEAECGAIYRLNHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFCASEPMPKDALVFKGAI-GLKFVSDKSYYWMEEDNKYGRKGSKG--------FQLAYSINKCGDNIELREGTGFITTVTSPAFPLPYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHD---CSADYIEFFDSSDIMANKTLGKFCGT--MDK---IPQYRIVTSG-----PNLLIHMRTDFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYP----PALLCGWTISGPVDSQLQIRIDGVDTE 3566          

HSP 11 Score: 62.7734 bits (151), Expect = 6.473e-9
Identity = 209/987 (21.18%), Postives = 362/987 (36.68%), Query Frame = 2
Query: 5237 ICEW--NLVANTSEIGLRIFFYFMGFEGGSNNPNCS-SDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYG-------VGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSR---------ENAI-------SYILHDFIDI-----------RNGPNET----SSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEK-------LQFTFDQFSVGRRLD-NG-----QCNRGNLIIYDSNYD-----AKVFCGSGVIDSAIFTPPVTLILSAEG---------YRYPGFLIRWNPPVDENFK-------KIGDCEYII---KATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLE--SSYEC--------KYENFTVEFTGSK--NPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILAMNINKTL--------CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSG--FQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDG----STTFTQKIGGQNFCG-KTN---SIFTIGNVLTILFKNMD-DFSYFRLKVKI--GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIR--LTFMDRDLDENCSKSNLTVIPVKESE--NAVIWSNCNSSTWDIYTEYSTVRIIFKTNTVTTR----KGFKLKYFFE-----DFMCGGEYSDP-ERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCF 7810
            IC++  N+ A  S + +    +    + GS   +C+ +D +LT+ +G  ++SS  A  C  S  H + +      + + ST     F+   G            CG      +G+ + P      + D+ C + I    G  I+++I   S          +N++       +Y  H  ++              GP  T    S++L     L  IR +   YKF        R  G +  N            + +F S  GV+ SP +G +Y  + + TW +    S         L+ TFD++ V      NG     +  R  L   +  Y      ++VF    + D    T     I   +G          R P  L   NP     F        K    +Y +   K  N    + + N+PN       CT+ I   +T  + ++ L+  L      EC         YEN+ VEF+G +  N +F+   YV    C      E           ++I   +D    F G  L YK +   C   F + + G++ +  YP K   + +C + L   +   + L     DL       C    ++I     N+T+        CG+ IPP +    TN+  ++      F S+   +G  +   +     +      LT   ++ I D    +      F +C +H       R+ I    + +    C++S L F +G    S  F+        C  K N    I +  N +TI++K+++ + S+F L  +     CGG +    G +++P YPL       C W ++    + +R  LT +D DL+ + S     +      +  ++ +  N +   +    E ++  I    N +  +     GF+ K  F        +C G   +     + S  YP  +     CTW I V    RI+  V    ++Q  +
Sbjct:  543 ICDFVFNIPAANSAVVMTFTEFDKFTQEGSGPTDCAKTDANLTLYDGPEDSSSEFATFCGDS--HSVHAPLSDTPITMTSTGAMLRFRGTQGSFTIKWETVERKCGYRSSKPEGIISVP----QNHQDIVCEWFISAPGGKIIEVTIPPVSMHSKDIEKCDQNSLEIYDGYATYDKHRILETCSSTLESQVVRTTGPFLTVAFISNMLQSDAGLETIRGFVLKYKFTTPD----RECGAEIDND-----------SNDF-SFSGVIESPNYGSLYPPNMDCTWKINGTLSNGSYSGDMVLKLTFDEYDVKSGFSANGPGMHYRSFRRLLPRNEVEYGIAPGFSRVFAYRNLFDMGTCTNDFLKIHDGDGTLVQETCNPRRPPNVLTVNNPAAVLTFHSDSAEQGKGFRIQYEMLCEKRVNGNGTIQTWNFPNGGAAGT-CTYIIEAPKTHVISVRFLTIGLRVLPMSECFYTPNAVETYENY-VEFSGGRTDNALFNR-RYV----CARYPFVEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSS-MTGTISSPNYPEKYQPHMHCVYNLYVSWSKTVKLTFDVFDLEVTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYST-TNTMAVV------FVSDRSVAGPGWNAKFEAVSRKTTCDFTLTAPSNNLIFDPQQLK------FDKCTYHIAVHENQRILIKMNNMSLP---CDKSSLMFRNGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVYKSINSEGSFFNLTYETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALD-DLNSSDSGGFCPLFAANRIDFFDSALQGNQHLKRY-CAKEMASEPITSDDNELIIKYVQSGGFQSKKIFGFSGHFTTLCNGIVHEAISGSIQSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHHFSISQKSY 1481          

HSP 12 Score: 59.6918 bits (143), Expect = 5.525e-8
Identity = 146/718 (20.33%), Postives = 267/718 (37.19%), Query Frame = 2
Query: 2630 FQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRK--IAISFLDFDIN------DDSECKFDFIKISGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTF------------AGTGFRAKVSVFDCG-------GSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL-----IHDNQT-KRFCGNHAK--------SGPTVTHKLVIRFVSDNSVSGEGF-IMRFYTVKRDQYCYESFESSSGL--ITNPTLEK--LSNSFTCFYSIKVPQFKKILINITVSESD------GSCFAIPCLGQATLKXXXXXXXXXXXXNVCPT-CPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAP----------ANTYCRWEIRSTPGKRILIKINHI----RSGSV--------DETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIF-------QNLASTKYRFRLYYTQDCEFPI---TSSSGRIESKNEMLRYC--SWKLSSLRGS--KILIQIDKFDL--PPLQNGQC---YSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPN 4501
            F+++ E  CG    ++        S  YP  Y  +  C Y      +   IAI F DFD+         + C+ D+++I  + +  +   +C    +E +  ++      I + F S+ ++               GF+   S+  CG       G+ F+T      +P              Y ++  C W ITT  +  +   F++  LE+  +C+ DY+E      I  N+T  +FCG   K        SGP     L+I   +D +V+  GF +    ++ + + C     +++    +T+P  E      +  C ++I  P   ++ I I   +++      G   +  C+    +             ++C +  P  + + TS   A IT+   +      FN  I+YS +D +CG   L     I +  Y               ++  CR+ I+    + +++         ++G          D   L   K+P       +++I  +C   +   HV    ++ +I        +N +    +F       C   I   T  SGR+ S N    Y   S  +++L+ S  K+L+  + F L  P   N  C   Y  ++  D + T     CG+ L     TS      +        H+    ++  +V E   Q      + D +E +     GVI S  +PN
Sbjct: 3247 FRVNWEAECGAIYRLNHGV---ITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIIDTGTDRVLHTFC---ASEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSKGFQLAYSINKCGDNIELREGTGFITTVTSPAFP------------LPYTKDLDCVWNITTDPNRQLNIRFEEMKLEAFHDCSADYIEFFDSSDIMANKTLGKFCGTMDKIPQYRIVTSGP----NLLIHMRTDFNVNSGGFKLAVISSLGQKEGCGGKLTATTSWQTLTSPKDEDGNYPPALLCGWTISGPVDSQLQIRIDGVDTEQLEYPPGDRPSPECIDALAIYDGQEFFSPLLAGDICTSGTPLPKILYTSHRHAFITFETDRDGTGRGFN--ISYSIVDSDCGG-WLKATNEIKTLVYKGITSDDNKEMNKERSHQRCRFMIQGPKTEPVIVNFQQFNIPSKAGDCSDSFVEIRDVGSLQECKHPACAREPNQRKITKLCGTHVPTSHVSNTNTIQIIVSADIMPNKNQSRPSLKFEYNILDSCNRTIDTNTIKSGRLTSPNYPQVYSENSTCVTNLQSSNQKMLLVFNDFTLEEPNNVNKNCDYDYLMLKEGDSNGTYY---CGSTLPKALMTSGKDLTALLKSDHSLNHAGYDASYYTVVSERDDQ----IQFADSYELE-----GVISSIGYPN 3927          

HSP 13 Score: 59.6918 bits (143), Expect = 6.812e-8
Identity = 46/212 (21.70%), Postives = 90/212 (42.45%), Query Frame = 2
Query: 8225 STLGKVVNFIFQPGREVNMSNY----RVEIGYKFSRCGG--LLTESFG-YIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFV--------IEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEG--YKVSLTF 8809
            ST+    NF++    +++ S Y    R    Y  + CGG  ++ E+   +I SP +P  +     C+W + +P   +I+  +  + L ++ +C  + L IR      +P    +C      +       N++ + F S+ + ++ G           +       + C G I N  G++  P YP    S+++C W   +  G  Y+  +TF
Sbjct: 2557 STIFSTTNFLYM---KLHTSEYGKSRRFVATYGIATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWLFYNPNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGGRQYCSNKKCGFDVAVTMSGEKCGGRITNLIGTLTPPGYPGKLLSHVKCIWDFKMKPGFIYRFKITF 2765          

HSP 14 Score: 58.9214 bits (141), Expect = 1.136e-7
Identity = 112/529 (21.17%), Postives = 198/529 (37.43%), Query Frame = 2
Query: 8741 YPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYD--SLRII--------DSNAVTLLSELCGNIPPSNPINSSLNQ-MSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGS-------ITCEYLIPGWENHLQVVYIY----PNFFGCRYHDNQIQ----IDLEDQNGNYLPGQRICGK--SREKITIMHSKS-IKIVYTARNFHLKNYNFRARYLHDE---NVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGY--IFSINLRSVDIERSYDGCN-YDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG--YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQ--SNVMYLIFSTDFNI----------QKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYP 10174
            Y  NL C W I  P    + L F     LE   +  C +D  S R+         D   ++ +S+ C  +  +N  N S+N+ + + F TD + +  GF  +Y+  C     +R G      +   NY           C+Y +    N    V I          C Y++  I      +L + +  Y    + CGK    E++    ++  + I Y +     K +    +    E    V    D     VL +P FP    ++    ++  AP G+  + + +  + DI+ +   C+  D++      +  S+   I+CGN    + F   TN L ++  +  S Y     FVA        +  CGG   +   V T+    S        +   + C+W + +P  H ++   ++  +          C  + + I DG  +A P+I  +C       + T+  SN + + F+++             +K GF +  T   S       +TN    L  P YP
Sbjct: 2232 YEENLHCRWIIRRPMFTGIELKFDY---LELEDVQNCAFDFVSFRLQFDDQPEENDDVDLSSVSKHCALVRSNNTFNFSVNRALHIHFVTDRSRHGIGFKLKYRLTCNSFEHIRPGIFFEHTLTSPNYDGNFHTPSVWKCQYSLIIESNRKVSVEIVDLDIQENSPCSYNNALILGNRFSELVETHSQYSKSSKYCGKLEQGERLNFTSARGRLFIKYNSGPNSRKGFKMIIKEQLTECPSGVLHVDDNSPSRVLNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFST-TNFLYMKLHT--SEYGKSRRFVATYG-----IATCGGTVMVRENVTTHITSPSFPYP----FATPVQCQWNVKSPNTHMIEAKVDHVWLFYNPN-----CTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGGRQYCSNKKCGFDVAVTM--SGEKCGGRITNLIGTLTPPGYP 2738          

HSP 15 Score: 58.151 bits (139), Expect = 1.655e-7
Identity = 66/303 (21.78%), Postives = 125/303 (41.25%), Query Frame = 2
Query: 6929 GFQIMYSKKDEEC-GGRHELTRYQDSRIVDMNSNRL-HMTPHFIECKWHFTSPPGTRMQIDFE----ELVISRIICNE-SFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMD--DFSYFRLKVKIGSCGGLLHRRQG---YIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDL--DENCSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYST--VRIIFKTNTVTTRKG----------FKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            GF+++  ++  EC  G   +     SR+  +NS       P+ +EC++   +P G R+ + F+    ++  ++  C+   ++   DG T  ++ IG   +CG    ++IF+  N L +     +      F     I +CGG +  R+    +I SP++P  +     C W +   +   I        L  + NC+   L +     + N +I   C      D++T  ++  + + F +N+ TTR G          F +        CGG  ++    L    YP  L   ++C W   +
Sbjct: 2455 GFKMIIKEQLTECPSGVLHVDDNSPSRV--LNSPEFPQRIPNSVECEYVMAAPNGHRLMLTFDSENFDIDGNQKNCDLLDYIEIRDGPTVHSEVIG--IYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATYGIATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWNVKSPNTHMIEAKVDHVWLFYNPNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQFTSNSTTTRGGRQYCSNKKCGFDVAVTMSGEKCGGRITNLIGTLTPPGYPGKLLSHVKCIWDFKM 2753          

HSP 16 Score: 58.151 bits (139), Expect = 1.741e-7
Identity = 76/314 (24.20%), Postives = 129/314 (41.08%), Query Frame = 2
Query: 4511 NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIV------DENYVFQACNR------IDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMS-IHLKILDFETE-------ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTV------------SSRGFKAKY-FETCGGLRMAMESNQFL---LSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSD 5344
            +++C W+ Q   G+ + LKF   ++E++ NC++  +L + E+         D  ++FQ   +      I+  K    +S ++   L F    D     R F+  +E     C      + G+I SP YPN YP+++ C++ +   +  S I +K  DF+          + C  DY++I      D V L   C   +  +          + +KF +D +              S+GF+  Y    CG      E   F+    SP +P  YT  D  C WN+  + +   L I F  M  E      +CS+D
Sbjct: 3151 DLECVWDIQVPLGYHINLKFKDFDVETAENCAKDQLLISQEHSTRANSPNGDYYFLFQDEEKETPLCGIEHPKD--FESESNRVRLNF--TTDSQTTARGFRVNWE---AECGAIYRLNHGVITSPYYPNGYPNDITCTYLIAPPDQNSVIAIKFADFDLATMRTSFGRAPCEDDYLQIID-TGTDRV-LHTFCA--SEPMPKDALVFKGAIGLKFVSDKSYYWMEEDNKYGRKGSKGFQLAYSINKCGDNIELREGTGFITTVTSPAFPLPYT-KDLDCVWNITTDPNR-QLNIRFEEMKLEAFH---DCSAD 3448          

HSP 17 Score: 58.151 bits (139), Expect = 1.770e-7
Identity = 46/202 (22.77%), Postives = 93/202 (46.04%), Query Frame = 2
Query: 9818 NNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCR-YDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPR--YPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFI-SSHDKVIIQY 10411
            N++ C++ +AAP GH + + F++ +  ++G  +   C   D+I I DGP     VI   CG+    +I + +N +Y+   T    +   F  T+  + +    +    N +  + SP   YP  +P   ++    + +  T  I   V  + +  + NC+++Q +I+D +      I   C       VF  S+ +++ +Q+
Sbjct: 2494 NSVECEYVMAAPNGHRLMLTFDSENFDIDGNQK--NCDLLDYIEIRDGPTVHSEVIGIYCGNQAPSTIFSTTNFLYMKLHTSEYGKSRRFVATY-GIATCGGTVMVRENVTTHITSPSFPYPFATPVQCQWN---VKSPNTHMIEAKVDHVWLFYNPNCTMEQLMIRDGNSTANPLIGPVCVPRHAPDVFTRSASNQITVQF 2689          

HSP 18 Score: 56.9954 bits (136), Expect = 4.195e-7
Identity = 171/736 (23.23%), Postives = 284/736 (38.59%), Query Frame = 2
Query: 4730 LKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKES-------MSIHLKILD----FETEESLCRYD-YVEIFSP-INNDLVKLQHLCGKMANFIQTGFSSLN--NEMLIKFRTDHTVSSRGFKAKYFET---CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVL----CTKSPYHPIISNGHYLKVIL---KSTSG---NAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNY-----KFNDSVWIRLRS--QGGDFTNHIKFLAKYHINYNTEFRSD--YGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNG------QCNRGNLIIYDS----NYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDL------ESSYECKYENFTVEFT--GSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKK-ACYKDFRNP--LEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPP 6760
            L F S +   G  + F+  YE     CE  ++G+ G IQ+ N+PN       C++ ++  ++       ++I L++L     F T  ++  Y+ YVE      +N L   +++C +   F++  + S++    + IK  +D     +G   +Y  +   CGG+  +M     + SPNYP  Y  P   C +NL  + S+  +++ F     E     P  S +     I    +N +V   L    C       I S  + + V+    +S +G   NA F+A      +TC  DF L        F P  +  D  C Y I       I + +   S     S ++      RNGP+ETS         SEI     NY      F++ V I  +S    G F N    L    I      R D   G++++PQ+     ++ +  WTV      K++F           D+G        NR  +  +DS    N   K +C   +    I +    LI+     +  GF  +       +F  +  C  I+       I  SP YP    + +FCTWTI   +   +   +  F +      E    C  +   V+ T        F   +Y          +           NS+K+TY + + DP   F LS+    C +D   P  L  + +N++     FE   C + +++     I L +  +D+ P
Sbjct:  914 LTFHSDSAEQG--KGFRIQYEML---CEKRVNGN-GTIQTWNFPNGGAAGT-CTYIIEAPKTHVISVRFLTIGLRVLPMSECFYTPNAVETYENYVEFSGGRTDNALFNRRYVCARYP-FVEGAWMSVSAARRLQIKVGSDGNPMFKGLSLEYKTSDVGCGGVFSSMTGT--ISSPNYPEKYQ-PHMHCVYNLYVSWSKT-VKLTFDVFDLE---VTPAKSCEYDRVEIYTSYHNETVHGELLGKFCGAMIPPSIYSTTNTMAVVFVSDRSVAGPGWNAKFEAV--SRKTTC--DFTLTAPSNNLIFDPQQLKFD-KCTYHIAVHENQRILIKMNNMSLPCDKSSLM-----FRNGPSETSPPFSSLPPESEICTPKVNYMPVIRSFSNRVTIVYKSINSEGSFFN----LTYETITSGCGGRVDGLTGIVSAPQYPLGDKKNLKCDWTVAVALGNKVRFALTALDDLNSSDSGGFCPLFAANR--IDFFDSALQGNQHLKRYCAKEMASEPITSDDNELIIKY--VQSGGFQSKKIFGFSGHFTTL--CNGIVHEAISGSI-QSPGYPYKVYSNQFCTWTIKVPKGNRIVATVHHFSISQKSYFEGGINCITDMLKVDDTDLAEAEVTFKKTDYNITNSVNKYCDKAIPRVIRSRHNSMKLTYSS-QGDPTNQFWLSWNTLGCSRDITAPQQLIITKENIDPEVDEFE---CQYKIQAPIGKQINLKIDKMDILP 1609          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Celegans
Match: nas-39 (Zinc metalloproteinase nas-39 [Source:UniProtKB/Swiss-Prot;Acc:Q20176])

HSP 1 Score: 119.013 bits (297), Expect = 3.419e-26
Identity = 133/433 (30.72%), Postives = 186/433 (42.96%), Query Frame = 2
Query: 8315 SRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLE-HHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFH--RNRMRLSFHSDFSVSKNGFVIEYNFINPADTCN-----------------------GIIFNTE-----------------GSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSN--AVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG--VYDLRQGEIVS-ANVALINYG-SITCEYLI----PGWENHLQV-VYIYPNFFGCRYHDNQIQI-DLEDQNGNYLPGQRICGK-SREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP--SPYH 9439
            S CGG L  S G I SP +PE YP++  C W I AP+   I L     ++E    +C YD++ I  +E        KLCG     +E L F   RNR+R+ F SD SV ++GF    NFI   D C                        G I   +                 G I SPNYP  YP    C+W      G+++ LTF   F +E  +   C YD++ + D    +  L    CG  PP   ++SS N++ L FS+D + +  GF A Y S+CGG    +   G I S A  +   YG +  C +++    PG    +Q   +   +  GC+Y  + I+I D  +     L G R CG  S E IT    + + I++T      K   F A Y         S  KR +V KT + P   P H
Sbjct:  540 STCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKIGDSE--------KLCGE---YHEALLFTTPRNRVRIEFSSDSSVERDGFFA--NFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFS-SFQVEEHA--QCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSS-NELYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEGCQY--DYIEIYDGPEATLERLVG-RFCGDTSPEVITSTGPELLLIMHTDNAEEEK--GFVAEY---REAPRSSSTKRTFVSKTRHSPLEEPIH 947          

HSP 2 Score: 118.242 bits (295), Expect = 6.807e-26
Identity = 133/561 (23.71%), Postives = 216/561 (38.50%), Query Frame = 2
Query: 8312 FSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRK-----LCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEY-------------------------------------NFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY--------------KSICGG-----VYDLRQGEIVSANVALINYGSITCEYLIPGWE-NHLQVVYIYPNFFGCRYH------------DNQIQIDLEDQ------------NGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPV-GYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI---FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTP 9721
            ++ CGG +  + G I SP YPE YP N+DC+W I   EN  + +     HLE H +C YD L +      +S    K      CGL  I  +T+    N++ L F SD SV K GF + +                                     N  +   TC G +  + GSI SPN+P+ YP++  C W I  P+GY + L F   F++E      C YD ++I DS       +LCG    +    +  N++ + FS+D +   +GF A +              +  C       V     G I++ +      GS   E   P  + N       YP    C +H             +  Q++   Q            +G+       CG +   + +  S  + + +++ +  +    F+A Y      ++ ++    ++     F  S Y  N + +WI  A   G    I   + +IE S +GC YD++        + + +   FCG   + SP +I +    +       + E   GFVA     P
Sbjct:  379 YAICGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGL--IEKKTIVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNF-TKFNVEGMKTE-CAYDYVKIGDSE------KLCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSNELYLTFSS-DASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIE-SEEGCQYDYIEIYDGPEATLERLVGRFCG---DTSPEVITSTGPELLLIMHTDNAEEEKGFVAEYREAP 924          

HSP 3 Score: 91.2781 bits (225), Expect = 1.082e-17
Identity = 139/596 (23.32%), Postives = 223/596 (37.42%), Query Frame = 2
Query: 4265 LLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSI-----------IIQSSTHNFYLKFFS--------------------ANDPN----------GGMR---KFQGTYEFTNYSCEHEMSG----SEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE--ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY---FETCGGLRMAMESN--------------QFLL------------------------SPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPII---SNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDG---LFTSPFYPNS-VNMDLDCVYVIR-NSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNET-SSLLGRF 5746
            +L + CG   L RT  SS   + I+          V  +     L + T       YY           GVI S ++P S   N DCQW         V ++F    +E    C        ++  I+ E     + N   DGK +            I S T+   L+FFS                    A D N          GG +   +   +     +SC+    G    S G I SPN+P  YP++  C W ++  +   I L    F  E  ++ C YDYV+I           + LCG+    +   F++  N + I+F +D +V   GF A +   F+ C       E                 ++L                        SPNYP+ Y  P G  C W+ V      G R+   F  F+    +  C  D ++++ +G   ++ +  V C  +P  P++   SN  YL     ++     F+A Y   +S CGG    +     +++   + +S    + DC +++R  SPG  + +    F+ E+      +D+I+I +GP  T   L+GRF
Sbjct:  339 ILDRICGGDSLFRTIASSGNRMLIQ----------VRSSTPAASLPFAT-------YYAICGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQHKEC-------IYDRLILTEGI---SKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKIGDS--------EKLCGEYHEALL--FTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDY--PKGQNCSWHFVTTP---GHRLMLTFSSFQ-VEEHAQCKYD-AVSVYDGGDGSAQLAGVFCGLAP-PPLLLSSSNELYLTFSSDASVSRRGFQAHY---TSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEG-CQYDYIEIYDGPEATLERLVGRF 885          

HSP 4 Score: 89.7373 bits (221), Expect = 3.854e-17
Identity = 88/403 (21.84%), Postives = 152/403 (37.72%), Query Frame = 2
Query: 9737 CGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGD-DQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA--------------------------------VPSQNHLIKTVTNFSQL------LESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNR-TEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITY 10825
            CGGY+ A+ G+   I S +     +Y N+  C W+I AP G+ + + F     ++EG      C YD++ I D         + LCG+  +    TT  N + + FS+D ++++ GF   F A                                +    H  K  + F ++      + SP YPN+ P         +       + +T    ++     C  D   + D           FC  L+   + +SS +++ + +         S + R FQ  Y      R T ++  G I +   F   KY  N  C+  +   +P    +  F  FN+E    C YDYI+   G     + ++ + CG + P    +    + +I  TD +    G+   Y
Sbjct:  542 CGGYLKASNGS---ISSPNFPE--MYPNSKTCIWEIEAPDGYHIFLNF--TKFNVEGMKTE--CAYDYVKIGDS--------EKLCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSWHFVTT-PGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFC-GLAPPPLLLSSSNELYLTFSSDA-----SVSRRGFQAHYTSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPELLLIMHTDNAEEEKGFVAEY 920          

HSP 5 Score: 81.2629 bits (199), Expect = 1.176e-14
Identity = 74/264 (28.03%), Postives = 114/264 (43.18%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPY-GHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSA-RPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQL--LESPRYPNN 10180
            + +PN+P+ Y    N +W F    G+   +   S  +E  +  C YD VS       S+    +FCG L      +  +N L + F SD S   +  GF A           CGG + A   T G I S    ++  Y  N  C W + A   G  V++ F   +I  E      GC+YD+I IYDGP++    ++   CGD   + IT+    + LI  TD   ++ GF   +   P  +   +T  + ++   LE P +  N
Sbjct:  703 INSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEE-HAQCKYDAVSVYDGGDGSAQLAGVFCG-LAPPPLLLSSSNELYLTFSSDAS--VSRRGFQAHYTSL------CGGRLTAE-STPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESE-----EGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPELLLIMHTDNAEEEKGFVAEYREAPRSSSTKRTFVSKTRHSPLEEPIHDRN 950          

HSP 6 Score: 80.8777 bits (198), Expect = 1.692e-14
Identity = 119/564 (21.10%), Postives = 196/564 (34.75%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINH--------------IRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSV------------------------HVIFQNLASTKYRFRLYYT---------QDCEFPITSSSGRIESKN--EML---RYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTH-------------------------------SNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVK---ESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKL-QHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            CG    +  G I SP YP   P N+ C+W I      ++ I+  +              I +  + +    + K     F    ++  IV       +  F + SV                        H     +   K   R+ Y+           C   + +S+G I S N  EM    + C W++ +  G  I +   KF++  ++    Y +V+I D      +K CG       FT+    +RIE  +D S                                 S V   + G +L      C E   +     + +   G I S  +PN      +C W+F T PG  + L F   ++E    C    +   ++            C         ++ SS++  YL F  ++D +   R FQ  Y      C   ++         ++  F    Y  N  CSW ++ K     + I     + E+EE  C+YDY+EI+      L +L    CG  +  + T   S   E+L+   TD+    +GF A+Y E 
Sbjct:  382 CGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKIGDS-----EKLCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCF----FEVNAPAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEEHAQCKYDAV-SVYDGGDGSAQLAGVFCGL---APPPLLLSSSNELYLTF--SSDASVSRRGFQAHY---TSLCGGRLTAESTPGHIYSHATFSDSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEG-CQYDYIEIYDGPEATLERLVGRFCGDTSPEVIT---STGPELLLIMHTDNAEEEKGFVAEYREA 923          

HSP 7 Score: 79.7221 bits (195), Expect = 4.148e-14
Identity = 61/247 (24.70%), Postives = 115/247 (46.56%), Query Frame = 2
Query: 2693 EFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEI-TTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSGPTVTH-KLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSS 3400
            +  S NYP +Y    +C + F      ++ ++F  F + + ++CK+D + +   G  S  L   +C      L+  +SN+    + +TF S+++ +  GF+A  +   CGG   LT +   G+  SH   S    +++Y +N+ C+W +        +   F  F++ES   C YDY+E+    +        RFCG+ +    T T  +L++   +DN+   +GF+  +    R      +F S +
Sbjct:  702 DINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTFSSFQVEEHAQCKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSNE----LYLTFSSDASVSRRGFQAHYTSL-CGGR--LTAESTPGHIYSHATFS----DSKYGKNQDCSWIVRAKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPELLLIMHTDNAEEEKGFVAEYREAPRSSSTKRTFVSKT 937          

HSP 8 Score: 76.2554 bits (186), Expect = 4.244e-13
Identity = 86/394 (21.83%), Postives = 144/394 (36.55%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYEN--HTGFVAFINPTPGPMLGCGGYMNATVGTY------GVIKSLDLDN----NGLYENNLL------------------CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF--------TAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDA-SLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY 10471
            + +PNFP  Y ++    W   AP GY   +N    ++E     C YD+V    +         CG       F    N + + F SD S   +     F+A  +       GC       +G+Y      G I + D  N    +  +E N                    C W      GH + + F  +S  +E  ++   C+YD +++YDG D +  +    CG      + + SN +YL FS+D ++ + GF+  +        TA  +  H+    T         +Y  N   D  ++  + A +    + I      I S   C  D   I D      E  + +FC   S E +  +  + ++I      M   N+  ++ F   Y
Sbjct:  553 ISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEGMKTECAYDYVKIGDSEK------LCGEYHEALLFTTPRNRVRIEFSSDSSVERDGFFANFIADFDECQNDNAGCEHTCQNRLGSYVCTCNPGYILAEDKHNCKEGSCFFEVNAPAGDINSPNYPNDYPKGQNCSWHFVTTPGHRLMLTF--SSFQVEEHAQ---CKYDAVSVYDGGDGSAQLAGVFCGLAPPPLLLSSSNELYLTFSSDASVSRRGFQAHYTSLCGGRLTAESTPGHIYSHAT-----FSDSKYGKNQ--DCSWI--VRAKSPGRGVRIQFSTFNIESEEGCQYDYIEIYDGPEATLERLVGRFCGDTSPEVITSTGPELLLI------MHTDNAEEEKGFVAEY 920          

HSP 9 Score: 70.0922 bits (170), Expect = 3.713e-11
Identity = 79/297 (26.60%), Postives = 115/297 (38.72%), Query Frame = 2
Query: 8282 SNYRVEIG----------------YKFSRCGGLLTESFG--YIKSPGYPEKYPDNTDCEWLIIAPEN---------------MIIQLTIQTLH-----------LEHHLDCNYDHLFIRYAEEF-DSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS-------NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY 9016
            S +R+EIG                YK + CGG L +  G   I+  G          C W II+P+                MII LT + L             ++    ++    I Y   F       ++CG + +   T++   NRM +   S    +   F   Y        C G I+  EG I SP YP+ YP N  C WTIHV E  +V++ F + F LE+     C YD L + +        +   +    CG I     I S  NQ+SL F +D +    GF  ++
Sbjct:  220 SGFRLEIGQRVQLSEGDIRQTKKLYKCAECGGTLMQESGNLAIQHAGV---------CTWHIISPQGHTIFLNITGGLKLIIMIIFLTDEKLEDLTEIFKPNILKKNQTYLHWKTFLIYYTNSFFHFEILDRICGGDSLF-RTIASSGNRMLIQVRSSTPAASLPFATYYAI------CGGPIYANEGVIHSPKYPESYPPNSDCQWTIHVDENSQVAIEF-VYFHLEQHK--ECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKT-IVSKTNQISLRFFSDNSVQKTGFELRF 496          

HSP 10 Score: 60.077 bits (144), Expect = 3.537e-8
Identity = 70/267 (26.22%), Postives = 102/267 (38.20%), Query Frame = 2
Query: 2873 RYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIG--YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYL---ELIHDNQTK-------RFCGN-HAKSGPTVTHKLVIRFVSDNSVSGEGFIMRF----------------YTVKR---------------------DQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDG 3520
            R C G+       +S +   +++I  +S++  A   F    ++  CGG  +    +I    YPES            Y  N  C W I    ++ +   F  FHLE H  C YD L   E I  N  K        FCG    K+  + T+++ +RF SDNSV   GF +RF                Y V                       D  C    ++S+G I++P   E   NS TC + I+ P    I +N T    +G
Sbjct:  342 RICGGDSLFRTIASSGN---RMLIQVRSSTPAASLPFATYYAI--CGGPIYANEGVIHSPKYPES------------YPPNSDCQWTIHVDENSQVAIEFVYFHLEQHKECIYDRLILTEGISKNSKKDGKEMSETFCGLIEKKTIVSKTNQISLRFFSDNSVQKTGFELRFTKELNECATDKNICHHYCVNTVGGFKCACRVGYSLSSNGFSCDSTCGGYLKASNGSISSPNFPEMYPNSKTCIWEIEAPDGYHIFLNFTKFNVEG 591          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Celegans
Match: lin-12 (pep chromosome:WBcel235:III:9060096:9071760:-1 gene:WBGene00003001.1 transcript:R107.8.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:lin-12)

HSP 1 Score: 108.227 bits (269), Expect = 9.053e-23
Identity = 123/414 (29.71%), Postives = 166/414 (40.10%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----------------NGFTCLDIN------ECANAYTCGPNE-ECVNGFGTYQC--------------KCVQGMK-------------------RRANNMCQL-ENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGT 1552
            D CA+NPC +G  CI     F+CIC   + G +C E  + C+      + C+ G++C N + S+ C C  + +G  C      CS  +  DIC HGTC    SP + K F+C C+ G+        C  D +EC + +  C  +    CVN PG  RC DC  GF G                N  TC+  +      +C N +     E EC  GFG  +C              KC  G K                    R N    L EN+C ++   C  NA C   +  I G  C C  G+ GD             +  R    C+    C NGG C +    F+C C PGF G  C      +CL + C NGG C        +C C   FSG  CE +  + G T
Sbjct:  252 DSCASNPCSHGV-CISFSGGFQCICDDGYSGSYCQEGKDNCVN-----NKCEAGSKCINGVNSYFCDCPPERTGPYCEK--MDCS--AIPDICNHGTCI--DSPLSEKAFECQCEPGYE----GILCEQDKNEC-LSENMCLNNG--TCVNLPGSFRC-DCARGFGGKWCDEPLNMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKECPIGFGGVRCDLRLEIGICSRQGGKCFNGGKCLSGFCVCPPDFTGNQCEVNRKNGKSSLSENLCLSDP--CMNNATCIDVDAHI-GYACICKQGFEGD-------------ICERHKDLCLENP-CSNGGVCHQHRESFSCDCPPGFYGNGCEQEKMFRCLKSTCQNGGVCINEEEKGRKCECSYGFSGARCEEKINLTGFT 628          

HSP 2 Score: 93.2041 bits (230), Expect = 3.435e-18
Identity = 103/367 (28.07%), Postives = 144/367 (39.24%), Query Frame = 2
Query:  488 CANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTC-------------IADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQ------LENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            C  + C NG QCI   N  KC CP  FKG+ C  DVNEC +     + C N + C NT+G++ CVC   +    C  P N+ +      +     C+ + S  +P      C +G   D  +  C             +   D C     PCS      C++  G  +C  C  G+ G+ +     + C N   C    +C+NG  +Y C C      R    C+      + ++C  N+G C  ++  S   F      C C PGY G         I+     N     C+   +C N GTC      F C C  GFGG  C   + N C    C N G C     +   C C+  F G  CE E
Sbjct:  118 CYPSVCMNGGQCIGAGNRAKCACPDGFKGERCELDVNECEE---NKNACGNRSTCMNTLGTYICVCPQGFLPPDCLKPGNTSTVEFKQPV-----CFLEISADHPDGRSMYCQNGGFCDKASSKCQCPPGYHGSTCELLEKEDSC--ASNPCS---HGVCISFSGGFQC-ICDDGYSGS-YCQEGKDNCVNN-KCEAGSKCINGVNSYFCDCP---PERTGPYCEKMDCSAIPDIC--NHGTC-IDSPLSEKAFE-----CQCEPGYEG---------ILCEQDKN----ECLSENMCLNNGTCVNLPGSFRCDCARGFGGKWCDEPL-NMCQDFHCENDGTCMHTSDHSPVCQCKNGFIGKRCEKE 443          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Celegans
Match: clec-78 (C-type LECtin [Source:UniProtKB/TrEMBL;Acc:Q20531])

HSP 1 Score: 107.457 bits (267), Expect = 2.155e-22
Identity = 110/384 (28.65%), Postives = 158/384 (41.15%), Query Frame = 2
Query:  494 NNPCHNGAQCI-DGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTN-------AAC--SANNFRIEGRICTCNPGYSG-------DGVGENGCVIVSTNVTNRAYRRCV-----------------RRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVC 1543
            NNPC NGA+CI +    FKC C   ++G +C +++++C         C   A C + I  ++C C   +SG  C+I  N C+++     C HG C            +CLC  GW+     + C  +IDEC     PC       C++      CE C  G+EG     L ++ CA    C  N  C N   TY C C  G              CE N   C+ N        +C  + N+F+     C C PGY+G       D   ++ C+  +  V      +CV                   + CRN G C   +  + C C PG  G  C +   N+C+  PC NGG C   F +H  C C   F+G  CE ++  C
Sbjct: 2136 NNPCRNGARCIGEKLGRFKCQCVPGWEGPNCDKNIDDCAD-----SPCALNATCVDLINDYKCECPTGFSGKRCHIKENLCASSP----CVHGLCIDKLYSR-----QCLCQPGWT----GENCDQNIDECAAS--PCQND--AKCIDEINGYMCE-CADGYEGVHCQHL-VDHCAKQ-PCHNNATCTNMGATYHCDCTLGFDGVH---------CEMNIDECAENQCDKLGTESCRDAVNDFK-----CVCKPGYTGPRCDVKQDQCADSPCLNDAQCVDMGGAYKCVCKSGWTGPKCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESA-PNRCIGQPCHNGGECG-DFGSHLECACPASFTGKGCEFKNTGC 2478          

HSP 2 Score: 92.4337 bits (228), Expect = 8.521e-18
Identity = 107/401 (26.68%), Postives = 162/401 (40.40%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIG--SFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGT-CYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----------------NGFTCLD---------------------INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQ-LENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGG 1549
            ++  D C+  PC+NG +C     ++KC CP+ F G  C  + +EC  +      C NG  C +  G  S  C+C   ++G  C    + CS     + C +G  C  +        FKC C  GW        C  +ID+C     PC+++    CV+   D +CE CP GF G                +G  C+D                     I+ECA A  C  + +C++    Y C+C  G +      CQ L + C      C  NA C+          C C  G+ G        V    N+   A  +C +        +C+ ++  F C C PG+ G RC  V  +QC  +PCLN   C  +    Y+C C+  ++G  CE ++  C  
Sbjct: 2049 EMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVK-----CPNGGVCHDLPGVKSTTCLCRTGFAGPQCEEITDICST---NNPCRNGARCIGEKLGR----FKCQCVPGWE----GPNCDKNIDDC--ADSPCALN--ATCVDLINDYKCE-CPTGFSGKRCHIKENLCASSPCVHGL-CIDKLYSRQCLCQPGWTGENCDQNIDECA-ASPCQNDAKCIDEINGYMCECADGYE---GVHCQHLVDHCAKQP--CHNNATCTNMGATYH---CDCTLGFDG--------VHCEMNIDECAENQCDKL----GTESCRDAVNDFKCVCKPGYTGPRC-DVKQDQCADSPCLNDAQCVDM-GGAYKCVCKSGWTGPKCEQDNGSCAA 2404          

HSP 3 Score: 83.1889 bits (204), Expect = 5.184e-15
Identity = 89/357 (24.93%), Postives = 148/357 (41.46%), Query Frame = 2
Query:  485 DCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWS---LDPVTKTCIADIDECRVGKYPCSIHPFVACVNTP-GDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQL-ENVCETN---NGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            DC+   C N A+C    +  +C C   + G  C     E L+   +   C NG +CE    +++C C   ++G  C    + C+     N  +C        H     K   CLC +G++    + +T  C  + + CR G           C+    G  +C+ C  G+EG      +I++CA++  C  N  CV+    Y+C+C  G    +   C + EN+C ++   +G C           ++  R C C PG++G+   +N                C     C+N   C   + G+ C+C  G+ G  C+ ++++ C   PC N   C  +    Y C C   F GV+CE
Sbjct: 2016 DCSAKMCENNAECSVFMHRAQCHCKPGYVGDRC-----EMLEDVCSTQPCYNGGKCEQVGTTYKCTCPKMFNGARCQFESDECNGVKCPNGGVC--------HDLPGVKSTTCLCRTGFAGPQCEEITDICSTN-NPCRNG---------ARCIGEKLGRFKCQ-CVPGWEGPNCD-KNIDDCADS-PCALNATCVDLINDYKCECPTGF---SGKRCHIKENLCASSPCVHGLCID---------KLYSRQCLCQPGWTGENCDQN-------------IDECAASP-CQNDAKCIDEINGYMCECADGYEGVHCQHLVDH-CAKQPCHNNATCTNMGAT-YHCDCTLGFDGVHCE 2318          

HSP 4 Score: 75.0998 bits (183), Expect = 1.434e-12
Identity = 85/312 (27.24%), Postives = 132/312 (42.31%), Query Frame = 2
Query: 4808 CEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIF--SPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE---TCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLC---TKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDD--GLFTSPF-----YPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDF 5695
            C     G  G + S NYPN Y  NL C   L+   +  I L I  FETE     +D + +    P  N    ++ L G M   +QT  +S  N M+++FRTD   ++RG++ K+     TCGG   A    Q  +SP YP   T  +G  C W + +   ++   IF  F          +  +++SL +  G   +++V A      T   Y    +N  Y+ ++ ++TS +  F  +Y  G      D  + D  G   SP      YPN    D+ C + I           IE    + ++S I + F
Sbjct:  225 CRTYEKGESGQLSSTNYPNSYDPNLNCRHVLEGPINSRIELTIEHFETEPD---FDILTVLDGGPAENSTTVIKRLSGSMET-VQT-ITSATNMMIVQFRTDAQSNARGWQLKWRAVPFTCGGHFTAQAYIQSFVSPGYPK--TFANGAECVWTVESTPGQVVSLIFDDF----------SLRAEDSLIVYNGATPSATVLASFSGNLTTKKYITSSTNIVYIYMMTRTTSSSRGFSISYKRGC-----DLSMTDPHGEIISPGYLATEYPN----DVTCTFTIE----------IENLKADRSLSIIPNRF 500          

HSP 5 Score: 72.4034 bits (176), Expect = 1.010e-11
Identity = 98/403 (24.32%), Postives = 148/403 (36.72%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR----ANNMC----------------QLE---------NVCETNNGGCST---NAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFT 1594
            D+CA +PC N A+CID  N + C C   ++G HC   V+ C +       C N A C N   ++ C C+  + GV C + I+ C+  +  D  G  +C       N   FKC+C  G++       C    D+C     PC       CV+  G  +C  C  G+ G    C   N    A  C  N  CV+    Y C C  G+  +    A N C                 LE           CE  N GC T      C+     ++   C C+PG++G+           TN+   +   C       +G TC   +    C C     G  C  +IN            N +  F + +R     L++    E+  +  G        ++  + F+
Sbjct: 2246 DECAASPCQNDAKCIDEINGYMCECADGYEGVHCQHLVDHCAK-----QPCHNNATCTNMGATYHCDCTLGFDGVHCEMNIDECAE-NQCDKLGTESC---RDAVND--FKCVCKPGYT----GPRCDVKQDQC--ADSPCLND--AQCVDMGGAYKCV-CKSGWTGP--KCEQDNGSCAAKPCRNNGFCVSLVADYFCVCPPGVSGKNCESAPNRCIGQPCHNGGECGDFGSHLECACPASFTGKGCEFKNTGCKTCENGGKCAEAAGGLQK--CECSPGFTGERC--------ETNIDECSTAHC------PSGATCVDQVNTHICVCPFNLTGVHCDKMINT-----------NYDLQFLDPFRPTSASLYAPFRIESSALSVGLWVKFEKPHQHAAFFS 2599          

HSP 6 Score: 68.1662 bits (165), Expect = 1.618e-10
Identity = 70/263 (26.62%), Postives = 112/263 (42.59%), Query Frame = 2
Query: 8348 GYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIK---SPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINY-GSITCEYLI 9118
            G + S  YP  Y  N +C  ++  P N  I+LTI+  H E   D +   +      E  +   ++L G +  + +T++   N M + F +D   +  G+ +++  +    TC G  F  +  I+   SP YPK + +   C WT+    G  VSL F   F L          DSL + +  + + T+L+   GN+     I SS N + +   T    +  GF   YK  C        GEI+S       Y   +TC + I
Sbjct:  234 GQLSSTNYPNSYDPNLNCRHVLEGPINSRIELTIE--HFETEPDFDILTVLDGGPAENSTTVIKRLSG-SMETVQTITSATNMMIVQFRTDAQSNARGWQLKWRAV--PFTCGG-HFTAQAYIQSFVSPGYPKTFANGAECVWTVESTPGQVVSLIFD-DFSLRAE-------DSLIVYNGATPSATVLASFSGNLTTKKYITSSTNIVYIYMMTRTTSSSRGFSISYKRGCDLSMTDPHGEIISPGYLATEYPNDVTCTFTI 482          

HSP 7 Score: 54.299 bits (129), Expect = 2.626e-6
Identity = 60/276 (21.74%), Postives = 119/276 (43.12%), Query Frame = 2
Query: 9764 GTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDG--PDSARPVIQTLCGD-DQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTL 10582
            G  G + S +  N+  Y+ NL C+  +  P    +++  E+     +         +D +T+ DG   +++  VI+ L G  + V +IT+ +N+M + F TD      G++L + AVP       T   + Q   SP YP         +   + +     +++   D  +R+      D  I+ + +      +  F  +L+T++   SS + V I      M    +++ R F ISY+   C+ +     G I++   +   +Y +++ C  T+
Sbjct:  231 GESGQLSSTNYPNS--YDPNLNCRHVLEGPINSRIELTIEHFETEPD---------FDILTVLDGGPAENSTTVIKRLSGSMETVQTITSATNMMIVQFRTDAQSNARGWQLKWRAVPFTCGGHFTAQAYIQSFVSPGYPKTFANGAECVW-TVESTPGQVVSLIFDDFSLRAE-----DSLIVYNGATPSATVLASFSGNLTTKKYITSSTNIVYIY-----MMTRTTSSSRGFSISYK-RGCDLSMTDPHGEIIS-PGYLATEYPNDVTCTFTI 482          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Celegans
Match: glp-1 (pep chromosome:WBcel235:III:9092241:9099698:1 gene:WBGene00001609.1 transcript:F02A9.6.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:glp-1)

HSP 1 Score: 91.6633 bits (226), Expect = 1.108e-17
Identity = 104/359 (28.97%), Postives = 147/359 (40.95%), Query Frame = 2
Query:  488 CANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----------NGFTCLDINECANAYTCGPNEECVNGFGTYQC--KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTC-QKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            C ++PC+NG  C   Y  F+CIC   + G +C E ++ C Q     + C  G+ C N++ ++ C C    SG  C      C+   N  IC HG C P+      K F+C+CDSG+      + C  D +EC + +   +      C N  GD  C  C  G+ G            + C +   CA+     P   C  GF   +C  +C  G      ++      C  +NG C  +  C  N F      C C P Y GD    N       ++ +  Y  CV      N  TC     +G++C C  GF G  C   +   C    C NGG CE +     RC+C   FSG  CE
Sbjct:  121 CDSDPCNNGL-CYPFYGGFQCICNNGYGGSYCEEGIDHCAQ-----NECAEGSTCVNSVYNYYCDCPIGKSGRYCE--RTECALMGN--ICNHGRCIPNRD--EDKNFRCVCDSGYE----GEFCNKDKNECLIEE---TCVNNSTCFNLHGDFTCT-CKPGYAGKYCEEAIDMCKDYVCQNDGYCAHDSNQMPICYCEQGFTGQRCEIECPSGFGGIHCDLPLQRPHCSRSNGTCYNDGRC-INGF------CVCEPDYIGDRCEINRKDFKFPDIQSCKYNPCV------NNATCIDLKNSGYSCHCPLGFYGLNCEQHL--LCTPTTCANGGTCEGV-NGVIRCNCPNGFSGDYCE 443          

HSP 2 Score: 67.3958 bits (163), Expect = 2.518e-10
Identity = 97/354 (27.40%), Postives = 140/354 (39.55%), Query Frame = 2
Query:  683 CSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG---------------------------NGFTCL------------DINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR----ANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGD--------GVGENGCVIVSTNVTNRAYRRCVRRQLC-RNGGTCQ---KSLTGFTCQCLPGFGGARCRTVINNQ---------CLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGT 1552
            C   + G  C  P+ S  N  ++D C +G CYP +       F+C+C++G+        C   ID C   +  C+      CVN+  +  C DCPIG  G                             F C+            D NEC    TC  N  C N  G + C C  G   +    A +MC+ + VC+ N+G C+ ++         +  IC C  G++G         G G   C +             ++R  C R+ GTC    + + GF C C P + G RC   IN +         C  NPC+N   C  L  + Y CHC   F G+NCE +H++C  T
Sbjct:  101 CEEGYGGPDCKTPLFSGVNPCDSDPCNNGLCYPFYG-----GFQCICNNGYG----GSYCEEGIDHC--AQNECA--EGSTCVNSVYNYYC-DCPIGKSGRYCERTECALMGNICNHGRCIPNRDEDKNFRCVCDSGYEGEFCNKDKNECLIEETCVNNSTCFNLHGDFTCTCKPGYAGKYCEEAIDMCK-DYVCQ-NDGYCAHDSN--------QMPICYCEQGFTGQRCEIECPSGFGGIHCDLP------------LQRPHCSRSNGTCYNDGRCINGF-CVCEPDYIGDRCE--INRKDFKFPDIQSCKYNPCVNNATCIDLKNSGYSCHCPLGFYGLNCE-QHLLCTPT 414          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Fly
Match: Cubn (gene:FBgn0052702 transcript:FBtr0273437)

HSP 1 Score: 325.479 bits (833), Expect = 3.238e-88
Identity = 567/2656 (21.35%), Postives = 1012/2656 (38.10%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEIN-----IVCSEQI--TKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-------CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLV--KLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMES--NQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFY--FMGFEGGSNNPNCSSDNSL----TIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILT---------SPNYPNFDITRRFCTWTILTDRTEALDIQMLS-FDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIF--ENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWI--IVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNR----------LHMTPHFIECKWHFTSPPGTRMQIDFE------ELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMDDFSY----FRLKVKIGSCGGLLHRRQGYIASPNYPL-----NYPPISSCIWQISGYSYSNIRLTFMDRDL----DENCSKSNLTVIPVKES-----ENAVI--WSNCNSSTWDIYTEYSTV--RIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGC-FRIRARGVGYRSVLLY---IICASNLENFEIDTKSSMI-------------------------EVFGSGATISFS-------------YNSDQPSLCGSNIYPNNNESGVITIENVN-ISLCQYNIH----------NYPEDEGTLSM-----FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRM------YSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEH--------HLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTL----LSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVSANVALINYGSITCEY-LIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY--------VLKTPNFPSPYHHNANLT-------WIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD---AIFCGNLTNISPFM-IDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVP----------SQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITI--------TVKD-LKIRSSVNCS-LDQFIIQDASLKHENKIEK---------FCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFY-----FKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICG-SSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYV---VNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKV 11053
            CG    S MG I+SP YP   P   +C W I   PG  I + I  +     +   L N     +K  T  K  N     ++C +      +   E     ++F + AS  +R FR+ Y  +C   +T+++G IES N M  +       CSW + + +G+++L+++           +    V  +     L      N  +    T     I  E  T     SNV        L+Y+  GCME         +     G  QS  +P    N ++C W        +++L  + I++E S NC++  +  +     V+ +   + C        ++I SS H  +++F S N  NG    F+ TY     +C  +++   G+I+SPNYP  YP + RC W ++V +   I  ++ D   E    C +DY+E +    +D    +L  +CG      +   SS +N  +++F +D +VS +GF+  + E+CG   +  E+  +   +S       +     C W  V    E   RI F    +     +N    +  + L     I EG     + +   C   P   +ISNG  L V +        F+  Y    ++CG  +    G FTSP+YP S   +++C++++  S G+S+ L++E    E + S    D++++R   +E+  L+G  Y  +E+    ++     ++W++ +S   +      F+A Y+  ++ E     G + SP F   +      +W +  +    +  +       R LD    N      YD   D          D  I +    +  ++   R P F + WN    E  +     E   +     Q++T         SP YPN       C WT++        +  LS  DLE   E    ++   F+GS    +S +  +    C     S   VF    +  +++ +  D      GF    + AC  +        L N+    K+    N +C + ++      I     +D P       +   +   + +    L   N   +  P +    +   +V+   N SS   Y  F    S        R E  RY DS  + ++++            H+     EC W   +PP  R+ + F+      +       C   F+   DGST    +IG   +CG  K ++I++ GN + I +    D S     F   + +  CGG  H  +G IASP+  L         +  C++ I     S I LT     +    + +CS+ N  ++   ++     E  ++     C      + +E + +  R  F        +GF+LKY      CG         L +  YP  +   + C W++ V   +R  V+++ L  N G    +R R +G+R  L         S L  + +D  + ++                           +GS +   F+             +N  +P  C   + P +N + +I ++  N  S+  +N H          N  E E  L       + S   G P  ++         L  P++      + RN M      YS  + G V+  I +PG   NM+ ++           G+++ + G I        Y D +  E  ++ P+++ +++++  ++L             C + +L +    + +SP     C  N  +   +   R  + L +HSD   +   F +   +      C G +     +I   ++ + Y +N+ C W +    GY + LTF+  F +E +    C  D L +   N  T     L  +CG + P   IN++   + L+F +D +   +GF A+++  CGG+   D  + E+ S          + C + ++P   +   V+  + NF         I + L D   N     +  GK  ++ T+   K         N   +   +    L  +       F   Y        + +T    SP  H  N         W   AP GY F+I    +D E + + C YD V   +            FCG +    P + I     I+   SD    +   GF A +   P     C   ++    +  V      +N G Y+N+L C+          + V F N  +         GCR D++ + DG  +   +I   CG +Q  ++ T  + +Y+ F TD  +  +GF++T  A+P          S +   +   N         YPN      +  G+ +   +  +  +         V D LKI +S +   L+Q +  D     +   +          +C ++  + ++     +V ++++   +E         FQ+   L + NR E+ Y G    V        S +  CN+ +  P PN     Y     F  ++ E  +   +D               L ++C    +  S  +N++ + +   T   +     D+TY+   V + P   CGG+ Y   G+ ++P +  N   + EC W +++ SN+ +   F    LG+ T    TC+  TD++++
Sbjct: 1216 CGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDL-----ELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSHL-------ARHEQHVPTATMPGGLYIVDGRN--VQEIVTPQAMNISGEVLTVVHNASNV-----NFQLDYRIDGCME---------ELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSNHKNSVEVHE--RHCGST---TKLVITSSGHRLHVRFISDNSHNG--LGFEATYRTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKL-LSSSSNMAVVRFISDDSVSKKGFRLHFHESCGQTIIVDETMFDYIQMSRQAARNES-----CLW--VFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHP-PALISNGQALTVSVPLQLVEE-FQGHYMTMDTSCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSES-CNRDYLEVRE-ESESGQLIG-VYCGNEVPGVIHS---RGAIWMKFKSDDDNVGE--GFMASYNYEHHNELNGTEGTIESPHFPSKFQDPVPYSWRITVDKEYVVAISLLYL---RDLDQPHLN-----FYDGYSDIGARIEVTDPDETIISSTNVVYFTSN--RGP-FKLNWNRLSKEALRSNRTAEERTRQCGN-QLITIDRSVIGFHSPGYPNGYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQNWSELRTL----CSLPTESSDRVFHGRPY--LRVEFVTDPSVNKTGFNGIVRTACGSEIT--ASKGLVNITEILKVLPRPNHDCVWTIKVRQGRRI----KIDFPDFQ----LQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFA-SPPRFLVSFRFEELRYTDSGRIRLSASGDEQFISSPYYPHLPHPHSECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQREFVLINDGSTELRPEIG--RYCGNRKPDTIYSTGNQMRIRY--FTDVSEPHMGFNASLSVARCGGSFHSPEGVIASPSRDLLLIHEEGKQLQECVYTIELEKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFGLDGEEKIVDTLMLCGMEAKHLISETNKIVFRYRFLDGIPAENQGFRLKYTSLGSRCGETIYASVGVLQTPGYPLGVPHPMHCKWQVQVPKGRR--VRLEILDFNTGTNMDLRGR-LGFRGRLTVANDFKMQSILGRYNVDPPAEVLSSDNTMGIDAFLLPIVQNHGIKLRFSAYGSSSCPGFTVMMNEVADIQFQRFNISRPLHCSYKVVPPSNSTLLIRVKEYNTTSVMMWNTHMCALLSPLKFNRLEQEEELMERILCDYQSPAPGKPLPSIR--------LPFPIQ-LVVSASARNAMTNLVLSYSTQSCGGVI--ILEPGD--NMTVHQPS---------GMVSAA-GAIDCAWAIGPYTDASG-EDEVLVPQDIQLEVSVYNVNLPAPSPSAQSPEAPCLHHYLKVYNGPDQNSPSLGLFC--NQATAVNMVVERG-LFLEYHSDSFSANATFNVSIKY---GSGCGGKLVYPYRAI---DFAEQYKNNVECIWEVEATMGYHIGLTFQGRFYIEDSP--GCTKDYLLVQQRNETTGNWTDLQRICGRVAPEM-INTTSPYLRLIFRSDGDVVADGFLAKFERNCGGLLYADSTEQELASPGFPNGYEKYLQCNWTIVPRSPSMGGVLVSFVNF---DLEQGPISVCLYD---NLTVTTKDKGKDPQQTTLCGVK--------HNHEYRGKEYVNLLLRTDGSYSGRGFTLLYTSRLCGGIISRTSMVESPVQHTDNTLPPGSDCYWNLTAPAGYKFNIKFLFIDFEANSN-CAYDGVEVFSGPIPDERYRWGRFCGRINEDLPLISIPQERGIIHSFSD--DRDPSRGFRALVRVMP----NCDEKISLNGSSRYVYSK--FNNAGGYQNDLDCQIVFRVNPDQQISVEFSNFHV-----QDTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDNKVTDTGFQVTINAIPRLCGSSEITLSADGTKEVTINSPARTPGGNYPNGVSCFWKIKGDSLLRVQFVNFDLHGPNQNGSCVDDYLKIYNSEDAPLLEQGLGTDLVFNGQTSSKNGFGFATEHVYCGNVKPD-IYYGRSSEVYLKFRSKGLEQHGG-----FQLQVALNS-NR-ERHYDGLQGRVH------LSQSADCNIIIRAP-PNYTLSLYYTELIFGTYDCEMENLEVFD----------RTNRSLQRVCSFVDMGKSLFSNANELRLQMKTGSYLT--SLDLTYLASPVEKGPG--CGGQFYNTEGIFSNPFYPNNVRNNSECQWIVRVPSNNVVFLTFEVFNLGSKT----TCH--TDYLQI 3683          

HSP 2 Score: 312.383 bits (799), Expect = 2.626e-84
Identity = 304/1171 (25.96%), Postives = 482/1171 (41.16%), Query Frame = 2
Query:  158 DSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLND-ID----LSALSDEXXXXXXXXXXXXDLKKCNCEL------------INSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDEC--RVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQC------------KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRI-CTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQ-KSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNH-YRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP-----------CIWTIISSNDQFLQIIPIN---LQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKT-NIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI---PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDG-DCSVQLSVFEITTSGR--IQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRK-IAISFLDF-------DINDDSECKFDFIKISGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF-----DCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL-------IHDNQTK---RFCGNHAKSG-PTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNP 3418
            +SP++IS +GN+IF++ ++++ISF      ++ +N+ +D    L A S   ++     +   D ++   +L            +++ L +   +       L     ++ ALEN   ++K  L  + CA+ PC NG  C + Y  F+C C   F+G  C  DVNEC    GT  GCQNG +C+N  G++ C+C   W G+ C      CS +S  ++CGHG+C P     +   ++C+C+ GW  + +T  C  D+DEC       PCS     +C+N PG   C  CP G  GNG +C D++EC       +  P  +C+N +G+Y C            KC +  +       Q    C   N  C   A+C    F I G   C C  G  G G G NGCV  +T  TN       +   C NGG C     + +TC C  GF    C     + C  +PC NGG C        + C C P + G  CE     C G                +L + S  L +P           C W +I +N+  +  +  N   ++   +C  +++Q+++      A  +IG+YC   N  P   N   S   +    ++ N     GF +    T  ++E      C      +   T+G   SP  P  Y +N +C  ++Q    T  R++L   +L L +  +NC + DY+ I  +   RE+    C            +   +HFHSD+    + T FQ  +        CG   T     I ES      P  V   C ++I      +++      E   D  DC   L V +IT  G   +Q          +         N   I F    G     FQ++   AC   +N ++ +     S  YP     +  C Y     T   I++  +DF       D +D+ EC    ++I+   +  +   YC  N+ E    N   ET  + +   ++    G GF+ +          CGG    +          H+    +D+   Y     C W I    +  I   ++ F LE+  +C YDYLE+       ++D ++K   ++CGN       + + +LV++FVSD S S  GF +  YT +    C     +SSG +T+P
Sbjct:   31 NSPKIISKDGNLIFESGANRNISFRLSGNSRLTINEELDVMELLLATSGSKKRSGGKDDDFVDARELADQLADFNRRAFGANGLSAMLRVQQNRTRGSMALLRRFQTRLRALENRVDRMKTDLEANSCASGPCENGGTCYNTYTGFRCQCRSAFEGTKCEMDVNECALYEGTDLGCQNGGQCQNHFGTYSCLCQPGWHGMHCTQRKADCSQSSAWELCGHGSCVPS---ADDAGYRCICEPGWKTNGLTPICGEDVDECSDSAAHKPCS----TSCINLPGSFTCAPCPAGLTGNGVSCRDLDECQTNNGGCSLSPKVDCINTYGSYHCGECPVGWTGDGRKCERSPQDIDIPAGQTPRTCPAGNNPCYPTASC----FLISGTTSCRCPMGMVGTGYGPNGCVNGTT--TN------CKENPCLNGGICLFAGPSNYTCLCPIGFRPPICEPQ-PSPCDQHPCKNGGRCRPTTSGDLFVCQCLPGYRGRLCETRFSSCNG----------------MLSAQSGRLRYPPEGTGYEHNAQCAW-VIRTNESLVVNVTFNSFDVEDSTECRFDWLQINDGR--SAAAQIIGRYC--GNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDL----TWNSMEP----QCGG---RLNFETHGTLASPGSPGNYPKNRDC--RWQLVAPTTKRIKLTFFSLQL-EQHANC-NFDYVLIKDSISGRELA-KYCTTGAPAPLLLPTHLAEIHFHSDAEG--SDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVS--CEYEIHLAVGEQVVIQFARLE--LDPLDC---LEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAG----SFQLNYRMACDYKLNNEQGT---ITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPE---ENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVHTRSG--------DHIRLPVHDD--SYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLT-YTFEDRAKCGGHIHASSGELTSP 1114          

HSP 3 Score: 210.69 bits (535), Expect = 1.893e-53
Identity = 318/1530 (20.78%), Postives = 602/1530 (39.35%), Query Frame = 2
Query: 6578 FPGFKLSYKKACYKDFRNPLEGSLQNVEYPNK---IFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKI-----LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFS------YFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE-NCSKSNLTVIPVKESENAVIWSN-CNSSTWDI-----YTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG---------CFRIRAR-GVGYRSVLLYIICASNL--ENFEIDTK------SSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIEN---VNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM--------SNYRVEIGYKF---SRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSE---LCGNIPPSNP-INSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGS-------ITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYD--GPDSARPVIQTLCGDDQVDS--ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV-FISSHDKVIIQYQVGPMENINSATDRRFQISYELY--TCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKL 10951
             PG++    +  +      L      + YP +      N  C +++R++  + ++N+T        + +C   +L+I      A  I    CG+++P     +   SS   + L+    + +   GF + ++  + +CGGR     +          N     P   +C+W   +P   R+++ F  L + +   CN  ++   D  +   +++      G    +    ++  I F +  + S      ++ ++ ++  CGG+   ++G I+  +     P   SC ++I       + + F   +LD  +C    L V+ + +   +++    C S    +      +E++ ++I F     +    F+L Y      C  + ++ +  + S  YP        CT+ I+   +  I +K    ++  G         C     R   G    +L   C  N   ENF  +T       S+ ++  G G    +   +     CG  ++  + +   + + +      + C + I   P ++     + S +       +Y   +I + L   V D      ER++  +      V   +    R++ +        S+   ++ Y F   ++CGG +  S G + SP YP  Y    DC+W +    + ++++ ++   LE   +C+ D+L +R     DSP   + CG + I      F  + MRL  H+D +++  GF + +     A  C G + +  G+I SP YP  YP+   C W I +  G  +SL  +   DLE   L  C+YDS++I     +   S    LC +    NP I    N+ ++VF +D ++   GF   YK+ C     +R     +  +  +NY         I C + I   + +  +V +         H+  +           + G+ +      +   +  + + +V+ A N + +  ++R     +E    F  F      ++PN+P  Y +N    W+          + + ++D+E S +         +  +S       CG+ T +       + L VRF SD SH  N  GF A           CGG + A     GVI+S +   N  Y  +  C+WQ+     H  +++FE   ++LE       C +D++  YD    D+    +  +CGD+  D   +++ SN+  + F +D ++ K GF+L F     Q  +I   T F  +  S +   N      F     A      I  T   +K+R   N    Q+  +   L    KI +  E   T R+ F  SH   +I        ++       FQ  Y     +C     A SG+  +   +    Y  N+ C L L+  +         +  +LE+S +C  DY++  + E  E   ++   CG+ + P  + +   + M F +D     +G+  +Y      + +   E+    G I SP F + + +    SW I +
Sbjct:  494 LPGYRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTN-ESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIV---SSGNQLYLWFRSDNSTAKEGFDLTWNSMEPQCGGRLNFETHGTLASPGSPGN----YPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVLIKD--SISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDPLDC----LEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYARAGS----FQLNY---RMACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGG-VHTRSGDHIRLPVHDDSYAGEATCYWVIM-APANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVND------ERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRD-IPARIPGF-SHEMRLILHTDSAINGRGFRLRWRIF--AFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIE---DLELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISYKANC-----IRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVS----HLARHEQHVPTATMPGGLYIVDGRNVQEIVTPQAMNISGEVLTVVHNASNVNFQ-LDYRIDGCMEELRGTFGFF------QSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSNHKNSVEVHERHCGSTTKLV-ITSSGHRLHVRFISDNSH--NGLGFEATYRTVKAT---CGGKLTA---RNGVIESPNYPLN--YPAHSRCEWQVEVSQHH--QIVFEMADLNLESGY---DCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHESCGQT-IIVDETMFDYIQMSRQAARNESCLWVFQ----AVEPNKRIIFTPTHVKLREDAN---QQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGHYMTMDTSCGSIYNALSGKFTSP--YYPASYPPNIEC-LWLLEASMGNSLSLTLESMDLEKSESCNRDYLE--VREESESGQLIGVYCGNEV-PGVIHSRGAIWMKFKSDDDNVGEGFMASY------NYEHHNELNGTEGTIESPHFPSKFQDPVPYSWRITV 1935          

HSP 4 Score: 184.111 bits (466), Expect = 2.097e-45
Identity = 308/1429 (21.55%), Postives = 566/1429 (39.61%), Query Frame = 2
Query: 3704 YTINYSSLDEECGS-IHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLA-STKYRFRLYYTQDCEFP-----ITSSSGRIESKNEMLR-----YCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLK-KSCG---NQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPN-SIANIDCQWNFQTIPGFSVKLK---FDIIEMESSINCSEGPILRAWE-NEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFT---NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIF----SPINNDLVK-LQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FE---TCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSG--NAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNG---PNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEI--TWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFK---KIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYK--KACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILR-SHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-------LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECG-----GRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFC-GKTNSIFTIGNVLT--ILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTF--MDRDLDENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM 7795
            + + ++S++ +CG  ++  T G +ASP  P   P N  CRW++ +   KRI +    ++   +++   CN    ++K   + +E+   C+       +       + F + A  +   F+L+Y+ +   P      T+  G I   +          C +++    G +++IQ  + +L PL    C   + I+D   ++L+ K CG   ++L   TFTS    ++I+ Y          RA           G  +  Y    +   + + G I S  +PN + ++  C +   T     + LK   F +   ES  + ++  +      N+ ++   +   C +    ++ + +++    YL+   + D +   R F+  Y      N  C    + S   I+ P + + Y     C W +    + +I L    F  E ++ C YDY+EI+    + +N++  K L   CG   N +     S + ++++KF +D++ S  GF   Y FE    CGG   A  S+  L SP YP  Y+   G+ C+W+L      + L I       E    +PNCS+D  L +  G G +S +    C +     I    H +++IL + S      F+  + + +  CGG    + G  +SP YPNS      C + I   PGS I L IE+   E  +S   +D + I  G   PN++   +       ++ N     + N    +        F     F   Y  N      +  G + S  +   + +   I  +WT+ A    ++       +   +        G L I D     ++              P  + +S E       L   +   + NF+   +I  C   ++ T       SPNYP        C W I  ++  A+++ + + DLE S  C  +  TV  +  KN +      V    CGS       +  T   + + + + +D      GF+ +Y+  KA          G +++  YP     +  C + +  S     +  +  L+L   +   C   +L+   +  + T       +CG     D   ++++SS + V  F +  S S+  GF++ +    E CG             Q SR    N + L +       K    +P   +++ D  +   +   C    +  ++G  T  Q      FC     ++ + G  LT  +  + +++F    + +   SCG + +   G   SP YP +YPP   C+W +     +++ LT   MD +  E+C++  L V    ES   +I   C +    +      + + FK++     +GF   Y +E      E +  E  + S ++P      +  +W+I VD  K  +V +  L +
Sbjct:  616 FDLTWNSMEPQCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQ---LEQHANCNFDYVLIKDSISGRELAKYCTTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDPL---DCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKFYA---------RA-----------GSFQLNYRMACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPEENFVSETN----YLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCG---NSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHA--SSGELTSPEYPANYSA--GLDCDWHLTGTIDHL-LEIQVENFELE---QSPNCSAD-YLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRWRIFAFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLELE-GLSNCYYDSVKIYTGIKLPNQSPCKV--LCKDDDLHNPLIQLENNKGTIVFDSDASNTFRG---FRISYKANCIRNLTATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSHLARHEQHVPTATMPGGLYIVDGRNVQEIVT------------PQAMNISGE------VLTVVHNASNVNFQLDYRIDGCMEELRGT--FGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTV--SNHKNSV-----EVHERHCGSTT----KLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNL--ESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDD--KLLSSSSNMAVVRFISDDSVSK-KGFRLHFH---ESCGQTIIVDETMFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEG--TEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGHYMTMDT-SCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVREESES-GQLIGVYCGNEVPGVIHSRGAIWMKFKSDDDNVGEGFMASYNYEHH---NELNGTEGTIESPHFPSKFQDPVPYSWRITVD--KEYVVAISLLYL 1948          

HSP 5 Score: 154.836 bits (390), Expect = 1.302e-36
Identity = 227/994 (22.84%), Postives = 399/994 (40.14%), Query Frame = 2
Query: 8321 CGGLLTESFGYIKSPGYPEKYPDNTDCEWLI--IAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCG-----LNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDL-----ERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI------CGGVYDLRQGEIVSANVALINY-GSITCEYLIPGWENHLQVVYIYPNFFG------CRYHDNQIQIDLEDQ--NGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCG-NLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDG---PDSARPVIQTLCGDDQVDS--ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRY--------PNNSPYDLRFMGELIAANETDHITITVKDLKIRS----SVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKV-------SYGNQALKYCGYILLDEEFQIPSSSFTV 11137
            CGG+ T   G I         P    CE+ I     E ++IQ     L L+  LDC      +   +E  S    K+CG     LNP    T +   NR+++ F++        F + Y        C+  + N +G+I SP YP    S+  C +TI       +SL  ++ F L     +      C   +LRI D     +L   CG   P     S  N + L  STD +    GF  +Y+++      CGGV+  R G+ +   V   +Y G  TC ++I    N  + + ++ N F       C Y   +I   L  Q  +    P  + CG S  +  + HS+ + + + + ++   +  F   Y  ++  K           L +P +P+ Y    +  W     + ++  I + + ++E+S + C+ D++         S  I  FCG ++    P       LI+   S I+       +  F         GCGG + + +G    I S    N+  Y N   C+W+I+   G  + ++ E+  + LEG S    C YD + IY G   P+ +    + LC DD + +  I  ++N   ++F +D +    GF++++ A     + I+ +T  +  +ES  Y        P N  + +R       A + + + + V  L        +       +I+   +++         E ++ + + IS     ++           +A++  FQ+ Y +  C    +   G      N+  K Y +NL C   LIT   +   +      +LE S  C  D +   +        V  + CGS+      ++  R+ + F++D S N  G++ TY   R     CGG++   +GVI SP +  NY     C W +++  +  I +   D+      +LE     N D+++        + G +  K CG    D++    SS+  V
Sbjct:  744 CGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFA--RLELDP-LDC---LEVLDITDEGGSILQEKICGSDASRLNP---PTFTSEFNRLKIKFYA----RAGSFQLNYRM-----ACDYKLNNEQGTITSPGYPNLTRSDRICTYTISTATNTVISLK-RIDFQLTNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVH-TRSGDHIRLPVHDDSYAGEATCYWVIMAPAN--KAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVS-DYSESDGGFDLTYTFEDRAKCGGHIHASSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPN-CSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRWRIF-------AFGCGGSLRSNMG---AISSPRYPNS--YPNMAHCEWRISLHPGSGISLLIED--LELEGLSN---CYYDSVKIYTGIKLPNQS--PCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISYKA-----NCIRNLTATTGTIESLNYMEPFWETIPINCSWTIR-------APKGNRVLVEVSHLARHEQHVPTATMPGGLYIVDGRNVQ---------EIVTPQAMNISGEVLTVVH----------NASNVNFQLDYRIDGCMEELRGTFG-FFQSPNYP-KMYPNNLEC-YWLITVEQDSAIELTINNIDLEDSPNCTKDAL--TVSNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATY---RTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADL------NLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAV 1649          

HSP 6 Score: 153.68 bits (387), Expect = 2.911e-36
Identity = 372/1838 (20.24%), Postives = 669/1838 (36.40%), Query Frame = 2
Query: 1976 GLFQSPNFPLKYQQNINCAMKFQAEYGTRF---RVELQIKTLDLGDLQSNCSDSDYLQIN-FVDREIKITACNQNMYFNKKFI--VNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPAD-----VEAFCTWKIKQTNSSRLIRLKG---TFENWFDGDCSVQLSVFEITTSGRIQNH-------FITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKI-AISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAK--VSVFDCGGSFFLTNKLIIG--YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDY------LELIHDNQTKRFCGNHAKSGPTV---THKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITN-----PTLEKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIR-----SGSVDETKLCNDKNPV-LKFVTAKKEINIVCSEQITKMHV-FEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNG--------QCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANIDCQWNFQTI-PGFSVKLKFDIIEMESSIN---CSEGPILRAWENEIVDENYVFQACNRIDDGKS---IIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLK--VKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY----FETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSS--------------TCGGDFYLDDGL---FTSPFYPNSVNMDLDCVY-VIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQ-DTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCN-RGNLIIYDSNYDAKVFCGSG-----VIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQML-SFDLESSY----ECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA-CYKDFRNPLEGSLQNVEYPNKIFEN-----KNCTFILRSHFLNYI-LNLTALDLPPPTNGKC---------------VNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDF 7108
            G   SP +P   + +  C         T     R++ Q+   +  D  ++   +  L+IN  ++R+I    C +N    + F+   N   +H  +D  S     +F++R   A   + CG   T + + I     +P        EA C W I    +++ IRL     + EN  D  C         +   ++ +        +      E L  +  ++  +F   + +  G     +       CG  ++    S+ E  S  YP NYS    C +        +  I   +F++     C  D++++   G     L  R+C  +    I   S++    + +   ++S   G GFR +  +  F CGGS       I    YP S+ N +             C W I+    + I  + +   LE   NC YD       ++L + +  K  C +     P +    +K  I F SD S +  GF + +        C  +  +++G I +     P  E +     C ++I+ P+  ++L+ ++          +P    AT+      +   ++  +    PQ   I  S    T+ +      NA   N+ ++Y    + C      T G   SPNYP   P N  C W I       I + IN+I      + + D   + N KN V +          +V +    ++HV F   + H    N    +  +R      C   +T+ +G IES N  L Y     C W++   +  +I+ ++   +   L++G        + Y      D     L K CG++  +    SS+  + +  +    + S      +G  L +  + C +T   D    DY      IQ ++   +  N  C W FQ + P   +      +++    N    +EG  L       + E    Q   R+   +S    +I +       +  + + P   + +FQG Y   + SC    +   G   SP YP  YP N+ C W L+  +  S+S+ L+ +D E  ES C  DY+E+      +  +   L G        G       + +KF++D      GF A Y         G    +E      SP++P  +  P     W +  +   +      Y    +     P+      L   +G    S + A +    P   IIS+ +    ++  TS    FK  +   S                CG      D     F SP YPN    DL+C + ++ ++P     L++ +   E      + D++ I +G +  +       TL  +   + +  F+   ++R+        N   F         +E  +  G++   +   V  + + +  WT+      +++  F  F +   + +G  + R  L++ + N +   F G G     V+   + T      +       P FL+ +     E  +        + A+   Q ++SP YP+       C W +       + +    +FD+  +     EC+ E F +   GS         Y     CG  N     ++ T   N ++I Y  D  +P  GF  S   A C   F +P EG + +      +        + C + +     + I L    L +P   NG C               ++G  KI+   +   LCG     + + +I+ ++ I+          +   GF++ Y+     CG     T Y    ++      L + PH + CKW    P G R++++ 
Sbjct:  862 GTITSPGYPNLTRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTNLRINDGLNRKILGPYCGKNQP-EENFVSETNYLQLHLSTDVDSMGRGFKFEYR-ALATGNDKCGGVHTRSGDHI----RLPVHDDSYAGEATCYWVI-MAPANKAIRLHWNSFSLENAVD--CIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYSESDGGFDLTYTFEDRAKCGGHIHA---SSGELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQSPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHE----MRLILHTDSAINGRGFRLRWRIFAFGCGGSLRSNMGAISSPRYPNSYPNMAH------------CEWRISLHPGSGISLLIEDLELEGLSNCYYDSVKIYTGIKLPNQSPCKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISY-----KANCIRNLTATTGTIESLNYMEPFWETI--PINCSWTIRAPKGNRVLVEVSHLARHEQ--HVP---TATMPGGLYIVDGRNVQEI--VTPQAMNI--SGEVLTVVH------NASNVNFQLDYRI--DGCMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAIELTINNIDLEDSPNCTKDALTVSNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSH----NGLGFEATYRTVKAT-CGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLN---LESGYDCNWDYLEAYDLTE-DDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSK-----KGFRLHFH-ESCGQTIIVDETMFDY------IQMSR--QAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVK--IYEGTEPQGTPRLKFCRSHPPALISNG------QALTVSVPLQLVEEFQGHYMTMDTSCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSES-CNRDYLEV-----REESESGQLIGVYCGNEVPGVIHSRGAIWMKFKSDDDNVGEGFMASYNYEHHNELNGTEGTIE------SPHFPSKFQDPVPY-SWRITVDKEYVVAISLLYLRDLD----QPH------LNFYDGY---SDIGARIEVTDPDETIISSTN----VVYFTSNRGPFKLNWNRLSKEALRSNRTAEERTRQCGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADYVKIFSGSDLQN--WSELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVRTACGSEITASKGLVNITEILKVLPRPNHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFASPPRFLVSFR---FEELRYTDSGRIRLSASGDEQFISSPYYPHLPHPHSECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQRE-FVLINDGSTELRPEIGRY-----CG--NRKPDTIYST--GNQMRIRYFTDVSEPHMGFNASLSVARCGGSFHSP-EGVIASPSRDLLLIHEEGKQLQECVYTIELEKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFGLDGEEKIVDTLM---LCGM----EAKHLISETNKIVFRYRFLDGIPAENQGFRLKYTSLGSRCGE----TIYASVGVLQTPGYPLGV-PHPMHCKWQVQVPKGRRVRLEI 2558          

HSP 7 Score: 153.68 bits (387), Expect = 3.357e-36
Identity = 306/1327 (23.06%), Postives = 524/1327 (39.49%), Query Frame = 2
Query: 4046 YRFRLYYTQ--DCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNR-TFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQ--GCMETFYYDPHESDYSTKNGVIQSAQFP-NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNY--SCEHEMSGSEGIIQSPNYPNFYPHNLRCSW--NLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQH-LCGKMANFIQT-GFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNL-VANTSEIGL-RIFFYFM-GFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKS-PYHPIISNGHYLKVILKSTSGNAIFKA------AYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNG-----PNETSSLLGRFY-------TLSEIRNYTYNYKFNDSVWIRLRSQGG-DFTNHIKFLAK--YHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSN-YDAKV---FCGSGVIDS-AIFTPPVTLILSAE-GYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENK--NCTFILRSHFLNYIL----NLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIG---GQNFCGKTNSIFTIGNVLTILFKNMDDFSYFRLKVKI------GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKE--SENAVIWSNCNSSTWD--IYTEYSTVRII-FKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKIN-VDVSKRIIVKVKKLKMNQ 7801
            YR RL  T+   C   +++ SGR+    E   Y     C+W + +     + +  + FD+    + +C + +++I+D    +  ++ + CGN L +     SS   + +   +D ST      A EG  L + +    C     ++ H        G + S   P N   N DC+W         +KL F  +++E   NC+   +L      I D     +       G    +   TH   + F S  D  G    FQ  Y        C    +  EG I   +  N  P  + C +  +L V E + I    L+ +        D +E+    +     LQ  +CG  A+ +    F+S  N + IKF       +  F+  Y   C   ++  E    + SP YP++ T  D IC + +  A  + I L RI F    G     +N  C + N L I +G+  N  +    C K+ P    +S  +YL++ L ST  +++ +       A   G+  CGG           P + +S   +  C +VI      +I L    FS ENA+  I +D+++I +       +E S  L ++         LS  R     +  + S      S GG D T   +  AK   HI+ ++      G L SP++   Y+   +  W +       L+   + F + +   +  C+   L + +    D+ +   FCG  +      F+  + LIL  +      GF +RW       F   G     + A      ++SP YPN       C W I       + + +   +LE    C Y++  + +TG K P  S  +   + K   L+N    +      N   I + +D  + F GF++SYK  C ++      G+++++ Y    +E    NC++ +R+   N +L    +L   +   PT    + G L I+         G N+   + P   N S  ++ +  N S+ +    FQ+ Y  + + C     +   + +     + N   M P+ +EC W  T    + +     EL I+ I   +S     D  T    K      +  CG T  +    +   +  + + D S+  L  +        +CGG L  R G I SPNYPLNYP  S C WQ+    +  I     D +L+   +C+   L    + E  +E   ++  C   T D  + +  S + ++ F ++   ++KGF+L +F E   CG      E   +     +  +    C W    V+ +KRII     +K+ +
Sbjct:  497 YRGRLCETRFSSCNGMLSAQSGRLRYPPEGTGYEHNAQCAWVIRTNESLVVNVTFNSFDVE--DSTECRFDWLQINDGRSAAAQIIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNST------AKEGFDLTWNSMEPQCGGRLNFETH--------GTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQLEQHANCNFDYVL------IKDSISGRELAKYCTTGAPAPLLLPTHLAEIHFHS--DAEGSDTGFQLHYSVEERVPGCGGVYTAKEGTISESSTANTEPGGVSCEYEIHLAVGEQVVIQFARLELDP------LDCLEVLDITDEGGSILQEKICGSDASRLNPPTFTSEFNRLKIKF----YARAGSFQLNYRMACD-YKLNNEQGT-ITSPGYPNL-TRSDRICTYTISTATNTVISLKRIDFQLTNGESDDDDNDECLTTN-LRINDGL--NRKILGPYCGKNQPEENFVSETNYLQLHL-STDVDSMGRGFKFEYRALATGNDKCGGVHTRSGDHIRLPVHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCI-YDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLLSHSRQLVLKFVSDYS-----ESDGGFDLTYTFEDRAKCGGHIHASS------GELTSPEYPANYSAGLDCDWHLTGTIDHLLEIQVENFELEQ---SPNCSADYLEVRNGGGTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRWRIFA---FGCGGSLRSNMGA------ISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLELEGLSNCYYDSVKI-YTGIKLPNQSPCK--VLCKDDDLHNPLIQLEN----NKGTIVFDSDASNTFRGFRISYKANCIRNL-TATTGTIESLNYMEPFWETIPINCSWTIRAPKGNRVLVEVSHLARHEQHVPT--ATMPGGLYIVD--------GRNVQEIVTPQAMNISGEVLTVVHNASNVN----FQLDY--RIDGC-----MEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDSAI-----ELTINNIDLEDSPNCTKDALTVSNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGKLTARNGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRL-HFHES--CGQTIIVDETMFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLRE 1721          

HSP 8 Score: 138.272 bits (347), Expect = 1.386e-31
Identity = 229/1031 (22.21%), Postives = 417/1031 (40.45%), Query Frame = 2
Query: 7973 CGSNIYPNNNESG---VITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM--------SNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQ-TLHLEHHLDCNYDHLFIRYAEEFDS--PPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIF--NTEGSIKSPNYPKPYPSNLRCNWTI--HVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII--DSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS-ICGGVYDLRQGEIVSANVALIN---------YGSITCEYLIPGWENHLQVVYI-YPNFFGCRYHDNQI-QIDLEDQNGNYLPGQRICGKSREKITIMH-SKSIKIVYTARNFHLKNYNFRA--RYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGV-IKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQ-------------------------TLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESP------RYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYEL-YTCNRTEKAY--SGRIVNVEN-----FKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVV 10831
            C   I P  + SG   V+  +++ + +  YN+ N P    +     + +   PC + Y   K+ NG  +     G  CN+             VN + + G  +          + + V I Y  S CGG L   +  I    + E+Y +N +C W + A     I LT Q   ++E    C  D+L ++   E        +++CG   ++ E ++     +RL F SD  V  +GF+ ++        C G+++  +TE  + SP +P  Y   L+CNWTI    P    V ++F + FDLE+  +  C YD+L +   D       + LCG     N        ++L+  TD +++  GF   Y S +CGG+  + +  +V + V   +         Y ++T      G++ +++ ++I +     C Y   ++    + D+   +    R CG+  E + ++   +   I+++  +    +  FRA  R + + + K+  +    YV    N    Y ++ +   +F        S+   +  ++ + DGC  D+V         +D I  FCG   N  P +  T + L +RF +D  +    TGF   IN  P  + G      +  GT  V I S      G Y N + C W+I       ++V F N    L G ++ G C  D++ IY+  D+  P+++                           CG+ + D    +S+ +YL F +    Q  GF+L      ++      +     L +S       R P N    L +  ELI                   + +C ++   + D   +    +++ C  +   +   S+ +++ +Q + G            +  S +L Y  +  EK     G+  N E      F      +N  C   +  P+ N+ +   F+ FNL   +TC  DY+Q +  +   ++  + + CG   P  + +  S+V + F   +++NYDG  I +V+
Sbjct: 2790 CAWAIGPYTDASGEDEVLVPQDIQLEVSVYNV-NLPAPSPS-----AQSPEAPCLHHYL--KVYNGPDQNSPSLGLFCNQ----------ATAVNMVVERGLFLEYHSDSFSANATFNVSIKYG-SGCGGKLVYPYRAID---FAEQYKNNVECIWEVEATMGYHIGLTFQGRFYIEDSPGCTKDYLLVQQRNETTGNWTDLQRICGR--VAPEMINTTSPYLRLIFRSDGDVVADGFLAKFE-----RNCGGLLYADSTEQELASPGFPNGYEKYLQCNWTIVPRSPSMGGVLVSF-VNFDLEQGPISVCLYDNLTVTTKDKGKDPQQTTLCG--VKHNHEYRGKEYVNLLLRTDGSYSGRGFTLLYTSRLCGGI--ISRTSMVESPVQHTDNTLPPGSDCYWNLTAP---AGYKFNIKFLFIDFEANSNCAYDGVEVFSGPIPDERYRW---GRFCGRINEDLPLISIPQERGIIHSFSDDRDPSRGFRALVRVMPNCDEKISLNGSSRYVYSKFNNAGGYQNDLDCQIVFRVNPDQQISVEFSNFHVQDT-DGCRSDYVELRDGGGTFADIIGRFCGQ--NQPPTLRTTRHTLYMRFVTD--NKVTDTGFQVTINAIP-RLCGSSEITLSADGTKEVTINSPARTPGGNYPNGVSCFWKIKG--DSLLRVQFVN--FDLHGPNQNGSCVDDYLKIYNSEDA--PLLEQGLGTDLVFNGQTSSKNGFGFATEHVYCGNVKPDIYYGRSSEVYLKFRSKGLEQHGGFQLQVALNSNRERHYDGLQGRVHLSQSADCNIIIRAPPNYTLSLYYT-ELIFG-----------------TYDCEMENLEVFD---RTNRSLQRVCSFVDMGKSLFSNANELRLQMKTG-----------SYLTSLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYPNNVRNNSECQWIVRVPSNNVVF-LTFEVFNLGSKTTCHTDYLQILEQDATGEEREMRRFCGEDNPKYYKSRRSQVLVRF--HKTVNYDG--IGWVI 3731          

HSP 9 Score: 127.487 bits (319), Expect = 2.752e-28
Identity = 291/1398 (20.82%), Postives = 525/1398 (37.55%), Query Frame = 2
Query: 1541 CGGTY-AVSNEYREISLFTSLLPSPSRSLHFPCIWTIISS--NDQFLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVE----LQIKTLDLGDLQSNCSDSDYLQINFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEP-------------CG-ATITMNPNAI-IESPAIPADVEAF--CTWKIKQTNSS--RLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIF----FKKLKGISTPE-----FQISAEYACGNS-------VNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDD-----SECKFDFIKISGSN--SGHLDQ-RYCNGNKNELITLNSND--------ETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFY----VFDQFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSGPTVT-HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEKL------SNSFTCFYSIKVPQFKKILINITVSE----SDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETK----------LCND--KNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLR------------YCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYP--------IRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANIDCQWN---FQTIPGFSVKLKFDIIEMESSI------------NCSEGPI----LRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSP----NYPNFYPHNLRCSWNLKVKESMSIHLKIL---DFETEESL-CRYDY--VEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFE 5311
            CG  Y A+S +      FTS     S   +  C+W + +S  N   L +  ++L+    C+ +Y+++ E+S   E+  LIG YC   N  P   ++ G+I +   +   N+ +  GF        MA  N +  +  NG       T G  +SP+FP K+Q  +         Y  R  V+    + I  L L DL       D   +NF D    I A  +    ++  I +  +V+F S      N   F+  W + +S+E              CG   IT++ + I   SP  P   E    C W +  +N +   ++ L       F  DC       +I +   +QN        E+ +   L  E+   +F    + +++ ++ P      F      ACG+        VN+ E+          P+    N  CV+     + R+I I F DF + ++     S+C+   +  +G++  S  L + +YC    +E++  +SN            + +++F+          R ++S    G   F+++      P  H                 C W +    +  I       FD       P        LI+D  T+      R+CGN        T +++ IR+ +D S    GF       +    C  SF S  G+I +P+ + L           C Y+I++ +   I +     +     +GSC     L    +           +  +     + + + + +N     Y       A    + + Y+SL   CG    +++G + +P YPL  P   +C+W+++   G+R+ ++I    +G+  + +          + ND     +L          ++ S+    +  F    +  I QN    K RF  Y +  C        G     NE+              +CS+K+     S +LI++ +++   +     +    +S      L++    +L+ R       P        IR+         ++   A   +VL Y TQ C      +P ++       V Q +   ++   IDC W    +    G    L    I++E S+               E P     L+ +     +   +   CN+      ++ +     ++   FSAN           T+   N S ++  SG  G +  P    ++   Y +N+ C W  +V+ +M  H+ +     F  E+S  C  DY  V+  +    +   LQ +CG++A  +    ++ +  + + FR+D  V + GF AK+   CGGL  A  + Q L SP +P+ Y      C W +V  +  +G  +   F+ F+
Sbjct: 1792 CGSIYNALSGK------FTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVREES---ESGQLIGVYC--GNEVPGVIHSRGAIWMKFKSDDDNVGE--GF--------MASYNYEHHNELNG-------TEGTIESPHFPSKFQDPV--------PYSWRITVDKEYVVAISLLYLRDL-------DQPHLNFYDGYSDIGARIEVTDPDETIISSTNVVYFTS------NRGPFKLNWNR-LSKEALRSNRTAEERTRQCGNQLITIDRSVIGFHSPGYPNGYEQDLNCFWTLVPSNPAMHAVLTLSQIDLEIFSEDCIADY--VKIFSGSDLQNW------SELRTLCSLPTESSDRVFHGRPYLRVEFVTDPSVNKTGFNGIVRTACGSEITASKGLVNITEILKV------LPRP---NHDCVWTIKVRQGRRIKIDFPDFQLQNNMASGSSDCRNYLLLRNGNDEDSPFLGRGKYCEDVVHEVLNTSSNKAYIKFHFASPPRFLVSFRFEELRYTDSGRIRLSA--SGDEQFISSPYYPHLPHPH---------------SECIWIVEAPPEHRIMLHFQGAFDMLDATGEPEECQREFVLINDGSTELRPEIGRYCGNRKPDTIYSTGNQMRIRYFTDVSEPHMGFNASLSVAR----CGGSFHSPEGVIASPSRDLLLIHEEGKQLQECVYTIELEKGSTIDLTSEYLQIPTLRNGSCSQRNHLMLEEMDAFGLDGEEKIVDTLMLCGMEAKHLISETNKIVFRYRFLDGIPAENQGFRLKYTSLGSRCGETIYASVGVLQTPGYPLGVPHPMHCKWQVQVPKGRRVRLEILDFNTGTNMDLRGRLGFRGRLTVANDFKMQSILGRYNVDPPAEVLSSDNTMGIDAF----LLPIVQN-HGIKLRFSAYGSSSC-------PGFTVMMNEVADIQFQRFNISRPLHCSYKVVPPSNSTLLIRVKEYNTTSVMMWNTHMCALLSPLKFNRLEQE--EELMERILCDYQSPAPGKPLPSIRLPFPIQLVVSASARNAMTNLVLSYSTQSCGGVIILEPGDN-----MTVHQPSGMVSAAGAIDCAWAIGPYTDASGEDEVLVPQDIQLEVSVYNVNLPAPSPSAQSPEAPCLHHYLKVYNGPDQNSPSLGLFCNQATAVNMVVERGLFLEYHSDSFSAN----------ATF---NVSIKYG-SGCGGKLVYPYRAIDFAEQYKNNVECIW--EVEATMGYHIGLTFQGRFYIEDSPGCTKDYLLVQQRNETTGNWTDLQRICGRVAPEM---INTTSPYLRLIFRSDGDVVADGFLAKFERNCGGLLYADSTEQELASPGFPNGYE-KYLQCNWTIVPRSPSMG-GVLVSFVNFD 3061          

HSP 10 Score: 92.0485 bits (227), Expect = 1.486e-17
Identity = 110/444 (24.77%), Postives = 187/444 (42.12%), Query Frame = 2
Query: 9926 CRYDHITIYDGPDSARPVIQTLCGDDQVD-SITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE-----LIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENK-----IEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY---ELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG----NQALKYCGYILLDEEF-----QIPSSSFTVEYKSLTGGVGAGFRISW 11188
            C   ++ I DG +  R ++   CG +Q + +  +++N + L  STD +    GFK  + A+ + N     V   S   +  R P    +D  + GE     +I A     I +      + ++V+C  D   I D+     N      + K+C +   E +   SH + ++   V       S +D  F ++Y   +   C     A SG + + E      YS  L C+  L     +L  +   + F LE+S  C+ DY++   G  G    ++ + CG  IP      S  + +I  TD +IN  G+ + +   R  +  CGG +  + G I+SP +  +Y     C W I L   S I     D++L   ++    CY   D VK+  G    NQ+   C  +  D++      Q+ ++  T+ + S       GFRIS+
Sbjct:  913 CLTTNLRINDGLN--RKILGPYCGKNQPEENFVSETNYLQLHLSTDVDSMGRGFKFEYRALATGNDKCGGVHTRSG--DHIRLP---VHDDSYAGEATCYWVIMAPANKAIRLHWNSFSLENAVDCIYDYLEIYDSLGAQVNDERSKPLAKYCGNSVPEDLL--SHSRQLVLKFVSDY----SESDGGFDLTYTFEDRAKCGGHIHASSGELTSPE--YPANYSAGLDCDWHLTGTIDHL-LEIQVENFELEQSPNCSADYLEVRNGG-GTDSPLIGRFCGRDIPARIPGFSHEMRLILHTDSAINGRGFRLRW---RIFAFGCGGSLRSNMGAISSPRYPNSYPNMAHCEWRISLHPGSGISLLIEDLELEGLSN----CY--YDSVKIYTGIKLPNQSP--CKVLCKDDDLHNPLIQLENNKGTIVFDSDASNTFRGFRISY 1328          

HSP 11 Score: 78.9518 bits (193), Expect = 1.193e-13
Identity = 109/496 (21.98%), Postives = 188/496 (37.90%), Query Frame = 2
Query: 1943 NGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEAF--CTWKIKQTNSSRLIRLKGTFENWFDGDCSVQ-LSVFEIT---TSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYA--ETRKIAISFLDFDINDDS--------ECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSF-FLTNKLIIG-YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR----FCGNHAKSGPTVTH---KLVIRFVSDNSVSGEGFIMRF 3349
            +G  E  + T G FQSPN+P  Y  N+ C      E  +   +EL I  +DL D  +   D+  +  +    E+    C            +R  V F SD+  +       +R  KA     CG  +T   N +IESP  P +  A   C W+++ +   +++            DC+   L  +++T   T G  +  F  C       +      N   + F     +S   F++    +CG ++ +DE     F      +  + N  C++ F A    ++I  +     + +D+        +C    +KI       G    ++C  +   LI   SN +   + +  +    F G       S   CG  +  L+ K     YP S            Y  N  C W +   +   +    +   LE   +C  DYLE+  ++++ +    +CGN     P V H    + ++F SD+   GEGF+  +
Sbjct: 1437 DGCMEELRGTFGFFQSPNYPKMYPNNLECYWLITVEQDS--AIELTINNIDLEDSPNCTKDALTVSNHKNSVEVHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKAT----CGGKLTAR-NGVIESPNYPLNYPAHSRCEWQVEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEG--ERLFKVCGDETEDDKLLSSSSNMAVVRFISDDSVSKKGFRLHFHESCGQTIIVDETM---FDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALI---SNGQALTVSVPLQLVEEFQGHYMTMDTS---CGSIYNALSGKFTSPYYPAS------------YPPNIECLWLLEASMGNSLSLTLESMDLEKSESCNRDYLEVREESESGQLIGVYCGNEV---PGVIHSRGAIWMKFKSDDDNVGEGFMASY 1899          

HSP 12 Score: 73.559 bits (179), Expect = 5.628e-12
Identity = 62/243 (25.51%), Postives = 113/243 (46.50%), Query Frame = 2
Query: 10481 TCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIP--PSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS-GVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVS---YGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            +CN    A SGR+      +   Y HN  C   + T   +L     F  F++E S+ C +D++Q   G     Q ++ + CG+ +P   + V++ +++ + F +D S   +G+D+T+  + +P  +CGG +  ++ G + SPG   NY ++ +C W +   +   IK  F  +Q      LE     N D+V +     G +  KYC          +P+    + + S   G   GF++ +S
Sbjct:  508 SCNGMLSAQSGRLRYPP--EGTGYEHNAQCAWVIRT-NESLVVNVTFNSFDVEDSTECRFDWLQINDGRSAAAQ-IIGRYCGNHLPHGGNIVSSGNQLYLWFRSDNSTAKEGFDLTWN-SMEP--QCGGRLNFETHGTLASPGSPGNYPKNRDCRWQLVAPTTKRIKLTFFSLQ------LEQHANCNFDYVLIKDSISGRELAKYC-TTGAPAPLLLPTHLAEIHFHSDAEGSDTGFQLHYS 736          

HSP 13 Score: 68.5514 bits (166), Expect = 1.477e-10
Identity = 105/497 (21.13%), Postives = 198/497 (39.84%), Query Frame = 2
Query: 9743 GYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLK--HENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFK----QKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDY------IQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSS--SFTVEYKSLTGGVGAGFRISW 11188
            G M    GT+G  +S +     +Y NNL C W I      A+++    N+I LE       C  D +T+ +  +S   V +  CG      IT+  + +++ F +D +    GF+ T+  V +      T  N   ++ESP YP N P   R   + +  ++   I   + DL + S  +C+ D     D +       ++ K C +    +++  SS +  ++++      + +S + + F++ +   +C +T       IV+   F      ++ + N  C        PN R  F   +  L   +   Y        +   + E  E Q         S PP+ ++N   +++         + G+ +T          CG      SG  TSP +  +Y  + EC W ++    + +      M L  + S       N D+++V   +++ +  G    +E   +  S  +  +++KS    VG GF  S+
Sbjct: 1438 GCMEELRGTFGFFQSPNYPK--MYPNNLECYWLITVEQDSAIELTI--NNIDLEDSPN---CTKDALTVSNHKNSVE-VHERHCGSTTKLVITSSGHRLHVRFISDNSHNGLGFEATYRTVKATCGGKLTARN--GVIESPNYPLNYPAHSRCEWQ-VEVSQHHQIVFEMADLNLESGYDCNWDYLEAYDLTEDDTEGERLFKVCGDETEDDKLLSSSSNMAVVRFI-----SDDSVSKKGFRLHFH-ESCGQT------IIVDETMFDYIQMSRQAARNESCLWVFQAVEPNKRIIFTPTHVKLREDANQQYPTEGDCLNVGVKIYEGTEPQGTPRLKFCRSHPPALISNGQALTVSVPLQLVEEFQGHYMTM------DTSCGSIYNALSGKFTSPYYPASYPPNIECLWLLEASMGNSLSLTLESMDLEKSESC------NRDYLEVREESESGQLIGVYCGNEVPGVIHSRGAIWMKFKSDDDNVGEGFMASY 1899          

HSP 14 Score: 63.929 bits (154), Expect = 4.583e-9
Identity = 78/285 (27.37%), Postives = 115/285 (40.35%), Query Frame = 2
Query: 2735 SHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF-DCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSG----LITNPTLE---KLSNSFTCFYSIKVPQFKKI-LINITV--SESDGSC 3526
            S C +   A    K  I FL  D   +S C +D +++ SG   +  +   R+C G  NE + L S  + + II +F S+      GFRA V V  +C     L       Y       S ++    Y+ +  C        D  I   F  FH++    C  DY+EL     T      RFCG N   +  T  H L +RFV+DN V+  GF +    + R     E   S+ G     I +P         N  +CF+ IK     ++  +N  +     +GSC
Sbjct: 3155 SDCYWNLTAPAGYKFNIKFLFIDFEANSNCAYDGVEVFSGPIPDERYRWGRFC-GRINEDLPLISIPQERGIIHSF-SDDRDPSRGFRALVRVMPNCDEKISLNGSSRYVY-------SKFNNAGGYQNDLDCQIVFRVNPDQQISVEFSNFHVQDTDGCRSDYVELRDGGGTFADIIGRFCGQNQPPTLRTTRHTLYMRFVTDNKVTDTGFQVTINAIPRLCGSSEITLSADGTKEVTINSPARTPGGNYPNGVSCFWKIKGDSLLRVQFVNFDLHGPNQNGSC 3430          

HSP 15 Score: 59.6918 bits (143), Expect = 7.094e-8
Identity = 60/226 (26.55%), Postives = 97/226 (42.92%), Query Frame = 2
Query: 8390 NTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSP--PFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSEL---CGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQ 9052
            + DC  +I AP N  + L    L    + DC  ++L     E FD      +++C    +     S + N +RL   +   ++        + +     C G  +NTEG   +P YP    +N  C W + VP    V LTF++ F+L   S  TCH D L+I++ +A     E+   CG   P     S  +Q+ + F    N++  G+  ++     GVY   Q
Sbjct: 3531 SADCNIIIRAPPNYTLSLYYTELIFGTY-DCEMENL-----EVFDRTNRSLQRVCSFVDMGKSLFS-NANELRLQMKTGSYLTSLDLTYLASPVEKGPGCGGQFYNTEGIFSNPFYPNNVRNNSECQWIVRVPSNNVVFLTFEV-FNL--GSKTTCHTDYLQILEQDATGEEREMRRFCGEDNPKY-YKSRRSQVLVRFHKTVNYDGIGWVIRF----AGVYSDHQ 3741          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Fly
Match: CG42255 (gene:FBgn0259140 transcript:FBtr0332131)

HSP 1 Score: 269.626 bits (688), Expect = 2.612e-71
Identity = 211/770 (27.40%), Postives = 336/770 (43.64%), Query Frame = 2
Query:  182 NGNIIFQTASSKSISFHTQN-GGQIRLNDIDL-SALSDEXXXXXXXXXXXXDLKKCNC-----ELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKE----------KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGT-IHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICG-HGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKT------CIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCG----PNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP-------------CIWTIISSNDQFLQIIPINLQL--LGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAAL-----KTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQS---NCSDSDYLQINFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDS-RSDVNSTRFQFRWKKAISQEPCGATIT 2329
            N N++ + A  +++S         + +ND+D+ + L    R I +      +  K +        +  K+    R+I S   S   S      L  +  +++            L  ++C +NPC NG  C D Y  F+C CP  ++G  C +DVNEC  ++GT + GC N  +C NT GS+RCVC   ++G  C +  N+C    + ++CG HGTC       N   + C+CD GW+      T      C+ D+DEC     PC       C+N PG  RC  CP G+ G+G  C DI+ECA+    G    P   C N  G+++C +C  G           ++    N G C   A C    +  +  +CTC  G  G G G +GC   S+       R    +  C+N GTC ++  G TC C PG+ G  C +  ++ C  +PCLNGG C  L    Y+C C   ++G  C ++   CG T                +  PS  LH+P             C + I ++ +  L +     QL    DC+ +++QLH+ +    ++ LIG++C   +  P    T GS++  +  +       N  Q  GF +        I N     C   +  +T    G+ +SP +P + +  ++C  +  A +G  +R+ L+   + LG  ++   NCS  D L +   DR++ + AC            N   + FH+D+ RSD   + FQ  ++       CG   T
Sbjct:   39 NDNLLLEPAWDRNVSLRLMGESATVTINDVDMMTVLRRRQRIIADRQAARREPLKVDAVRDMFHDVELKMTRIQRRIFSARNSTKRSGLNQRILRRQLQRVERVKGILQTLAGNLARNECLSNPCKNGGTCHDAYKGFQCECPAGWQGDSCEDDVNECFTLAGTDLDGCLNNGQCINTPGSYRCVCRNGFTGTHCRLRHNTCLFGGSRELCGEHGTCI---QAANSAGYVCICDQGWTWADANVTSASPSACVRDVDECEPRVNPCHDE----CINLPGSFRCGACPTGYTGDGRFCRDIDECASEDNGGCSLQPRVTCTNTEGSHRCGRCPAGWTGDGRTCTASDSNSCNNEGICHPLAKC---EYVSDMVVCTCPLGSFGHGYGADGCSADSS-------RLPCDQHPCQNNGTCVQNGRGTTCICQPGYSGVVCNS--SDACHPSPCLNGGTCRLLPDAKYQCVCPRGYTGTTCSHQRFFCGVT----------------IRGPSGQLHYPPNTADGDYQADERCPFIIRTNRNMVLNLTFTQFQLEDSADCTADFLQLHDGNSL--SSRLIGRFC--GSRLPM---TNGSVITTQEQVFFWFRSDNQTQGKGFHV--------IWNSLPFSCGE-TINLTSTQTGVLRSPGYPGQARPELDCRWQLTAPFG--YRLLLRFYDISLGSSEASAGNCSQ-DSLIVYDSDRQL-LRACQSIQPPPVYSSSNSLRLDFHTDAIRSD---SSFQMHYEVVPGHPGCGGVYT 750          

HSP 2 Score: 212.616 bits (540), Expect = 4.563e-54
Identity = 458/2209 (20.73%), Postives = 857/2209 (38.80%), Query Frame = 2
Query: 3695 EFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKF-VTAKKEINIVCSEQITKMHVFEEQSVHVIFQ--NLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQ-------IDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANIDCQWNFQTIPGFSVKLKFDIIEMES-SINC--SEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF--------YPHNLRCSWNLKVKESMSIHLKILDFE-TEESLCRYDYVEI--FSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCS--SDNSLTIIEGIGNNSSVKAV-LCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYN-YKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY-GVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLI-LSAEGYRYPGFLIRWNPPVDENFKK------IGDCEYIIKATNQTQI-LTSPNYPNFDITRRFCTWTILTD-RTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPP----PTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDF-EELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGK-TNSIFTIGNVLTILFKNM--DDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPL--NYPPISSCIWQISGYSYSNIRLTFMDRDL--DENCSKSN-LTVIPVKESENAVIWSNCNSST---WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRI---------IVKVKKLKMNQGCFRI-RARGVGYRSVLLYIICASNLENFEID-----------TKSSMIEVFG------SGATISFSYNSDQPSLCGSNIYPNNNESGVITIEN-VNISLCQYNIHNYPEDEGTLSM----FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGY-IKSPGYPEKYPD---NTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLER---TSLHTCHYDSLRIIDSNAVT----LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEI---VSANVALINYGSITCEYLIPGWENHLQVVYI------YPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPN--FPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD---AIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGY--MNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPD 9964
            E  + +++  +   CG    S+MG I SP+          C W+I    G R+ +++        ++ ++C+ +  +     TA   I I C+  I K        V V +   + A     F L Y  +C   +    G IE+ N    Y     C W + +  G K  +Q       ++KF    L +    S V + D      +  C N  L    T  N  + +   +D S      RA      EY+  GC E               G  +S   P S+ ++DC W      G  ++L    +  E+  I C  +E  +  +  +       +F++C+  ++ ++    S  +   ++F S++ P+   + F+ ++     SC   +S S G++ +P + N         Y  N+ C W ++V     I      F  T+   C   +VE+    P N ++  L+  CG+ +  I+        ++ ++F++     + G    YFE  CGG           LS    ++ +  D  C W +   TS  G ++       E     P C+  S N    ++ + ++  V    +C   P + I+   +     ++  +     +A +    ++CGG+     G  +SP YP+S   +++CV+ IR  PG++++++ E      +  +   DF++IR      SS+ G    L   +N        +  +WI+ RS+ G+     +F  ++   +N E  S   G +  P    V N+D   TW +F +  +     F+++  G            LI++D  YD      +  +    FT    ++ L         F ++W   +D N          G C   +  ++   I L+SP YP+       C WTI +   +  +    +  DLE    C  +  +++   S   +  +   +   K   +       +       +++ +++D      GF+   + +C  +    + G +  +   N   E      +     ++  +N    ++PP       G   +G  +  ++ +  T  G+ +        T+ S   +      S  +    + + Y + +E C G  +L + Q      M+    ++     EC W   +PPG  + +DF E+  +S   C++  + FFDG+T   + +     C K  N++ T GN+L + +++   +    FRL + + +CGG      G+I+S NYP    YP  S C + I     + IRL   D  L  D N + S+ L ++  ++    ++  +  + T   + + T  +T+R +   N V   +GFK++Y      C  + +    ++     P+++ W   C  +I+V   +R+         I  VK+   N+   +I R   + + S        S +  F ID           T + M+ V        S   +   Y+S +P++C  NI   +  +G I+I++ + +      I     D  TL+     ++    G P   V F   I N    PV+      N  N   S  T    V  +    + V +  +R    Y+   CGG L  + G  I+SP       D     +C W +      +++  +    L    D  Y  +F   +E        ++C    + N TL   R    + +HS+  +++    I   +     + N I  +   S       K Y  + +  W     +G  + L F     LER    S   C  D L +   +  T     ++ LCG    +N I     +M ++F T+ N   +GF  Q    C  V  L   EI    S + A        C Y     +NH  VV +      + ++   R +    +    D NG    G+   G+   +  +  +  +++ Y +    L  + F  +Y   + ++   ++   + L+ P     S Y HN    W   AP  +   I  +  D+E S + C +D ++       S +    + CGN+TN    ++++N  ++   +D S+  ++ GF+A +  TP     C  +  ++  V    V++   ++       +LLC +Q +AP  +  ++  E   + L        C Y  + I+D  D
Sbjct: 1171 EKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLRS------NDNRICSGQLTLYDGPTTASNPIVIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFMLNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRA-GGRKNHLQLIFSHLSVEKFSSICLND--YVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNR-LLLRFKSDSSVELQGFRA------EYKRIGCGEHL---------RESGGRFESPNAPFSV-DMDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCH--EETQTQTFTSPGNELVIRFVSSSAPS--RKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIF-LEKTCGEDSPMIRIVHG---RKLRVRFKSQ--AGTWGRFIMYFERQCGGR----------LSTGEGYLQSRLDEECSWLV---TSPEGSKLSLIINQLEC----PKCNAVSQNCSEGLQLLNDDDQVLLYQMCRDHPANLIVPANN-----VRILTHGIRLQAQFSTFENSCGGNITSASGSLSSPNYPDSYPANIECVWSIRTRPGNALEITFEAMDIVRS-EHCNDDFLEIR------SSVQGPLLALYCDKNLPETPLVVHSELWIKFRSRPGNTAGGFRF--RWTYVHNNEINSGINGTIEPPPPLFVSNEDQPFTWRLFTDFKKVFVLQFEEYISG------------LILFDG-YDDNALAVNIPVSPWRFTSSSNVVYLKTVNDALTHFRLKWG-VLDSNLVASNLSLTTGGCTKELTLSHHGDIELSSPGYPHGYAPNLNCEWTIRSQFPSHHIYAHSIIVDLEDYPACSADYLSIQ---SSRDLIKWKNELHACKASQIAPVHGTPY-------LRLQFRSDVSINGTGFRAKLRTSCGSN----MTGIVGTIPQENLFDECAWHIDVRPGRKIDIAINYN--NMPPIAVCEAYGLIYDGVDEHASL-LEHTRFGNQMGIRRTQFRTSGSHAYIKYHIGRSRINGLCLWNLTYREFNE-CNGEIQLNQ-QAPNYTIMSPGYPYLPHPHAECTWLVMAPPGETIAVDFDEQFELSARHCDKENVEFFDGATKLARLL--LRTCRKPQNTVRTTGNLLLVHYQSQLNEPTGGFRLNLSLSTCGGQFSASAGFISSENYPHLGGYPKPSVCEYSILLPKNAFIRLNITDLHLPYDANGTSSDRLEIVDYEDRTQKLMVLDGRTKTSILFTLNTNAATIRFVAVQN-VNNYRGFKIRYERYVGTCSRDINGASGDIVIPPMPQSV-WLRFCRLRISVPKGQRVRLNLLNLSNIRVVKRNDTNRSFMQIGRLESMAHFSFYNDANSLSKIAEFRIDGGYNGSGIIESTDNYMLVVVMTNQLDLSATPLRARYSSSEPTVCPPNI--GDQATGSISIQSLLQVPGYHCTIKFVGTDSATLTFKVEEYLFQTAGGPA--VVFRDDITN---IPVK--AMYANVTNSFVSVVTSAGSVTLL--NSKNVKLRRFRAT--YRRHNCGGRLQAAEGVTIESPDLLTTLNDAYGEVECLWTLSNSNGYVLEGNVT---LTDRCDREYIVIFSGQSE------VGRICRGMAM-NSTL-LERPFSTILYHSESRLAQQSKFILQAW-KSVSSGNAIRIDHRPSPPVTISSKNYLESKQRIWEFVTNDGLSLRLHF-----LERIFIVSSPNCSTDRLTVERYDQTTEEYIEVTSLCGR-QAANDILVPSARMRVIFQTNSNITGDGFSFQVIPSCDSVL-LAGAEIQTLASPSWAAFRGRQFNCSYTFYAHDNHQVVVSVRTRGRPWASYACSRSYFEAYR--RGDGNG---VGEESIGRLCPEFEVKGNGRVRLRYVS---PLSRW-FEMQY---QLIQCGGNYSTSFTLRPPQNEDSSVYAHNTLCEWRITAPPQHAVVIEFKYFDMESSRN-CGFDSLTIYRGHVVSEEQRTGLLCGNVTNPETIIVNSNEALIVLTTDSSN--SYRGFLASVRFTP----NCNEHVALDLEVPRMSVMRQYVVN----ISESLLCIFQASAPPDY--RISLEVRKLQLADDVVCRTCSY--LEIHDSKD 3216          

HSP 3 Score: 154.066 bits (388), Expect = 2.188e-36
Identity = 309/1458 (21.19%), Postives = 565/1458 (38.75%), Query Frame = 2
Query: 2312 CGATITMNPNAIIESPAIPAD----VEAFCTWKIKQTNSSRLIRLKGT-FENWFDGDCSVQLSVFEI--TTSGRIQNHFITCQTR-EMLSENHLKVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAE-TRKIAISFLDFDINDDSE----CKFDFIKISGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF----DCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCGNHAKS--GPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTS---------SNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYP-LFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTA-KKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDL-PPLQNGQCYS---FVRISD-RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN----IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKV---KESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNC-SSDNSLTIIEGIGNNSSVKAVLC----TKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPN---SVNM-----DLDCVYVIRNSPGSSIDLSIEEFSREN----AISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQ-DTEITWTVFAESSEKLQFTFDQFSVGR-RLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSF 6460
            CG TI   P+  +  P   AD     +  C + I+ TN + ++ L  T F+     DC+          + S R+   F  C +R  M + + +  + + + +F+         F +   S  ++CG ++N+    T   +S  YP        C +Q  A    ++ + F D  +         C  D + +  S+   L  R C   +   +  +SN     + + F +++  + + F+    V      CGG +  +   I GY               +E   VC + I     T +  V D+  L    +C Y  +E+     T     +R CG+H +S   P ++   VI    + ++SG   + + + +   + C  +F ++SG+I+ P       +  TC Y++  P    + + IT    D S      LG A            S  +V  +  Q+  I  S         SN A++ +    + + G     + Y+ +  +CG       G +  P    + A   T+C+W I   PG++   KI+    G      + ++     K V +    +  V    +  ++      +H  +  L     +F +     C    T+  G I+S N    Y     C W L +  G +I + +  F L     +  C++    +R  D  S+ L+ + CGN++ +R  +  N  + ++  +D S         +G +L +Q  G              S+  G I S   P+ +A     + C W      G  V L     ++ S+ N      L  ++      N +   CN      +  +QS+ +   +++   +D   G   F   Y+ TN  C   + G +G I++PN+P  YP    C W+++    K  + +    L  E   S+C  DYV +   +++  +  QHLC    N      +++ N +L++F++D +V  +GF+A+Y     G  +  ES     SPN P      D  C W + A+     +R+  + + FE  +    C  +++SL++    G NSSV         T++       N   ++ +  S      FKA++    ++CGG      G+ T+P + N   S N+     +++CV+ +  + G  I    E+F+  +    ++S++    ++  N         G    +  I    +  K      +R +SQ G +   I +           F    G   S   G++ ++ D E +W V +    KL    +Q    +    +  C+ G  ++ D   D +V       D      P  LI+ A   R     IR            G        T+ +  L+SPNYP+       C W+I T    AL+I   + D+  S  C  ++F    +  + P+ + 
Sbjct:  503 CGVTI-RGPSGQLHYPPNTADGDYQADERCPFIIR-TNRNMVLNLTFTQFQLEDSADCTADFLQLHDGNSLSSRLIGRF--CGSRLPMTNGSVITTQEQVFFWFRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQTGVLRSPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVYDSDRQLL--RACQSIQPPPVYSSSN----SLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISGY-------------MNFE---VCLYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGNVILVRYEYALSGV-RLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRIT----DLS------LGTAN------NENDTSYLDVYLSADQKRHIVKSTDNLILLSHSNRASLVF----HGSGGGRGMRLEYNFVPNQCG-------GFLNEPGRRYVTAVRGTFCQWFI-DFPGRK---KISIHTLGPTPSISIYDNSTSPGKLVNSYSGSVGDVFDGDLLTIN------LHTNWPRLEIYSIQFDIVQQDSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNV-LHLKFKSDDSME------EKGFLLSWQQMGA-------GCGGKLSSSMGTIHS---PHLLAGNRGILACDWQIIVAEGSRVSL-----QLRSNDNRICSGQLTLYDGPTTASNPIVIRCNGT---IAKPLQSTGNRVLVRYDVGHDAPDGT-DFMLNYQ-TN--CRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLVDMLDDQTLSEQHLC---TNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEYKRIGCGEHL-RESGGRFESPNAPFSV---DMDCVWIITASEGN-QIRLLLHEVYFE--APQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRI---VHGRKLR----VRFKSQAGTWGRFIMY-----------FERQCGGRLSTGEGYLQSRLDEECSWLVTSPEGSKLSLIINQLECPKCNAVSQNCSEGLQLLND---DDQVLLYQMCRDH-----PANLIVPANNVRILTHGIRLQAQFSTFENSCGG-----NITSASGSLSSPNYPDSYPANIECVWSIRTRPGNALEITFEAMDIVRSEHCN-DDFLEIRSSVQGPLLAL 1825          

HSP 4 Score: 153.295 bits (386), Expect = 4.315e-36
Identity = 265/1173 (22.59%), Postives = 468/1173 (39.90%), Query Frame = 2
Query: 6683 NKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKI-----LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVI-----SRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKN--MDDFSYFRLKVKI----GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYSTVRIIFKTNTVTTR-----KGFKLKYFFE---DFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLL-------YIICASNLENFEIDTKSSMI-EVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPEDEG--------TLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLD---CNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNL---EGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLI--PGWENHLQVVYIY---PNFFGCRYHDNQIQID-LEDQNGNYLPGQRIC-GKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLH---DENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCN---YDFVXXXXXXXXXXDAIF--CGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVG---TYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDD 10003
            ++ C FI+R++  N +LNLT        +  C   FL++     L+  +    CGS +P     +IT    +    +    ++++  GF ++++     CG    LT  Q + ++          P  ++C+W  T+P G R+ + F ++ +     S   C++  L  +D      +    Q+   +   +++  N L + F    +   S F++  ++      CGG+    +G I+       Y     C++ I     + ++L      L ++  C    + +   + ++  ++   C S     + E     II   N +  R      G +L   F+     +C G ++     +++ NYP      + CT+ +   +   + +++  L +             Y  V L        +    NL       ++S++    G G  +   YN   P+ CG  +    NE G   +  V  + CQ+ I ++P  +         T S+ + DN+  P        K+ N     V D   G           T+    N+   P  E+    + +    +   CGG  T  FGYIKSP +P+ Y ++  CEW++ AP    I+L +    LE       C  D L IR  +   SP   + CG N I +   SF  N + L F SD S+ + GF++ +  +     C G + ++ G+I SP+        L C+W I V EG +VSL  +   D    S     YD      SN + +     G I  + P+ S+ N++ + +  D  H+      F   Y++ C    +  QG I + N          CE+ I   G +NHLQ+++ +     F     +D    +D L+DQ    L  Q +C     E IT + ++ +    +  +  L+   FRA Y      E+++     +     ++PN  +P+  + +  WI  A  G    + L  V  E     C          + +  NSS  +F  C   T    F    N L++RF S  S   +   F A     P     CGGY++A+ G   T G     D  N   Y +N+ C W +    G+ ++  FE  +++  G   V    +  +T  + PD+    ++  CG+D
Sbjct:  528 DERCPFIIRTN-RNMVLNLTFTQFQLEDSADCTADFLQLHDGNSLSSRLIGRFCGSRLPMTNGSVITTQEQVF--FWFRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQ-TGVLRSPGYPGQARPE-LDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVYDSDRQLLRAC--QSI--QPPPVYSSSNSLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISG------YMNFEVCLYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGS-----HEESELEPIISIGNVILVRYEYALSGVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRITDLSLGTAN---NENDTSYLDVYLSADQKRHIVKSTDNLILLSHSNRASLVFHGSGGGRGMRLEYNF-VPNQCGGFL----NEPGRRYVTAVRGTFCQWFI-DFPGRKKISIHTLGPTPSISIYDNSTSP-------GKLVNSYSGSVGDVFDG--------DLLTINLHTNW---PRLEIYSIQFDI---VQQDSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCG-NEIPSRIPSFG-NVLHLKFKSDDSMEEKGFLLSWQQMGAG--CGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLR-SNDNRICSGQLTLYDG-PTTASNPIVIRCN--GTI--AKPLQSTGNRVLVRY--DVGHDAPDGTDFMLNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLVDMLDDQT---LSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQ--GFRAEYKRIGCGEHLR-----ESGGRFESPN--APFSVDMDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVS--SSAPSRKYFKASFVQVPA---SCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVS---FVELTKLE-PDNKEIFLEKTCGED 1617          

HSP 5 Score: 128.257 bits (321), Expect = 1.520e-28
Identity = 203/913 (22.23%), Postives = 351/913 (38.44%), Query Frame = 2
Query: 8330 LLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHL----EHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSL---HTCHYDSLRIID--SNAVTLLSELCGNIPPSN--PINSSLNQMSLVFSTDFNHNLEG------FHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQ-IDL---EDQNGNYLPGQRICGKSREKITIMHSKSIKIVY----TARNFHLKNYNFR----ARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVN--CSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLER-SSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIK 10972
            L +   G ++SPGYP +     DC W + AP    + L    + L        +C+ D L +    + D    R    + P    + S   N +RL FH+D   S + F + Y  +     C G+   + G I        Y +   C + I  P G +V L       ++R SL    +CHY  + I D  S    LL  +CG+   S   PI S  N    V    + + L G      F   Y  +C G ++   G I + N     +  +TC Y + G  +    + I     G   ++N    +D+    DQ       + I   +   I + HS    +V+      R   L+ YNF       +L++   +  +  +  +     +FP       ++  +   P   I+  +     +  SY G   D              +F G+L  I+       + I   Q DI   ++                 CGG   A    +G IKS +   N  Y  + +C+W + AP+GH ++++  N   +LE      GC  D + I +G   + P+I   CG++    I +  NV++L F +D ++++ GF L++  + +       +++    + SP     +   L    ++I A E   ++     L++RS+ N  CS  Q  + D      N I   C   +  +   S+ ++V+++Y VG   +    TD  F ++Y+   C    +   G I    NF +  Y     C   +         Q  F + ++E+ SS C  DY+  +     +Q      +C +       T  +R+ + F +D S+   G+   Y       I CG  +    G   SP     +    +C W I     + I+
Sbjct:  630 LTSTQTGVLRSPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVY---DSDRQLLRACQSIQPPPVYSSS---NSLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISG------YMNFEVCLYLIEQPRGTQVKLV------IDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGN----VILVRYEYALSGVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRITDLSLGTANNENDTSYLDVYLSADQK------RHIVKSTDNLILLSHSNRASLVFHGSGGGRGMRLE-YNFVPNQCGGFLNEPGRRYVTAVRGTFCQWFIDFPG--RKKISIHTLGPTPSISIYDNSTSPGKLVNSYSGSVGD--------------VFDGDLLTINLHTNWPRLEIYSIQFDIVQQDS-----------------CGGTFTAR---FGYIKSPNWPKN--YGESQMCEWILRAPFGHRIELVVHN--FTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAG--CGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVA-EGSRVS-----LQLRSNDNRICS-GQLTLYDGPTTASNPIVIRCNG-TIAKPLQSTGNRVLVRYDVG--HDAPDGTD--FMLNYQT-NCRVRLEGLQGAI-ETPNFPE-NYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLV-DMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEY-----KRIGCGEHLRESGGRFESP--NAPFSVDMDCVWIITASEGNQIR 1448          

HSP 6 Score: 117.857 bits (294), Expect = 2.158e-25
Identity = 325/1497 (21.71%), Postives = 570/1497 (38.08%), Query Frame = 2
Query: 6641 GSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILAMNINKTL---CGSNIPPDLQPIITNSS-WI-IVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDG----STTFTQKIGGQNFCGKTNSIF--TIGNVLT---ILFKNMD-DFSYFRLKVKIGSCGG---LLHRRQGYIASPNYPLNYPPISSCIWQI-SGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSN----CNSSTWDIYTEYSTVRIIFKTNTVTTRKGF--KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENF----EIDTKSSMIEVFGSGATISFSYNSDQ-PSLCGSNI-YPNNNE-SGVITIE----NVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCS-NVYFVSKIGNGLREPVEDFGTGCNERNRMY---------SFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPE--KYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLD-CNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSF--HRNRMRLSFHSDFSVSK-NGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLR-CNWTIHVPEGYKVSLTF--------KLPFDLERTSLHTCHYDSLRII----DSNAVTLLSE--LCGNIPPSNPINSSLNQMSLVFSTD-FNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYL--IPGWENHLQVV-------------YIYPNFFG--CRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHL--KNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGN--LTNISPFMIDTNVLIVR-FQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITI--YDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE------LIAANETDHITITVKDL-KIRSSVNCS---LDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSI-PPSFVTNSSRVSMIFVTDQSINYDGY 10813
            GSL +  YP+    N  C + +R+   N + +   A+D+    +  C + FL+I +      L   C  N+P    P++ +S  WI   +  GN +   R   F+  Y   +E   G              +N       P F+  +     P   R+  DF+++ + +     S L  FDG    +      +    F   +N ++  T+ + LT   + +  +D +     L +  G C     L H     ++SP YP  Y P  +C W I S +   +I    +  DL++   CS   L++   + S + + W N    C +S          +R+ F+++      GF  KL+      M G   + P+  L           F  C W I+V   ++I + +    M        A G+ Y  V  +   AS LE+     ++  + +     GS A I +     +   LC  N+ Y   NE +G I +     N  I    Y    +P  E T  +       I    +  F     +  +E VE F  G  +  R+          +  T G ++   +Q         +R+ +    S CGG  + S G+I S  YP    YP  + CE+ I+ P+N  I+L I  LHL +  +  + D L I   E+      +KL  L+  +  ++ F  + N   + F +  +V+   GF I Y       TC+  I    G I  P  P P    LR C   I VP+G +V L              D  R+ +     +S+       D+N+++ ++E  + G    S  I S+ N M +V  T+  + +     A+Y S         +  +   N+     GSI+ + L  +PG+   ++ V             Y++    G    + D+   I ++    N          S   +T+++SK++K+    R F    + +N   R    E V + S    P +L T N     +      W  +   GY+   N+   D       C+ +++            IF G   +  I   M   + L+ R F + + H E+     +         +  G   NA    +     + + +    E+     W+     G ++++ F      +   +    C  D +T+  YD        + +LCG    + I   S  M +IF T+ NI   GF  +F  +PS + ++       Q L SP +         F G          A++   + ++V+   +  +S  CS    + +   D +   E  I + C         +  + +V ++Y V P+        R F++ Y+L  C     + S  +   +N     Y+HN +C   +  P P       FKYF++E S  C +D +    G    ++     +CG+   P + + NS+   ++  TD S +Y G+
Sbjct: 1763 GSLSSPNYPDSYPANIECVWSIRTRPGNALEITFEAMDIV--RSEHCNDDFLEIRSSVQGPLLALYCDKNLPE--TPLVVHSELWIKFRSRPGNTAGGFR---FRWTYVHNNEINSG--------------INGTIEPPPPLFVSNE---DQPFTWRLFTDFKKVFVLQFEEYISGLILFDGYDDNALAVNIPVSPWRFTSSSNVVYLKTVNDALTHFRLKWGVLDSNLVASNLSLTTGGCTKELTLSHHGDIELSSPGYPHGYAPNLNCEWTIRSQFPSHHIYAHSIIVDLEDYPACSADYLSI---QSSRDLIKWKNELHACKASQIAPVHGTPYLRLQFRSDVSINGTGFRAKLRTSCGSNMTGIVGTIPQENL-----------FDECAWHIDVRPGRKIDIAINYNNMPPIAV-CEAYGLIYDGVDEH---ASLLEHTRFGNQMGIRRTQFRTSGSHAYIKYHIGRSRINGLCLWNLTYREFNECNGEIQLNQQAPNYTIMSPGYPYLPHPHAECTWLVMAPPGETIAVDFDEQFELSARHCDKENVE-FFDGATKLARLLLRTCRKPQNTVRTTGNLLLVHYQSQLNEPTGGFRLNL--SLSTCGGQFSASAGFISSENYPHLGGYPKPSVCEYSILLPKNAFIRLNITDLHLPYDANGTSSDRLEIVDYEDRT----QKLMVLDGRTKTSILFTLNTNAATIRFVAVQNVNNYRGFKIRYERY--VGTCSRDINGASGDIVIP--PMPQSVWLRFCRLRISVPKGQRVRLNLLNLSNIRVVKRNDTNRSFMQIGRLESMAHFSFYNDANSLSKIAEFRIDGGYNGSGIIESTDNYMLVVVMTNQLDLSATPLRARYSS--------SEPTVCPPNIGDQATGSISIQSLLQVPGYHCTIKFVGTDSATLTFKVEEYLFQTAGGPAVVFRDDITNIPVKAMYANVTNSFVSVVTSAGSVTLLNSKNVKL----RRFRATYRRHNCGGRLQAAEGVTIES----PDLLTTLN---DAYGEVECLWTLSNSNGYVLEGNVTLTD------RCDREYI-----------VIFSGQSEVGRICRGMAMNSTLLERPFSTILYHSESRLAQQSKFILQAWKSVSSG---NAIRIDHRPSPPVTISSKNYLESKQRI-WEFVTNDGLSLRLHFLERIFIVSSPN----CSTDRLTVERYDQTTEEYIEVTSLCGRQAANDILVPSARMRVIFQTNSNITGDGF--SFQVIPSCDSVLLAGAEI-QTLASPSWA-------AFRGRQFNCSYTFYAHDNHQVVVSVRTRGRPWASYACSRSYFEAYRRGDGNGVGEESIGRLCPEFE-----VKGNGRVRLRY-VSPLS-------RWFEMQYQLIQCG-GNYSTSFTLRPPQNEDSSVYAHNTLCEWRITAP-PQHAVVIEFKYFDMESSRNCGFDSLTIYRGHVVSEEQRTGLLCGNVTNPETIIVNSNEALIVLTTDSSNSYRGF 3137          

HSP 7 Score: 107.842 bits (268), Expect = 2.172e-22
Identity = 177/821 (21.56%), Postives = 323/821 (39.34%), Query Frame = 2
Query: 6641 GSLQNVEYPNKIFENKNCTFILRS---HFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIE-------CKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFK---NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQI-SGYSYSNIRLTFMDRDLDE---NCSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKL---------KMNQGCFRIRARGVGYRSVLLYIIC--ASNLENFEIDTKSSMIEVFGSGATISFSYNS---DQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPED-EGTLSMFMSDNTGI-PCSNVYFVSKIGNGLREPVED-----------FGTGCNERNRMYSFSTLGKV-VNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHL----FIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPI 8938
            G +++  +P    E++ C +ILR+   H +  +++   L+    + G C   +L+I   +   +      CG+ IP  + P   N    +++L           GF + + +    CGG+           +  +   +H +PH +        C W      G+R+ +          IC+   L  +DG TT +  I  +        + + GN + + +    +  D + F L  +  +C   L   QG I +PN+P NYPP   C W I +G   ++++L F    +++    C    ++++ + + +       C N     I T  + + + FK+++    +GF+ +Y  +   CG    +      S N P ++   + C W I      +I + + ++         +  +    + A      SV+L+  C   +  + F       +I    S A     + +     P+ CG  I   +  SGV+T    +      N+ NY  + E   ++ +++  GI P    + ++  GN     VE                C E + M       K+ V F  Q G       +   I Y   +CGG L+   GY++S         + +C WL+ +PE   + L I  L       CN         ++   + D     ++C  +P +   L    N +R+  H        G  ++  F    ++C G I +  GS+ SPNYP  YP+N+ C W+I    G  + +TF+   D+ R+    C+ D L I  S    LL+  C    P  P+
Sbjct: 1075 GYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTG-CWTDWLEIRNGDSESSPLIGRYCGNEIPSRI-PSFGN----VLHLKFKSDDSMEEKGFLLSWQQMGAGCGGK-----------LSSSMGTIH-SPHLLAGNRGILACDWQIIVAEGSRVSLQLRS--NDNRICSGQ-LTLYDGPTTASNPIVIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFMLNYQT-NCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEY--KRIGCGEHLRESGGRFESPNAPFSVD--MDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYI---SASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRIVHGRKLRVRFKSQAG------TWGRFIMYFERQCGGRLSTGEGYLQS-------RLDEECSWLVTSPEGSKLSLIINQLECPK---CNAVSQNCSEGLQLLNDDDQVLLYQMCRDHPAN---LIVPANNVRILTH--------GIRLQAQFSTFENSCGGNITSASGSLSSPNYPDSYPANIECVWSIRTRPGNALEITFE-AMDIVRS--EHCNDDFLEIRSSVQGPLLALYCDKNLPETPL 1836          

HSP 8 Score: 101.679 bits (252), Expect = 1.547e-20
Identity = 271/1282 (21.14%), Postives = 481/1282 (37.52%), Query Frame = 2
Query: 7346 IASPNYPLNYPPISS---------CIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNS----STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEY---SDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGS-----NIYPNNNESGVITIEN-------VNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKI----GNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSR---CGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHL---EHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLR---CNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNH--------NLEGFHAQYKSI----CGGVYDLRQGEIVSANVALINYG-SITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQID-LEDQNGNY----LPGQRICGKSREKITIMHSKSIKIVYTARNFHLK-----NYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLT---WIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQI-AAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRS-SVNC-SLDQFIIQDASLKHENKIEKF--CESLSTERVFISSHDKVIIQYQVGPMENINSATDRR-FQISYELY--TCNRTEKAYSGRIV--NVENFKQKK----YSHNLICNLTL-ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSW 10939
            I  P+  L+YPP ++         C + I       + LTF    L++  +C+   L +       + +I   C S    +   + T    V   F+++  T  KGF + +    F CG      S     L S  YP      L C W++      R++++   + +  G     A      S+++Y    S+ +            V+ S  ++   +++D      S      + P +   G +  E+       +N  +C Y I    +  GT    + D   +  S      KI    G     P+     G +E + +    ++G V+   +    E  +S  R+   +  +    C G    + G I +P YP  Y D+  C + +  P +  +++ I  L L    +  D +Y  +++   ++      R +  +    N  L  H NR  L FH   S    G  +EYNF+   + C G + N  G        + Y + +R   C W I  P   K+S+    P              S+ I D++             P   +NS    +  VF  D            LE +  Q+  +    CGG +  R G I S N    NYG S  CE+++     H   + ++       Y       D LE +NG+     L G R CG              +I       HLK     +   +   L  + +      K    + T + P     N  +    W      G   S+ LRS D       C+     +   ++ S+  +   N T   P     N ++VR+  D+ H +   G    +N      +   G         G I++ +   N  Y     C+W I A    + +++IF +  +S+E  S +  C  D++++ D  D      Q LC +D ++ ITT  N + L F +D +++  GF+  +  +    HL ++   F    ESP  P +   D  +   +I A+E + I + + ++   +  + C   +  +   A   + + +  F  C   +  + F S  ++++I++        +SA  R+ F+ S+     +C     A SG +      N +  K    Y+ N+ C  T+ +T    +R   +F+ FNL  S  C+  +++    EP  ++  L K CG   P   + +  ++ + F + Q+  + G  I Y        +CGG +    G + S           ECSW
Sbjct:  507 IRGPSGQLHYPPNTADGDYQADERCPFIIRTNRNMVLNLTFTQFQLEDSADCTADFLQLHDGNSLSSRLIGRFCGSRLPMTNGSVITTQEQVFFWFRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQTGVLRSPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISL--GSSEASAGNCSQDSLIVY---DSDRQLLRACQSIQPPPVYSSSNSLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISGYMNFEVCLYLIE---QPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGNVILVRY----EYALSGVRLSKSFDLTYTRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRITDLSLGTANNENDTSYLDVYLSADQK------RHI--VKSTDNLILLSHSNRASLVFHG--SGGGRGMRLEYNFV--PNQCGGFL-NEPG--------RRYVTAVRGTFCQWFIDFPGRKKISIHTLGP------------TPSISIYDNST-----------SPGKLVNSYSGSVGDVFDGDLLTINLHTNWPRLEIYSIQFDIVQQDSCGGTFTARFGYIKSPNWPK-NYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIG-RYCGNEIPS---------RIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLRSNDNRI----CSGQLTLYDGPTTASNPIVIRCNGTIAKPLQSTGNRVLVRY--DVGH-DAPDGTDFMLNYQTNCRVRLEGLQ-------GAIETPNFPEN--YPPGQDCEWDIRAGGRKNHLQLIFSH--LSVEKFSSI--CLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEYKRIGCGEHLRESGGRF----ESPNAPFSVDMDCVW---IITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQTQTFTSPGNELVIRFVS------SSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRP--HFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRIVHGRKLRVRFKS-QAGTW-GRFIMYFER-----QCGGRLSTGEGYLQS-------RLDEECSW 1672          

HSP 9 Score: 98.5969 bits (244), Expect = 1.524e-19
Identity = 165/766 (21.54%), Postives = 291/766 (37.99%), Query Frame = 2
Query: 5564 FYPNSVNMDLD----CVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF--YTLSEIRNYTYNYKFNDSVWIRL--RSQGGDFT---NHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR-RLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTG--SKNPIFSFIEYVAMVKCGSLNNSEFN-VFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTI-LFKNMDDFSYFRLK---VKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE-----NCSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYSTV-RIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK 7783
            + PN+ + D      C ++IR +    ++L+  +F  E++      DF+ + +G + +S L+GRF    L          +     W R   ++QG  F    N + F     IN  +   +  GVL SP +      + +  W + A    +L   F   S+G      G C++ +LI+YDS+      C S      I  PPV    ++    +    IR +     +++ +           +++   S  Y NF++    C + I   R   + + +    L  S  C Y    + F G  +  P+   I       CGS   SE   +        ++  Y          F L+Y + C  +F N   G +    YP   F++  CT+ L       + + +T L L    N    +     L+ +  + +  S    D   ++++S+   +   G+        G ++ Y+    +CGG            ++    R         C+W F   PG R +I    L  +  I      + +D ST+  + +   ++ G    +F  G++LTI L  N      + ++   V+  SCGG    R GYI SPN+P NY     C W +       I L   +  L+E      C    L +       + +I   C +        +  V  + FK++     KGF L +      CGG+ S     ++S +        L C W+I V    R+ ++++
Sbjct:  516 YPPNTADGDYQADERCPFIIRTNRNMVLNLTFTQFQLEDSAD-CTADFLQLHDGNSLSSRLIGRFCGSRLPMTNGSVITTQEQVFFWFRSDNQTQGKGFHVIWNSLPFSCGETINLTS---TQTGVLRSPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLIVYDSDRQLLRACQS------IQPPPVYSSSNSLRLDFHTDAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRIS-GYMNFEV----CLYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEI-FDGRSTDAPLLRRI-------CGSHEESELEPIISIGNVILVRYEYALSGVRLSKSFDLTYTRVCTGNF-NTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRITDLSLGTANNENDTSYLDVYLSADQKRHIVKST---DNLILLSHSNRASLVFHGSGGGR----GMRLEYNFVPNQCGG-----------FLNEPGRRYVTAVRGTFCQW-FIDFPG-RKKISIHTLGPTPSI------SIYDNSTSPGKLV--NSYSGSVGDVFD-GDLLTINLHTNWPRLEIYSIQFDIVQQDSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQLR 1228          

HSP 10 Score: 85.5001 bits (210), Expect = 1.277e-15
Identity = 266/1247 (21.33%), Postives = 475/1247 (38.09%), Query Frame = 2
Query: 4460 STKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSI----NCSEGPILRAWENEIVD-ENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFT--NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVS----SRGFKAKYFETCGGLRMAMESNQFLLS-PNYPHVYTLPDGICEWNLVANT-SEIGLRIFFYFMGFEGGSNNPN-----CSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNE-TSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCG---SGVIDSAIFTPPVTLIL---SAEGYRYPGFLIRWNPPVDENFKKIG-DCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFD--LESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDP-FPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPT-NGKCVNGFLKILAMNINKTLCGSNIPPD--LQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKD-----EECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVIS--RIICN--ESFLAF-----FDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFS--YFRLK-VKI-GSCGGLLHRRQGYIASPNY--------PLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIW--SNCNSSTWDIYTEYS-TVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLK------MNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNI 7987
            ST+ GV++S  +P      +DC+W      G+ + L+F  I + SS     NCS+  ++      + D +  + +AC  I   +   + SS+++  L F +  D       FQ  YE    +  C    + S G I    Y NF      C + ++      + L I      +SL C Y  +EIF   + D   L+ +CG           S+ N +L+++  ++ +S    S+ F   Y   C G      +N  ++S PNYP  Y   D  C +NL     + + +RI    +G     N+ +      S+D    I++   N                ++S+ +   ++   + G    +  Y    + CGG  +L++       Y  +V     C + I + PG    +SI       +IS       D    P +  +S  G    + +    T N   N   W RL          I+F      +    F + +G + SP +   Y +     W + A    +++     F++     +  C    L I + + ++    G      I S I +    L L   S +     GFL+ W        +++G  C   + ++  T  + SP+    +     C W I+      + +Q+ S D  + S     Y+  T     + NPI        +++C   N +     Q+   N + + Y      P    F L+Y+  C       L+G+++   +P      ++C + +R+      L L    L     +  C+N ++ ++ M  ++TL   ++  +  L+PI T  + +++    + S E    GF+  Y +        E GGR E      S  VDM            +C W  T+  G ++++   E+     +I C   ES L+      ++ S    +    +    +T +  + GN L I F +    S  YF+   V++  SCGG +    G + +P +          NY     C+W +   +   IR  F   +L +  NCS S + +  + E +N  I+    C   +  I   +   +R+ FK+   T   G  + YF  +  CGG  S  E  L S    +       C+W +      ++ + + +L+      ++Q C            VLLY +C  +  N  +   +  I   G      FS   +    CG NI
Sbjct:  632 STQTGVLRSPGYPGQARPELDCRWQLTAPFGYRLLLRFYDISLGSSEASAGNCSQDSLI------VYDSDRQLLRACQSI---QPPPVYSSSNSLRLDFHT--DAIRSDSSFQMHYEVVPGHPGCGGVYTESRGRISG--YMNFEV----CLYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAPLLRRICGSHEESELEPIISIGNVILVRY--EYALSGVRLSKSFDLTYTRVCTG---NFNTNSGIISTPNYPGPY-FDDMTCTYNLTGPLDTAVRMRITDLSLGTANNENDTSYLDVYLSADQKRHIVKSTDN--------------LILLSHSNRASLVFHGSGGGRGMRLEYNFVPNQCGG--FLNE---PGRRYVTAVRGTF-CQWFI-DFPGRK-KISIHTLGPTPSIS-----IYDNSTSPGKLVNSYSGSVGDVFDGDLLTINLHTN---WPRLE------IYSIQFDIVQQDSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTDWLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSW--------QQMGAGCGGKLSSSMGT--IHSPHLLAGNRGILACDWQIIVAEGSRVSLQLRSNDNRICSGQLTLYDGPTT----ASNPI--------VIRC---NGTIAKPLQS-TGNRVLVRYDVGHDAPDGTDFMLNYQTNCRVRLEG-LQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVE--LQGFRAEYKRIGCGEHLRESGGRFESPNAPFS--VDM------------DCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEET---QTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKL-EPDNKEIFLEKTCGEDSPMIRIVHGRKLRVRFKSQAGTW--GRFIMYF--ERQCGGRLSTGEGYLQSRLDEE-------CSWLVTSPEGSKLSLIINQLECPKCNAVSQNCSEGLQLLNDDDQVLLYQMCRDHPANLIVPANNVRILTHGIRLQAQFSTFENS---CGGNI 1758          

HSP 11 Score: 83.9593 bits (206), Expect = 3.320e-15
Identity = 201/893 (22.51%), Postives = 344/893 (38.52%), Query Frame = 2
Query: 3704 YTINYSSLDEE-CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRI-LIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE----INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQ---DCEFPITSSSGRIESK-----NEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQL-LNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYD-----PHESDYSTK------------NGVIQSAQFP-NSIANIDCQWNFQTIPGFS-VKLKFDIIEME--SSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILD--FETEESLCR--YDYVEIFSPIN-NDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE---TCGGLRMAMESNQFLLSPNY------PHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCS-SDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFS--RENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNT---EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDA--KVFCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRW 6196
            Y+I +  + ++ CG    +  G+I SPN+P     +  C W +R+  G RI L+  N         T    D    L+      E    I   C  +I          +H+ F++  S + + F L + Q    C   ++SS G I S      N  +  C W++    GS++ +Q+                     RSN    + C  QL L    T+++ PI             VIR +  I    Q+ G      YD     P  +D+                G I++  FP N     DC+W+ +     + ++L F  + +E  SSI  ++   L     +++D+  + +     +DG   I  +  +   L+F S  D +  ++ F+   E+    C   +  S G  +SPN P  +  ++ C W +   E   I L + +  FE  +  CR     + + +P   N  V L   C +     QT F+S  NE++I+F +    S + FKA + +   +CGG   A  S+  L +P +       +V      I C W  V  T+  G+R  F        +++ NCS S   LT +E       ++      SP   I+ +G  L+V  KS +G       Y      CGG     +G   S        +D +C +++ +  GS + L I +    + NA+S    + + + N  ++        Y +            N+   +R+ + G      I+  A++    N+      S  G L+SP +   Y  + E  W++       L+ TF+   + R   +  CN   L I  S       ++C   + ++ +       I   S  G    GF  RW
Sbjct: 1054 YSIQFDIVQQDSCGGTFTARFGYIKSPNWPKNYGESQMCEWILRAPFGHRIELVVHNFTLEEEYSSTGCWTD---WLEIRNGDSESSPLIGRYCGNEIPSRIPSFGNVLHLKFKSDDSMEEKGFLLSWQQMGAGCGGKLSSSMGTIHSPHLLAGNRGILACDWQIIVAEGSRVSLQL---------------------RSND--NRICSGQLTLYDGPTTASNPI-------------VIRCNGTIAKPLQSTGNRVLVRYDVGHDAPDGTDFMLNYQTNCRVRLEGLQGAIETPNFPENYPPGQDCEWDIRAGGRKNHLQLIFSHLSVEKFSSICLNDYVSLV----DMLDDQTLSEQHLCTNDGLEPIT-TVGNRLLLRFKS--DSSVELQGFRA--EYKRIGCGEHLRESGGRFESPNAP--FSVDMDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVLFRSCHEETQ-TQT-FTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISA--SSGVLTTPGFHNHQDSKNVANYTSNIECVWT-VEVTNGYGIRPHFEQFNL---TDSGNCSVSFVELTKLEPDNKEIFLEKTCGEDSPMIRIV-HGRKLRVRFKSQAGTWGRFIMY--FERQCGGRLSTGEGYLQS-------RLDEECSWLVTSPEGSKLSLIINQLECPKCNAVSQNCSEGLQLLNDDDQV-----LLYQMCRDHPANLIVPANN---VRILTHG------IRLQAQFSTFENSCGGNITSASGSLSSPNYPDSYPANIECVWSIRTRPGNALEITFEAMDIVR---SEHCNDDFLEIRSSVQGPLLALYCDKNLPETPLVVHSELWIKFRSRPGNTAGGFRFRW 1861          

HSP 12 Score: 79.7221 bits (195), Expect = 7.949e-14
Identity = 90/386 (23.32%), Postives = 160/386 (41.45%), Query Frame = 2
Query: 9926 CRYDHITIYDGPDSARPVIQTLCGD----DQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVP-SQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSV----NCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYT----CNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSI-----PPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCY 11029
            C  D + ++DG   +  +I   CG          ITTQ  V +  F +D   Q  GF + + ++P S    I   +  + +L SP YP  +  +L    +L A      + +   D+ + SS     NCS D  I+ D+    + ++ + C+S+    V+ SS + + + +    +      +D  FQ+ YE+      C        GRI    NF+        +C L LI      + +      +L +S +C Y  I+   G   +   +L +ICGS       P   + N   V   +          +D+TY      +  C G    +SG+I++P +   Y++   C++N+    ++ ++ R TD+ LG   +   T Y
Sbjct:  558 CTADFLQLHDGNSLSSRLIGRFCGSRLPMTNGSVITTQEQVFFW-FRSDNQTQGKGFHVIWNSLPFSCGETINLTSTQTGVLRSPGYPGQARPELDCRWQLTAPFGY-RLLLRFYDISLGSSEASAGNCSQDSLIVYDS----DRQLLRACQSIQPPPVY-SSSNSLRLDFHTDAIR-----SDSSFQMHYEVVPGHPGCGGVYTESRGRISGYMNFE--------VC-LYLIEQPRGTQVKLVIDRVSLVQSLSCHYLKIEIFDGRSTDAP-LLRRICGSHEESELEPIISIGNVILVRYEYALSGVRLSKSFDLTY------TRVCTGNFNTNSGIISTPNYPGPYFDDMTCTYNLTGPLDTAVRMRITDLSLGTANNENDTSY 915          

HSP 13 Score: 62.7734 bits (151), Expect = 8.495e-9
Identity = 90/404 (22.28%), Postives = 158/404 (39.11%), Query Frame = 2
Query: 1970 TNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI-NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPA---IPADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSEN--HLKVENEFYIFFKKLKGISTPEFQIS----AEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAE--TRKIAISFLDFDINDDSECKFDFIKISGSNSGHLDQRYCNGNKNELITLNSND-----ETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEI 3130
             +G   SPN+P  Y  NI C    +   G    +E+  + +D+  ++S   + D+L+I + V   +    C++N+      + +   + F S  R    +  F+FRW    + E     I    N  IE P    +  + + F TW++  T+  ++  L+  FE +  G     L +F+      +  +      R   S N  +LK  N+    F+   G+       S        C   + +      E  S  YP  Y+ N +C +   ++  +  I    +  D+ D   C  D++ I  S       R     KNEL    ++       T  + + F+S+ +  GTGFRAK+    CG +      ++   P+ +L    +DE         C W I
Sbjct: 1761 ASGSLSSPNYPDSYPANIECVWSIRTRPGNA--LEITFEAMDI--VRSEHCNDDFLEIRSSVQGPLLALYCDKNLPETPLVVHSELWIKFRS--RPGNTAGGFRFRWTYVHNNE-----INSGINGTIEPPPPLFVSNEDQPF-TWRLF-TDFKKVFVLQ--FEEYISG-----LILFDGYDDNALAVNIPVSPWRFTSSSNVVYLKTVNDALTHFRLKWGVLDSNLVASNLSLTTGGCTKELTLSHHGDIELSSPGYPHGYAPNLNCEWTIRSQFPSHHIYAHSIIVDLEDYPACSADYLSIQSS-------RDLIKWKNELHACKASQIAPVHGTPYLRLQFRSDVSINGTGFRAKLRT-SCGSNM---TGIVGTIPQENL----FDE---------CAWHI 2120          

HSP 14 Score: 62.003 bits (149), Expect = 1.464e-8
Identity = 95/357 (26.61%), Postives = 141/357 (39.50%), Query Frame = 2
Query: 8123 CSNVYFVS---KIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEK--YPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRK--LCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTL--LSELCGNIPPSNPIN-----SSLNQMS--LVFST---DFNHNLEGFHAQYKSICG-GVYDLRQGEIVSANVALINY-----GSITCEYLI 9118
            CS  YF +     GNG+ E  E  G  C E    +     G+V      P     +S +  E+ Y+  +CGG  + SF  ++ P   +   Y  NT CEW I AP    + +  +   +E   +C +D L I Y     S   R   LCG N  + ET+  + N   +   +D S S  GF+    F    +    +            Y      +L C +    P  Y++SL  +     +     TC Y  L I DS  V    L    G    + P N     SS + MS  L+ +T     N + E      +++CG G YDLR  E ++  +   N      GSI C ++I
Sbjct: 2972 CSRSYFEAYRRGDGNGVGE--ESIGRLCPE----FEVKGNGRVRLRYVSP-----LSRW-FEMQYQLIQCGGNYSTSF-TLRPPQNEDSSVYAHNTLCEWRITAPPQHAVVIEFKYFDMESSRNCGFDSLTI-YRGHVVSEEQRTGLLCG-NVTNPETIIVNSNEALIVLTTDSSNSYRGFLASVRFTPNCNEHVALDLEVPRMSVMRQYVVNISESLLCIFQASAPPDYRISLEVRKLQLADDVVCRTCSY--LEIHDSKDVEGQNLGRYYGGTNGNEPSNRTKVFSSFSDMSFKLIATTGQAQKNISFELILQMVRTVCGQGEYDLRLNETITLGMQYDNSTRFYEGSIQCLWII 3311          

HSP 15 Score: 56.9954 bits (136), Expect = 4.583e-7
Identity = 103/448 (22.99%), Postives = 174/448 (38.84%), Query Frame = 2
Query: 1976 GLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITACNQNMYFNKKF-----IVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEAFCTWKI--KQTNSSRLIRLKGTFE----NWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQIS---AEYACGNSVNMDE--MSTYEF---QSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFI---KISGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFD--CGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLES----HPNCAYDYLELIHDN 3232
            G  ++PNFP  Y    +C    +A  G +  ++L    L +    S C + DY  ++ VD     T   Q++  N        + NR ++ F SDS  ++   R +++      +  CG  +        ESP  P  V+  C W I   + N  RL+  +  FE       D + S+ +S      S  +   F +C   E  ++      NE  I F      S   F+ S      +CG  ++     ++T  F   Q      NY+ N  CV+         I   F  F++ D   C   F+   K+   N     ++ C G  + +I +      +K+ + FKS    AGT  R  +  F+  CGG          GY +S L+E              C+W +T+   + +  + +Q           NC+ + L+L++D+
Sbjct: 1304 GAIETPNFPENYPPGQDCEWDIRAG-GRKNHLQLIFSHLSVEKFSSICLN-DY--VSLVDMLDDQTLSEQHLCTNDGLEPITTVGNRLLLRFKSDSSVELQGFRAEYK------RIGCGEHL-RESGGRFESPNAPFSVDMDCVWIITASEGNQIRLLLHEVYFEAPQIECRDAESSLSVSAPSGYNSSVVL--FRSCH-EETQTQTFTSPGNELVIRFVSSSAPSRKYFKASFVQVPASCGGYISASSGVLTTPGFHNHQDSKNVANYTSNIECVWTVEVTNGYGIRPHFEQFNLTDSGNCSVSFVELTKLEPDNKEIFLEKTC-GEDSPMIRIVHG---RKLRVRFKSQ---AGTWGRF-IMYFERQCGGRLSTGE----GYLQSRLDEE-------------CSWLVTSPEGSKLSLIINQLECPKCNAVSQNCS-EGLQLLNDD 1711          

HSP 16 Score: 56.225 bits (134), Expect = 8.809e-7
Identity = 116/590 (19.66%), Postives = 233/590 (39.49%), Query Frame = 2
Query: 1799 TPTRYNTTGSILIIKAALKTNIQQNHGFKIK--IIPTNMAIENLDCCHCANGSTEMTQLTNGLFQ--SPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI----NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEAFCTWKIK-QTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMS-TYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPN-CAYDYLELI-HDNQTKRFCGNHAKSGPTV-----THKLVIRFVSDNSVSGEGFIMRFYTVKRDQY---CYESFESSSGLITNPTLEKLSNSFTCFYSIKVPQFKKILINI 3499
            +P R+ ++ +++ +K     N    H F++K  ++ +N+   NL        + E+T   +G  +  SP +P  Y  N+NC    ++++ +       I  +DL D  + CS +DYL I    + +  + ++ AC  +             + F SD    +N T F+ + + +      G   T+    + +  A   DV       I    N+   I +   +   +DG      S+ E T   R  N     +T+   S +H  ++  ++I   ++ G+            C   + +++ +  Y   S  YP     ++ C +   A     IA+ F +        C  + ++     +    L  R C   +N + T  +      +++ ++S       GFR  +S+  CGG F  +   I      HL          Y +  VC + I    +  I       HL    N  + D LE++ ++++T++      ++  ++     T+   IRFV+  +V+      R + ++ ++Y   C      +SG I  P + +      C   I VP+ +++ +N+
Sbjct: 1933 SPWRFTSSSNVVYLKTV---NDALTH-FRLKWGVLDSNLVASNLSLT-TGGCTKELTLSHHGDIELSSPGYPHGYAPNLNCEWTIRSQFPSHHIYAHSI-IVDLEDYPA-CS-ADYLSIQSSRDLIKWKNELHACKASQ-IAPVHGTPYLRLQFRSDV--SINGTGFRAKLRTSCGSNMTGIVGTIPQENLFDECAWHIDVRPGRKIDIAINYNNMPPIAVCEAYGLIYDG-VDEHASLLEHT---RFGNQMGIRRTQFRTSGSHAYIK--YHIGRSRINGLCLWNLTYREFNECNGEIQLNQQAPNYTIMSPGYPYLPHPHAECTWLVMAPPGETIAVDFDEQFELSARHCDKENVEFFDGATKLARLLLRTCRKPQNTVRTTGN-----LLLVHYQSQLNEPTGGFRLNLSLSTCGGQFSASAGFISSENYPHLG--------GYPKPSVCEYSILLPKNAFIRLNITDLHLPYDANGTSSDRLEIVDYEDRTQKLMVLDGRTKTSILFTLNTNAATIRFVAVQNVNN----YRGFKIRYERYVGTCSRDINGASGDIVIPPMPQSVWLRFCRLRISVPKGQRVRLNL 2488          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0304659)

HSP 1 Score: 147.132 bits (370), Expect = 2.817e-34
Identity = 122/384 (31.77%), Postives = 179/384 (46.61%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS----------------------------NTDICGHGTCYPDH----SPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            YDDC  + C NG  CIDG + + C CP NF G+ C +DV+EC Q    +  CQNGA C NT GS+ C+C   W+G+ C+   + C  A+                              D C    C+ D     SP N   + C C +G+        C  DIDEC  G  PC  +    CVNTPG  RC +C  GF G      +INEC  ++ C     C++  GT++C C+ G        C+++ + C++N   C  +  C   + +I G  C+C  G++G             N+ +       + Q CRN G C  S+ G++C+C PG+ G  C   IN+ C SNPC  G   + +  N ++C C P ++G  C+ +
Sbjct:  294 YDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPV--CQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPIN-GSYACSCATGYK----GVDCSEDIDECDQGS-PCEHNGI--CVNTPGSYRC-NCSQGFTGPRCE-TNINEC-ESHPCQNEGSCLDDPGTFRCVCMPGF---TGTQCEIDIDECQSNP--CLNDGTC---HDKINGFKCSCALGFTG--------ARCQINIDD------CQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININD-CDSNPCHRGKCIDDV--NSFKCLCDPGYTGYICQKQ 639          

HSP 2 Score: 127.102 bits (318), Expect = 2.830e-28
Identity = 118/395 (29.87%), Postives = 175/395 (44.30%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR--------------ANNMCQLENV----CETNNG----GCSTNA-ACSANNFRIEGR--------ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRC------VRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVC 1543
            ++  D+C +NPC N   C D  N FKC C   F G  C  ++++C         C+N   C ++I  + C C   ++G  C I IN C    +++ C  G C  D        FKCLCD G++       C   I+EC     PC       C +  G   C+ C  G  G     +++NEC ++  C     C++G  +Y+C+CV G   +              ANN   ++ V    CE   G     C ++   C++N    EGR        IC C PGY+G                    +RC           C++GGTC   L  F+CQC+PG+ G +C T I++ C++NPC NGG C     N Y+C C+  F+G +CE++   C
Sbjct:  524 EIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQS-----QPCRNRGICHDSIAGYSCECPPGYTGTSCEININDC----DSNPCHRGKCIDD-----VNSFKCLCDPGYT----GYICQKQINECE--SNPCQFDGH--CQDRVGSYYCQ-CQAGTSGKNCE-VNVNEC-HSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTG--------------------KRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDD-CVTNPCGNGGTC-IDKVNGYKCVCKVPFTGRDCESKMDPC 871          

HSP 3 Score: 120.553 bits (301), Expect = 3.321e-26
Identity = 109/361 (30.19%), Postives = 154/361 (42.66%), Query Frame = 2
Query:  488 CANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNT------DICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSAN--NFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFL-FPNHYRCHCQPLFSGVNCENEHIVC 1543
            C +NPC NGA C +  N + C CP  F GK C+E V+ C Q       C+NGA C      F C CS  W+G LC++   SC +A++        +C +GTC  D+  ++     C C  G++       C  +IDEC+    PC                          NG TC D+                   G Y+C+C QG + +          CE N   C+ N   +    + R+    C+C PG  G        +I   N  +       +   C N G+C   + GF C C PGF GARC   IN +CLSNPC N G  + +   N+Y C+C+P   G +CE++   C
Sbjct: 1064 CDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSP-----CENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTC-KDYGNSH----VCYCSQGYA----GSYCQKEIDECQ--SQPCQ-------------------------NGGTCRDL------------------IGAYECQCRQGFQGQN---------CELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMG--------IICEINKDD------CKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDIN-ECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFC 1341          

HSP 4 Score: 115.931 bits (289), Expect = 7.850e-25
Identity = 115/393 (29.26%), Postives = 167/393 (42.49%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECL------------QISG---------------------TIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGH-GTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----NGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAAC--SANNFRIEGRI-CTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            ++  ++C +NPC+NGA CIDG NS+KC C   F G+HC ++V+EC+            Q++G                       + C N  RCE+ I  F C C   ++G  C + I+ CS    ++ C H GTCY          F C C  G++     + C  +ID+C     PC       C++     +C  C + F G    +       N C N   C P+      F  + C C  G   R          C+ +   CS ++ C   A+   + G   C C  GY G       C I + +  +           C+NGGTC   +  ++C C+ GF G  C T I N+CLS PC NG  C   + N Y C C   FSG+NC+
Sbjct:  675 EVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECS----SNPCQHGGTCY-----DKLNAFSCQCMPGYT----GQKCETNIDDCVTN--PCGNG--GTCIDKVNGYKCV-CKVPFTGRDCESKMDPCASNRCKNEAKCTPSSN----FLDFSCTCKLGYTGR---------YCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEG-----RDCAINTDDCASFP---------CQNGGTCLDGIGDYSCLCVDGFDGKHCETDI-NECLSQPCQNGATCS-QYVNSYTCTCPLGFSGINCQ 1020          

HSP 5 Score: 115.161 bits (287), Expect = 1.366e-24
Identity = 113/379 (29.82%), Postives = 165/379 (43.54%), Query Frame = 2
Query:  488 CANNPCHNGAQC--IDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNA--SNTDIC-GHGTCYPDHSPTNPKPFKC----------LCDSGWS-LDPVT------------KTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLD----INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR-ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            CA++PC NGA C  + G +SF C CP  F G  C+ D+ EC       + C+ G  C NT GS++C+C   ++G  C+     CS +   N  IC  +G  Y    P   +   C          LC +G + +D ++            + C  D+DEC    +P        C NT G   C         NG+  LD     ++C  A  C     C++G G++ C+C +G   +   +C L++ C +N   C  +A C  +   I G   C+C  GY G    E+                C +   C + G C  +   + C C  GF G RC T I N+C S+PC N G+C    P  +RC C P F+G  CE
Sbjct:  181 CASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQS-----NPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHP-VCQNGATCTNTHGSYSC------ICVNGWAGLDCSNNTDDCKQA-ACFYGATCIDGVGSFYCQCTKG---KTGLLCHLDDACTSNP--CHADAICDTS--PINGSYACSCATGYKGVDCSED-------------IDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNI-NECESHPCQNEGSC-LDDPGTFRCVCMPGFTGTQCE 524          

HSP 6 Score: 111.309 bits (277), Expect = 1.677e-23
Identity = 103/358 (28.77%), Postives = 147/358 (41.06%), Query Frame = 2
Query:  473 LTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVC---ETNNGGCSTNAACSANNFRIEG--RICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            +  DDCA+ PC NG  C+DG   + C+C   F GKHC  D+NECL        CQNGA C   + S+ C C   +SG+ C      C+ +S  N   C  G             + C C +G+S       C   +++C     PC       C     +  C  CP GF G    C +  +      C     C      + CKC  G   +   +C ++ +      +  G S    C+    +  G   +C C+ GY+G             +   +    C + Q C+NGGTC+  +  + CQC  GF G  C   I++ C  NPC NGG C     N + C C P   G+ CE
Sbjct:  945 INTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLS-----QPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGI----------NGYNCSCLAGYS----GANCQYKLNKCD--SNPCLNG--ATCHEQNNEYTCH-CPSGFTGK--QCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGK---LCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAG-------------SYCQKEIDEC-QSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDD-CAPNPCQNGGTCHDRVMN-FSCSCPPGTMGIICE 1257          

HSP 7 Score: 56.225 bits (134), Expect = 7.918e-7
Identity = 69/249 (27.71%), Postives = 90/249 (36.14%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINS-----CSNASNTDICG-----HGTCYPDH--------------SP--------TNPKPFKCLCDSGWSLDPVTKTC-----IADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR 1105
            +L  DDCA NPC NG  C D   +F C CP    G  C  + ++C   +     C N   C + +G F CVC   + G  C   IN      CSNA   D        H  C P H              SP               C+C++G+      K C       D + CRVG    +   F          RCE CP G  G       ++EC+    C     C +  G Y+C C    K +
Sbjct: 1219 ELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGA-----CHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGF----YGKNCELSGQDCDSNPCRVGNCVVADEGF--------GYRCE-CPRGTLGEHCEIDTLDECS-PNPCAQGAACEDLLGDYECLCPSKWKGK 1448          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Fly
Match: N (gene:FBgn0004647 transcript:FBtr0070507)

HSP 1 Score: 147.132 bits (370), Expect = 2.817e-34
Identity = 122/384 (31.77%), Postives = 179/384 (46.61%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS----------------------------NTDICGHGTCYPDH----SPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            YDDC  + C NG  CIDG + + C CP NF G+ C +DV+EC Q    +  CQNGA C NT GS+ C+C   W+G+ C+   + C  A+                              D C    C+ D     SP N   + C C +G+        C  DIDEC  G  PC  +    CVNTPG  RC +C  GF G      +INEC  ++ C     C++  GT++C C+ G        C+++ + C++N   C  +  C   + +I G  C+C  G++G             N+ +       + Q CRN G C  S+ G++C+C PG+ G  C   IN+ C SNPC  G   + +  N ++C C P ++G  C+ +
Sbjct:  294 YDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHPV--CQNGATCTNTHGSYSCICVNGWAGLDCSNNTDDCKQAACFYGATCIDGVGSFYCQCTKGKTGLLCHLDDACTSNPCHADAICDTSPIN-GSYACSCATGYK----GVDCSEDIDECDQGS-PCEHNGI--CVNTPGSYRC-NCSQGFTGPRCE-TNINEC-ESHPCQNEGSCLDDPGTFRCVCMPGF---TGTQCEIDIDECQSNP--CLNDGTC---HDKINGFKCSCALGFTG--------ARCQINIDD------CQSQPCRNRGICHDSIAGYSCECPPGYTGTSCEININD-CDSNPCHRGKCIDDV--NSFKCLCDPGYTGYICQKQ 639          

HSP 2 Score: 127.102 bits (318), Expect = 2.830e-28
Identity = 118/395 (29.87%), Postives = 175/395 (44.30%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR--------------ANNMCQLENV----CETNNG----GCSTNA-ACSANNFRIEGR--------ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRC------VRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVC 1543
            ++  D+C +NPC N   C D  N FKC C   F G  C  ++++C         C+N   C ++I  + C C   ++G  C I IN C    +++ C  G C  D        FKCLCD G++       C   I+EC     PC       C +  G   C+ C  G  G     +++NEC ++  C     C++G  +Y+C+CV G   +              ANN   ++ V    CE   G     C ++   C++N    EGR        IC C PGY+G                    +RC           C++GGTC   L  F+CQC+PG+ G +C T I++ C++NPC NGG C     N Y+C C+  F+G +CE++   C
Sbjct:  524 EIDIDECQSNPCLNDGTCHDKINGFKCSCALGFTGARCQINIDDCQS-----QPCRNRGICHDSIAGYSCECPPGYTGTSCEININDC----DSNPCHRGKCIDD-----VNSFKCLCDPGYT----GYICQKQINECE--SNPCQFDGH--CQDRVGSYYCQ-CQAGTSGKNCE-VNVNEC-HSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTG--------------------KRCELDIDECSSNPCQHGGTCYDKLNAFSCQCMPGYTGQKCETNIDD-CVTNPCGNGGTC-IDKVNGYKCVCKVPFTGRDCESKMDPC 871          

HSP 3 Score: 120.553 bits (301), Expect = 3.321e-26
Identity = 109/361 (30.19%), Postives = 154/361 (42.66%), Query Frame = 2
Query:  488 CANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNT------DICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSAN--NFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFL-FPNHYRCHCQPLFSGVNCENEHIVC 1543
            C +NPC NGA C +  N + C CP  F GK C+E V+ C Q       C+NGA C      F C CS  W+G LC++   SC +A++        +C +GTC  D+  ++     C C  G++       C  +IDEC+    PC                          NG TC D+                   G Y+C+C QG + +          CE N   C+ N   +    + R+    C+C PG  G        +I   N  +       +   C N G+C   + GF C C PGF GARC   IN +CLSNPC N G  + +   N+Y C+C+P   G +CE++   C
Sbjct: 1064 CDSNPCLNGATCHEQNNEYTCHCPSGFTGKQCSEYVDWCGQSP-----CENGATCSQMKHQFSCKCSAGWTGKLCDVQTISCQDAADRKGLSLRQLCNNGTC-KDYGNSH----VCYCSQGYA----GSYCQKEIDECQ--SQPCQ-------------------------NGGTCRDL------------------IGAYECQCRQGFQGQN---------CELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMG--------IICEINKDD------CKPGACHNNGSCIDRVGGFECVCQPGFVGARCEGDIN-ECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFC 1341          

HSP 4 Score: 115.931 bits (289), Expect = 7.850e-25
Identity = 115/393 (29.26%), Postives = 167/393 (42.49%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECL------------QISG---------------------TIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGH-GTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----NGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAAC--SANNFRIEGRI-CTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            ++  ++C +NPC+NGA CIDG NS+KC C   F G+HC ++V+EC+            Q++G                       + C N  RCE+ I  F C C   ++G  C + I+ CS    ++ C H GTCY          F C C  G++     + C  +ID+C     PC       C++     +C  C + F G    +       N C N   C P+      F  + C C  G   R          C+ +   CS ++ C   A+   + G   C C  GY G       C I + +  +           C+NGGTC   +  ++C C+ GF G  C T I N+CLS PC NG  C   + N Y C C   FSG+NC+
Sbjct:  675 EVNVNECHSNPCNNGATCIDGINSYKCQCVPGFTGQHCEKNVDECISSPCANNGVCIDQVNGYKCECPRGFYDAHCLSDVDECASNPCVNEGRCEDGINEFICHCPPGYTGKRCELDIDECS----SNPCQHGGTCY-----DKLNAFSCQCMPGYT----GQKCETNIDDCVTN--PCGNG--GTCIDKVNGYKCV-CKVPFTGRDCESKMDPCASNRCKNEAKCTPSSN----FLDFSCTCKLGYTGR---------YCDEDIDECSLSSPCRNGASCLNVPGSYRCLCTKGYEG-----RDCAINTDDCASFP---------CQNGGTCLDGIGDYSCLCVDGFDGKHCETDI-NECLSQPCQNGATCS-QYVNSYTCTCPLGFSGINCQ 1020          

HSP 5 Score: 115.161 bits (287), Expect = 1.366e-24
Identity = 113/379 (29.82%), Postives = 165/379 (43.54%), Query Frame = 2
Query:  488 CANNPCHNGAQC--IDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNA--SNTDIC-GHGTCYPDHSPTNPKPFKC----------LCDSGWS-LDPVT------------KTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLD----INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR-ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            CA++PC NGA C  + G +SF C CP  F G  C+ D+ EC       + C+ G  C NT GS++C+C   ++G  C+     CS +   N  IC  +G  Y    P   +   C          LC +G + +D ++            + C  D+DEC    +P        C NT G   C         NG+  LD     ++C  A  C     C++G G++ C+C +G   +   +C L++ C +N   C  +A C  +   I G   C+C  GY G    E+                C +   C + G C  +   + C C  GF G RC T I N+C S+PC N G+C    P  +RC C P F+G  CE
Sbjct:  181 CASSPCRNGATCTALAGSSSFTCSCPPGFTGDTCSYDIEECQS-----NPCKYGGTCVNTHGSYQCMCPTGYTGKDCDTKYKPCSPSPCQNGGICRSNGLSYECKCPKGFEGKNCEQNYDDCLGHLCQNGGTCIDGISDYTCRCPPNFTGRFCQDDVDECAQRDHP-VCQNGATCTNTHGSYSC------ICVNGWAGLDCSNNTDDCKQA-ACFYGATCIDGVGSFYCQCTKG---KTGLLCHLDDACTSNP--CHADAICDTS--PINGSYACSCATGYKGVDCSED-------------IDECDQGSPCEHNGICVNTPGSYRCNCSQGFTGPRCETNI-NECESHPCQNEGSC-LDDPGTFRCVCMPGFTGTQCE 524          

HSP 6 Score: 111.309 bits (277), Expect = 1.677e-23
Identity = 103/358 (28.77%), Postives = 147/358 (41.06%), Query Frame = 2
Query:  473 LTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVC---ETNNGGCSTNAACSANNFRIEG--RICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            +  DDCA+ PC NG  C+DG   + C+C   F GKHC  D+NECL        CQNGA C   + S+ C C   +SG+ C      C+ +S  N   C  G             + C C +G+S       C   +++C     PC       C     +  C  CP GF G    C +  +      C     C      + CKC  G   +   +C ++ +      +  G S    C+    +  G   +C C+ GY+G             +   +    C + Q C+NGGTC+  +  + CQC  GF G  C   I++ C  NPC NGG C     N + C C P   G+ CE
Sbjct:  945 INTDDCASFPCQNGGTCLDGIGDYSCLCVDGFDGKHCETDINECLS-----QPCQNGATCSQYVNSYTCTCPLGFSGINCQTNDEDCTESSCLNGGSCIDGI----------NGYNCSCLAGYS----GANCQYKLNKCD--SNPCLNG--ATCHEQNNEYTCH-CPSGFTGK--QCSEYVDWCGQSPCENGATCSQMKHQFSCKCSAGWTGK---LCDVQTISCQDAADRKGLSLRQLCNNGTCKDYGNSHVCYCSQGYAG-------------SYCQKEIDEC-QSQPCQNGGTCRDLIGAYECQCRQGFQGQNCELNIDD-CAPNPCQNGGTCHDRVMN-FSCSCPPGTMGIICE 1257          

HSP 7 Score: 56.225 bits (134), Expect = 7.918e-7
Identity = 69/249 (27.71%), Postives = 90/249 (36.14%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINS-----CSNASNTDICG-----HGTCYPDH--------------SP--------TNPKPFKCLCDSGWSLDPVTKTC-----IADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRR 1105
            +L  DDCA NPC NG  C D   +F C CP    G  C  + ++C   +     C N   C + +G F CVC   + G  C   IN      CSNA   D        H  C P H              SP               C+C++G+      K C       D + CRVG    +   F          RCE CP G  G       ++EC+    C     C +  G Y+C C    K +
Sbjct: 1219 ELNIDDCAPNPCQNGGTCHDRVMNFSCSCPPGTMGIICEINKDDCKPGA-----CHNNGSCIDRVGGFECVCQPGFVGARCEGDINECLSNPCSNAGTLDCVQLVNNYHCNCRPGHMGRHCEHKVDFCAQSPCQNGGNCNIRQSGHHCICNNGF----YGKNCELSGQDCDSNPCRVGNCVVADEGF--------GYRCE-CPRGTLGEHCEIDTLDECS-PNPCAQGAACEDLLGDYECLCPSKWKGK 1448          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Fly
Match: tok (gene:FBgn0004885 transcript:FBtr0084690)

HSP 1 Score: 124.79 bits (312), Expect = 1.159e-27
Identity = 170/728 (23.35%), Postives = 286/728 (39.29%), Query Frame = 2
Query: 7058 CKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCGKTNS--IFTIGNVLTILFKN---MDDFSYFRLKVKIGSCGGLLHRRQ--GYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIW--------SNCNSSTWDIYTEYSTVRIIFKT-------------------------NTV-----TTRKGFKL---KYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPN-NNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLN---PISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPK----PYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII-DSNAV-----TLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSIC-GGVYD 9043
            C+W  T+  G R+++  E + I +   C   +L   DG    +  IG   FCGK +   I T  + + + + N   ++ F  F+ +  +  CGG L      G + SPNYPL+Y P   C+W+I+      + L F   +++  ++C    + V      +  +I          N  SS   +Y ++ +   + K                          NT+     + R GF+L   K   ED  CGG    P   + S ++P+       C W+I      RI +      +     +      GY SV +Y     N            ++  G+               CGS+I P   +ES  + +E        ++     +  G  ++F +D     C+       + NG          GC    R    +T+G  +      G  ++ + +  + G     C   ++  FG I SP YP+ YP N DC W  I      I+L      +E H +C YD++ +   E   S    + CG     PIS+ +     N+M +   +D +  KNGF   +     +  C G +  T    +  ++ +     Y   + C WTI  P+   V L F L FD+E  S   C +D +++  D + V      +  + CGN+ P + INS  + + + F TD +  ++GF A Y ++   G YD
Sbjct:  752 CEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIG--RFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDV-VCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCED-ACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQ--QSDCGYDSVTVYSKLGEN-----------RLKRIGT--------------FCGSSIPPTATSESNALRLE--------FHSDKSIQRSGFAAVFFTDID--ECA-------VNNG----------GCQHECR----NTIGSYICMCHN-GYSMHENGHDCKEG----ECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTS-----NQMYMVLKTDKNKQKNGFTASH-----STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIF-LTFDIE--SSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQD-INSMTHSLLVRFKTDGSVPMKGFSASYVAVPNSGEYD 1398          

HSP 2 Score: 94.3597 bits (233), Expect = 2.225e-18
Identity = 136/595 (22.86%), Postives = 218/595 (36.64%), Query Frame = 2
Query: 4520 CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSE--GIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE------------------TCGG----LRMAME------------------SNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGF--EGGSNNPNCSSDNSLTIIEGIGNNSSVK-AVLCTKS--PYHPIISNG-----HYLKVILKST-----------------------------------SGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF------YTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHV-YNQDTEITWTVFAESSEKLQFTFDQFSV 6019
            C+W      G  V+LK + + +  S NC E   L   +        + + C ++D     +I++ +    L + + +   G  R F+  ++     C  E+S  +  G ++SPNYP  Y  N  C W + V ES  + LK   FE E    C YDYVE+      D   +   CG           S  N M +KF +D +V   GF A + +                  T GG     R+  E                   N  + SP++P +Y L    C W +VA       RI   F  F  EG ++  +    +S+T+   +G N   +    C  S  P     SN      H  K I +S                                    +G ++ +  +      C  +     G   SP YP+S   + DCV+    +PG  I L   EF  E+      +D + + +G +E+SS+LGRF      + +S   N  Y     D        Q   FT         ++   ++ +  Y   +  +FG+  Y+   +  WT+ A  +  +Q  F  F +
Sbjct:  752 CEWRITATYGERVELKLENMNIFKSNNC-ETDYLEIRDGYFEKSPLIGRFCGKVD---KEVIRTESSRMLLTYVNTHRIEG-FRGFKAEFDVV---CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKP---PPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKE-CIWEIVAPPKH---RISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESH-QECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDK-----NKQKNGFTASHSTACGGYLRATSQVQQFY---SHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDI 1322          

HSP 3 Score: 93.2041 bits (230), Expect = 4.327e-18
Identity = 72/243 (29.63%), Postives = 112/243 (46.09%), Query Frame = 2
Query: 8306 YKFSRCGGLLTESFGYIKSPGYPEKYP---DNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSK-NGFVIEYNFINPADTCNG--IIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNA--VTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHA 9010
            YK  +CG    ES G   SP +        +   CEW I A     ++L ++ +++    +C  D+L IR      SP   + CG   +  E +    +RM L++ +   +    GF  E++ +     C G   + +  G ++SPNYP  Y  N  C W I VPE Y+V+L F+  F++E     +C YD + + D       L+   CG  PP N + SS N M + F +D +    GF A
Sbjct:  718 YKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCG--KVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVV-----CGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQ-SFEVENHD--SCVYDYVEVRDGPGQDAPLIGVFCGYKPPPN-MKSSGNSMYVKFVSDTSVQKAGFSA 949          

HSP 4 Score: 91.2781 bits (225), Expect = 1.985e-17
Identity = 140/598 (23.41%), Postives = 246/598 (41.14%), Query Frame = 2
Query: 3623 REEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLS---TMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKI------NH---------IRSGSVDETKL----CNDKNP----------VLKFVT----AKKEINIVCSEQI----TKMHVFEEQSVHVIFQNLASTKYRFRLYYTQD-----CEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQC---YSFVRI-SDRSNTLLKKS---CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRA------------HEGIVLEYQ-TQG---CMETFYYDPHESDYSTKNG-----------VIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKM-ANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY 5143
            +E I+T S+   +TY V  ++  G   +   +   D  CG   LS    +G + SPNYPL    N  C W+I      ++ +K       NH         +R G   +  L    C  K P           +KFV+     K   + V  +++    T+ H  E + ++ +     S +  F L+  +      C   I   +G I S +      +L+ C W++ +    +I +    FDL    + Q    Y  V + S      LK+    CG+ +   T TS +  +R+E ++D+S   +   A            + G   E + T G   CM    Y  HE+ +  K G            I S  +P+S   N DC W+F T PG  +KL F+  ++ES   C+   +   ++ E    + + + C    D     I S+++  Y+      D N     F  ++   + +C   +  +  + Q  ++  F    Y   + C W +   ++  + L  L F+ E S  C +DYV++FS I++   +   + G+   N +    +S+ + +L++F+TD +V  +GF A Y
Sbjct:  806 KEVIRTESSRMLLTY-VNTHRIEGFRGFKAEF---DVVCGG-ELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSI-PPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVA-VYDGESESSSVLGRFCG---DKIPFPISSTSNQMYMVL--KTDKNKQKNGFTASH---STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASY 1388          

HSP 5 Score: 84.3445 bits (207), Expect = 2.287e-15
Identity = 84/336 (25.00%), Postives = 132/336 (39.29%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIE---RSYDGCNYDFVXXXXXXXX---XXDAIFCGNLTNISPFMI-DTNVLIVRFQSDISHYENHTGFVAF----INPTPGPMLGCGGYMNATVGTYGVI--KSLDLDNNGLYENNLLCKWQIAAPYG--------------------------HAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLD 10294
             + +P+FP  Y       W   AP  +  S+N    D+E        C YD V+  +            FCG  ++I P    ++N L + F SD S     +GF A     I+       GC      T+G+Y  +      +  NG       CK++I+AP+G                          H +K+IF  N   +E       C YD++ +YDG   +  V+   CGD     I++ SN MY++  TD N QK+GF  + +   +    ++  +   Q     R+ N    D       IAA +  ++ +      I SS NC+ D
Sbjct: 1007 TITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCG--SSIPPTATSESNALRLEFHSDKS--IQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIF--NEFDVESHQE---CTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTASHST--ACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFD 1331          

HSP 6 Score: 79.7221 bits (195), Expect = 6.677e-14
Identity = 61/232 (26.29%), Postives = 103/232 (44.40%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHD---------NQTKRFCGN-HAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTV 3358
            S NYP +Y  N+ CV+ F      +I + F +FD+    EC +D + +    S S  +  R+C       I+  SN    ++ +  K++      GF A  S   CGG    T+++   Y  +      YD+         C W I    ++ +  +F  F +ES  NC +DY+++  D             ++CGN   +   ++TH L++RF +D SV  +GF   +  V
Sbjct: 1171 SPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAVYDGESESSSVLGRFCGDKIPFPISSTSN----QMYMVLKTDKNKQKNGFTASHSTA-CGGYLRATSQVQQFYSHARFGNQDYDDGMD------CEWTIAAPDNSYVQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNVLPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAV 1391          

HSP 7 Score: 78.1814 bits (191), Expect = 1.977e-13
Identity = 143/654 (21.87%), Postives = 245/654 (37.46%), Query Frame = 2
Query: 4085 PITSSSGRIESKNEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYS-FVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP-NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTY-------EFTNYSCEHE----MSGSE----------------------------GIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-----ESLCRYDYVEIFSPIN-NDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYF---ETC----GGLRM-----------------AMESNQF-----------------LLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSV--NMD----LDCVYVIRNSPGSSIDLSIEEF---SRENAISYILHDFIDIRNGPNETSSLLGRF 5746
            P   ++G + ++ E   +C W++++  G ++ ++++  ++   ++  C + ++ I D     + L+ + CG        T S+  +     T  +TH   I    G   E+      E    D          G ++S  +P + + N +C W       + V LKF   E+E+  +C     +   +    D   +   C          ++SS ++ Y+KF S  D +     F   +       E  N+ CEHE    + G E                            G I SP++P  YP    C W +       I L    F+ E     +S C YD V ++S +  N L ++   CG   + I    +S +N + ++F +D ++   GF A +F   + C    GG +                  +M  N                   + SPNYP  Y  P+  C W+ +      G RI   F  F+  S+   C+ DN + + +G   +SSV    C      PI S  + + ++LK T  N          S+ CGG  YL        FY ++   N D    +DC + I     S + L    F   S EN     +  F DI +   +   + G++
Sbjct:  737 PSHYTAGALSNETE---HCEWRITATYGERVELKLENMNI--FKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRML----LTYVNTHR--IEGFRGFKAEFDVVCGGELSVDD--------AVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYD-YVEVRDGPGQDAPLIGVFCGYKPPPN---MKSSGNSMYVKFVS--DTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCG---SSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYP-PNADCVWHFITTP---GHRIKLIFNEFDVESHQ-ECTYDN-VAVYDGESESSSVLGRFCGDKIPFPISSTSNQMYMVLK-TDKNKQKNGFTASHSTACGG--YLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQY 1353          

HSP 8 Score: 76.2554 bits (186), Expect = 6.639e-13
Identity = 99/465 (21.29%), Postives = 172/465 (36.99%), Query Frame = 2
Query: 9830 CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQK-SGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-------------------------ESLSTERVFISSHDKVIIQYQVGPMENINS--ATDRRFQISYELYTCNRTEKAYSGRIVNVENFK------QKKYSHNLICNLTLITPAPNLRYQFYFKYFNLE----RSSTCAYDYIQFILGEPGEQQYV-LPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSI-------------------------------------KCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            C+W+I A YG  V++  EN +I      +   C  D++ I DG     P+I   CG    + I T+S+ M L +     I+   GFK  F  V        +V +    LESP YP +   +   + + I   E+  + +  +  ++ +  +C  D   ++D   +    I  FC                         +      VF+   D+   Q      E IN+    +   +I +EL++  +  +   G ++   N         + Y     C   ++ P P  R    F +F+LE    + S C YD +  +  + GE +   +   CGSSIPP+  + S+ + + F +D+SI   G+   +  + D                                        +C  EI    G I SP +  +Y  + +C W+        IK  F +  +
Sbjct:  752 CEWRITATYGERVELKLENMNIF-----KSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDVVCGGE---LSVDDAVGRLESPNYPLDYLPNKECVWK-ITVPESYQVALKFQSFEVENHDSCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAP-PKHRISLNFTHFDLEGTAHQQSDCGYDSVT-VYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGTIFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDV 1205          

HSP 9 Score: 73.559 bits (179), Expect = 4.051e-12
Identity = 116/512 (22.66%), Postives = 185/512 (36.13%), Query Frame = 2
Query: 5153 CGGLRMAMESNQFLLSPNYPHVYTLPDGI--CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKST---SGNAIFKAAYGVGSSTCGGDFYLDD--GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRS----QGGDFT-------------NH------IKFLAKYHINYNT--EFRSDY---------------GVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSV-GRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDE---------------------------------NFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV 6424
            CG  R   ES+    SP++     L +    CEW + A   E   R+           +N NC +D  L I +G    S +    C K     I +    + +   +T    G   FKA + V    CGG+  +DD  G   SP YP     + +CV+ I       + L  + F  EN  S + +D++++R+GP + + L+G F       N   +    +S++++  S    Q   F+             NH      I  L  Y  +     E  SD                G + SP F  +Y    E  W + A    ++   F  F + G       C   ++ +Y    + ++     FCGS +  +A        +   S +  +  GF   +   +DE                                 +  K G+C+Y I A   T  + SPNYP+       C W  +T     + +    FD+ES  EC Y+N  V
Sbjct:  723 CG--RTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGE---RVELKLENMNIFKSN-NCETD-YLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEFDV---VCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCV-YDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSS---GNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLEGTAHQQSDCGYDSVTVYSKLGENRLKRIGTFCGSSIPPTATSESNALRLEFHSDKSIQRSGFAAVFFTDIDECAVNNGGCQHECRNTIGSYICMCHNGYSMHENGHDCKEGECKYEISAPFGT--IFSPNYPDSYPPNADCVWHFITTPGHRIKLIFNEFDVESHQECTYDNVAV 1218          

HSP 10 Score: 73.1738 bits (178), Expect = 6.118e-12
Identity = 62/223 (27.80%), Postives = 98/223 (43.95%), Query Frame = 2
Query: 10550 YSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGV---ITSPGFGTNYYESG-ECSWNIKLVSNSYIKWRFT--DMQLGNNTSLE-PTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWSPV 11197
            Y  N  C    IT  P  R +  F  F++E    C YD +    GE  E   VL + CG  IP    + S+++ M+  TD++   +G+  ++      S  CGG +   S V    +   FG   Y+ G +C W I    NSY++  F   D++   N + +    +S+ D V   YG    +YCG + L ++    + S  V +K+       GF  S+  V
Sbjct: 1178 YPPNADCVWHFIT-TPGHRIKLIFNEFDVESHQECTYDNVAVYDGE-SESSSVLGRFCGDKIPFPISSTSNQMYMVLKTDKNKQKNGFTASH------STACGGYLRATSQVQQFYSHARFGNQDYDDGMDCEWTIAAPDNSYVQLIFLTFDIESSENCTFDYVQVFSDIDDVYGQYGPMYGQYCGNV-LPQDINSMTHSLLVRFKTDGSVPMKGFSASYVAV 1391          

HSP 11 Score: 67.3958 bits (163), Expect = 3.242e-10
Identity = 76/332 (22.89%), Postives = 125/332 (37.65%), Query Frame = 2
Query: 4808 CEHEMSGSEGIIQSPNY---PNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSS-RGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGH--YLKVILKSTSGNAIFKAAY-----------------------------GVG----------SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRE 5665
            C      S GI  SP++            C W +       + LK+ +    +S  C  DY+EI          +   CGK+   +     + ++ ML+ +   H +   RGFKA++   CGG     ++   L SPNYP  Y LP+  C W +    S    ++   F  FE   N+ +C  D  + + +G G ++ +  V C   P   + S+G+  Y+K +  ++   A F A +                              +G             CGG     +G  TSP +P    +  +C++ I   P   I L+   F  E
Sbjct:  723 CGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEV---IRTESSRMLLTYVNTHRIEGFRGFKAEFDVVCGGELSVDDAVGRLESPNYPLDY-LPNKECVWKITVPES---YQVALKFQSFE-VENHDSCVYD-YVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNHGCEHECINTLGGYECSCRIGFELHSDKKHCEDACGGVIEYPNGTITSPSFPEMYPLLKECIWEIVAPPKHRISLNFTHFDLE 1045          

HSP 12 Score: 62.3882 bits (150), Expect = 1.072e-8
Identity = 56/219 (25.57%), Postives = 94/219 (42.92%), Query Frame = 2
Query: 2738 HCVYQFYAE-TRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAG-TGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR------FCG-----NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRF 3349
            HC ++  A    ++ +   + +I   + C+ D+++I         L  R+C     E+I      E+ ++++T+ +     G  GF+A+  V  CGG   + + +        L    Y     Y  NK C W+IT      +   F  F +E+H +C YDY+E + D   +       FCG     N   SG    + + ++FVSD SV   GF   F
Sbjct:  751 HCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRT----ESSRMLLTYVNTHRIEGFRGFKAEFDVV-CGGELSVDDAV------GRLESPNY--PLDYLPNKECVWKITVPESYQVALKFQSFEVENHDSCVYDYVE-VRDGPGQDAPLIGVFCGYKPPPNMKSSG----NSMYVKFVSDTSVQKAGFSAVF 951          

HSP 13 Score: 62.003 bits (149), Expect = 1.578e-8
Identity = 62/248 (25.00%), Postives = 101/248 (40.73%), Query Frame = 2
Query: 9422 FPSPYHHNA--------NLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGL-YENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA----VPSQNH 10120
            F SP H+ A        +  W   A  G    + L +++I +S + C  D++         S  I  FCG +         + +L+    +     E   GF A  +      + CGG ++        +  L+  N  L Y  N  C W+I  P  + V + F+  S  +E       C YD++ + DGP    P+I   CG     ++ +  N MY+ F +D ++QK+GF   F        +QNH
Sbjct:  734 FASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKS-NNCETDYLEIRDGYFEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNT--HRIEGFRGFKAEFD------VVCGGELSVD----DAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQ--SFEVENHD---SCVYDYVEVRDGPGQDAPLIGVFCGYKPPPNMKSSGNSMYVKFVSDTSVQKAGFSAVFMKEVDECETQNH 963          

HSP 14 Score: 53.5286 bits (127), Expect = 5.682e-6
Identity = 43/203 (21.18%), Postives = 86/203 (42.36%), Query Frame = 2
Query: 10412 QVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSI-NYDGYDITYVVNRDPSIKCGGEIYLDSGV--ITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTS 11011
            ++G    ++     +  + Y+   C RT +  SG   +  ++     S+        IT     R +   +  N+ +S+ C  DY++   G   E+  ++ + CG        T SSR+ + +V    I  + G+   +       + CGGE+ +D  V  + SP +  +Y  + EC W I +  +  +  +F   ++ N+ S
Sbjct:  699 EIGQRLRLSQGDIAQANLLYKCPKCGRTFQESSGIFASPSHYTAGALSNETEHCEWRITATYGERVELKLENMNIFKSNNCETDYLEIRDGY-FEKSPLIGRFCGKVDKEVIRTESSRMLLTYVNTHRIEGFRGFKAEF------DVVCGGELSVDDAVGRLESPNYPLDYLPNKECVWKITVPESYQVALKFQSFEVENHDS 894          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Zebrafish
Match: cubn (cubilin (intrinsic factor-cobalamin receptor) [Source:ZFIN;Acc:ZDB-GENE-060228-6])

HSP 1 Score: 975.696 bits (2521), Expect = 0.000e+0
Identity = 955/3759 (25.41%), Postives = 1585/3759 (42.17%), Query Frame = 2
Query:  158 DSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDH--SPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP-------------CIWTIISSNDQFLQI-IPI-NLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTN--GLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVF----EITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-------RFCGNHAKSGPTVTHKLV-IRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINIT--------------VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN--HIRSGSVD---ETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQN---LASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS----NYDAKVFCGSGVIDSAIFT-PPVTLILSAE---GYRYPGFLIRWN--------PPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF--ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSES--RYSGFQIMYSKKDEECGGRHELTRYQDSRIV---DMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEE--LVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKE--SENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGC-----FRIRARGVGYRSVLLYIICASNLENFEIDTKS-SMIEVFGSGATIS-----FSYNSDQPSLCGSNI-YPNNNESGVITIENVNISL-CQYNIHNYPEDEGTLSMFMSDNTGI----PCSNVY--FVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAV---TLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYL---PGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISP-FMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGG-CRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            + PR+IS+NG++ F    +K I F T   G +++   DL    ++             +KK N E I++     S   E ++  L   + +++ LE++   I++ +    C++NPC N   C++  ++F C+CP N++G  C  DVNEC  ++GT  GCQNGA C NT GS+ C C+ +W G  C    + C+  S  D+C HG C      +P  PK +KC+CD+GW+  P    C ADIDEC +   PCS +P V C NT G   C  CP G++GNG++C D++ECA      +  P   C+N  G++ C +C  G +      C   ++C TNNGGC   A C++        +CTC PGY G+G G  GC  +S          C     C NG  C+ + TG+ C C PG+ G  C   +N +C SNPC NGG C     N Y C C   ++G  C+     CGG                +L SP+ +  +P             C W I +  +Q L+I  P  +++    C+ +++Q+H+      +  +IGKYC  +            +     +L    + +H             +   C           QLTN  G  +SP +P  Y  N +C        G    +     TL L +   NC + D+L+I      +  +    C+       +       +HFHSD    ++   F   +  + S   CG   T     II SP  P +      C + I      R+ R +    N+   D  +         E+       +  I       L    L   N  +I F+    +S   F+   E ACG +++        F  D YP N      C +     E   + ++FL FD+   S C FD +++    S+S  L  RYC      ++        K + I FK++++ +  GF A+    + G    LT        E   + ++    T+Y     CTW I+      I   F  F++E H NCAYDY++ ++DN T        RFCG       T T  L+ +  VSD+S+S EGF   + ++     C + F +S+G +++P   +    +  C Y I V    +I++N T              +   DG     P +GQ             +   +  +   R  +K  S+  ++TY            +  ++      CG    ++ G   SPNYPL  PAN  C W I+++ G RI +     H+   +VD   +  +  D N       AK     +C  QI        ++++V  +    + +  +    + T +       S G IES N    Y     CSW + +  G+ I      F++    +G  Y  V++ D  N    L+   CGN +     T+S   + I   +D S       ++ G  +++   GC    +         T N      Q+P    N +C W+  T PG S+ +     ++E   +C+    L  +    +    + Q C        + + S+ +   ++F S    +G  R F  T+      C   ++   G I SP YP+ YP N  CSW + V     +     D + E    C YDYV I    +     L  +CG          +S  N + + FR+DH+++ RGF A++ E CG   +  +    + SP YP+ Y   +  C W + A   E    +   F  FE    N NC+ D S+ I++G    +      C  +  HP+  +SN   +K +     G   F+A Y   +S CGG   ++ G F SP YP+    +++CV+ + +SPG+ I LS   F  + + S   +D+++IR G + T +L+GRF   S   NYT        +WI+  S      +   F A +   Y  +     G++ASP +   Y  + +  WTV  +S   +Q  F    +    +   C    L IYD     ++    FCG  + +    +   +TL   ++   G +  GFLI W         P ++      G C   +   +  Q L SP +P        C+W I +  +  ++  +LS D+E    C +++  +   G  N      +       GSL+++          +++ + + +D      GF  ++ + C   F +   G L + +YP     N NC +  ++   F   +   +   +    N      +L++       +  ++  LCGSN+P   Q   T++S     L+ +F S+     +GF++++      CGG  EL        +   D  SN     P  I+C W  T P G  +Q+DFE    +     C   ++   DG T+    IG    CG T  ++  + G  + + F+     ++  F+ K  I  CGG    + G I SP +P  NYP  S+C W + G +   + LT+   DL ++ +  N   + ++E  +   ++  +C N+    + T  S   + F ++      GF L +      CGG+ + P   ++S NYP        C W I V   +R+ + +  L++         F     G+   +  L  +C +     ++ +   +M  +F + +++S       Y+S++ ++CG  +  P N  S      N + +L C++ I N P    +  + + D   +     C   Y  F   IG+   E +     G    +     ST    V+F+     +  + +   +  Y FS CGG  +   G I SPGYP  YP  + C WL+ AP    + LT     +E H  C +D + I       SP   + CG N  S  T+    N++ + F +D +VSK GF   ++    +  C GII    G+IKSPNYP+ +P+N+ C+WTI   +G  + + F   F +  +S   C    +++   N      LL+  CG   P+  I +  N ++  F +  +   +GF A + + CG  +    G +VS N       +  C Y+I   E  + V+      F    H   +   ++  +G      P   +CG +   I       +   Y+    H  +  F A Y       VF+       + +P+   S YHHN N T+        + ++   S ++E S   CN+D+V+     S  +  +  FCG+   + P     TN + ++F +D S      G+ A  + T GP  GCGG++++  G +G   S D+D NG YE ++ C W IA     A+ + F    IS E     G  CRYDH+TIYDG  +  P++ T CGD       + SN + + F +D  + + GF  T++ V S        T  SQ + SP YPN  P        ++ A   + + ++V+   + +S +C+ +    +D  +    +  KFC + S    F S    + I ++          T   F +SY++  C+R  +   G + +        Y HNL C++ L  P  N     +F  F++E   +C +DY++   G       +L K CG+++P      S+ + + F +D +   +G++IT+  +      CGG +Y D G  TSP +   Y     C W+I+  S   +   F  + +
Sbjct:   39 EQPRMISENGHLTFSAGYNKDIRFTTSGTGSLKVGAEDLILQINQ-------------IKK-NKEDIDTIKN--SGPSEDIKNQLHLLDTRVTTLESKVQSIEQTVQRKTCSSNPCQNTGTCLNLLDAFHCLCPDNWQGPTCAVDVNECQVLAGTPLGCQNGATCNNTPGSYTCTCTPEWYGPHCTSRYDDCAGGSQ-DLCVHGLCIDSDRVNPNEPK-YKCICDAGWTSPPGVAACTADIDECSLPTKPCSTNPPVECFNTLGSFYCGACPSGWQGNGYSCQDVDECATNNGGCSTSPFVPCLNTMGSFHCGQCPPGYEGDGK-TCTQADICSTNNGGCFPLATCTSTPGSTI-PLCTCPPGYVGNGYGPTGCTQIS--------DICGTSNPCVNG-QCENTATGYVCHCDPGWAGQNCDQNMN-ECSSNPCQNGGTCTDGI-NGYTCTCTAQWTGPQCQTPQQECGG----------------ILESPAGTFSYPNNPGTGDYDHQVSCAWVIRTDPNQILRITFPFFDIENSASCNFDFLQVHDGE--SASAFVIGKYCGSA--------APAELFSSHNSLYFWFRSDHSVSAGGFTVAWQSQAPVC---------GGQLTNTYGDIKSPGYPGNYPPNRDCYWTVNVNPG--LLITFAFGTLSL-EHHDNC-NFDFLEIRDGLLPEDSLLGKYCSTASPPPLQTTGPSAWIHFHSDFS--ISDRGFHITYTTSPSDPGCGGVFTET-EGIIISPNWPNNYAHNRQCIYII------RMPRSEQVALNFTHMDLEIHTGCLFDFVEVRDGTGETDPLIGKYCGNTLPAPILSTTNGLWIRFQSDSSVSRAGFRAMYELACGGTLSGTGQIRTPFHPDPYPHN----KVCEWVINQPEGYVVTLNFLTFDVEGSSTCAFDHVEVRDGPSSSSPLIGRYCGVEMPPML----ESTQKSMFIQFKTDASVSNHGFTAEFGSAEQGCGETLT--------EPTGSFTSPGHPTEYPHGANCTWYISVPPGHLIRLSFSYFNMEFHTNCAYDYVD-VYDNGTALTGTLLGRFCGRSVPPSLTSTDSLMTVLLVSDSSLSAEGFSADYISINATTDCSKVFRTSTGELSSPNYPDNYPTNRECVYRIIVEVNMQIMLNFTDFQLEGFSSCGFDYLEIRDGGYETSPLIGQ---------YCGTNAPPIIVSHSNRLWMKFRSD-HSLTYR----------GFQAHWDGTQTGCGGTLTTSSGGFTSPNYPLPYPANAECYWHIKTSAGSRIQLSFGDFHLED-TVDCYFDYLMVYDGNNSNAHQLAK-----LCGNQIPAPISSSRENMYVKLRTDSIIHTGGFLANYHSTCNGMLIANRSRGMIESLNYPNDYPSHADCSWTIQAYMGNTINYTFIAFEVE-QSDGCGYDHVKLYDGPNDQANLIGTFCGN-VPPPAGTTSGTSLHIVFRSDMSI------SYRGFQMDWYQNGCGGELF-----GPVGTFNSPGYPGQYP---MNRECVWHIHTSPGSSISITILEFDVEYHPDCNYDK-LEVYGGPDLSAPRLAQLCTTRPPSNPLQVSSTGNAVTVRFTSDAVVSG--RGFNATWVEVPGGCGGSVTAPSGEIHSPQYPSNYPDNADCSWVITVDAGHRVFFNFTDLDIENQFSCSYDYVAIHDGPHEHSPLLAQVCGTSR---PPPVTSSTNVIYVCFRSDHSLNHRGFSAQFSEACGSFIVTDDVGGEIASPRYPYPYPP-NQDCSWIIRAQ--EPFNHVTLSFTDFELEMLNSNCTHD-SVEILDGDNVQAPSVGRYCGSNLPHPVTSLSNAMVVKFVSDHAVGRKGFRATYMASTSGCGGLLNMESGAFNSPNYPDVYPPNVECVWTLTSSPGNRIQLSFIMFQLQPS-SDCSNDYLEIREG-HSTGALVGRFCGDSLPTNYT--SITGHILWIKFISDSS--ISGAGFRAVFSHLYGNDITGSTGLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIEDLFN---CLYDKLKIYDGPSTNSFLLGEFCGLTLPNPVRSSGSAITLEFQSDTVIGGK--GFLIEWTAVQGSGPLPTIEP-----GACGGTLVTGDTPQFLFSPGWPELYQHNLDCSWVIRS-PSSIVEFNLLSLDMEDEVSCLHDSLDIR-DGETNASPLIAKVCGRQLPGSLHSTG---------DAMLLRFTSDGSINGRGFNATFSRGC-GGFLHTDRGVLSSPQYPQNYKPNLNCNWQVMVTPGFRVSVTFQSPFQVQGYGNQCSTGDYLELRNGPDGNSPTLSGRLCGSNVPSTFQ--TTDNS-----LYAHFVSDGSNEGNGFKLLFEAHSSACGGLIELNDGDPPGYITSPDYPSNY----PQNIDCVWIITVPNGEAVQLDFEGDFYIEPHSGCLFDYIEIRDGPTSDADLIG--RLCGNTRPSTQHSSGTTMYLRFRTDASVTHIGFKAKYSIAVCGGTYIGQNGVIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTLTYTAFDL-QSSANCNSDYVEIREYNASGRLLGKHCGNNLPAPMDTGDSFAYVKFVSDASANAGGFSLSFEASIEECGGDLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLEDQSTCAFDFVEILNGLTPSAPRLDRLCGTVPAGTQVKSSGNTMTVIFSTDSSVSNGGFTADYSSEESAVCGGILNEPGNFTSPDFGNGNYSNNLNCEWLIQN-PHHTNSSIVVIIDELHLEHHQTCEWDYLEFRLDIGDHNGELLTRL-CGQTPPSIPIVVSTPSLWVHFL----SDEAVGDLGFKATYYFSECGGTQSGDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEVEEHSQCVWDSVTIFNGASSGSPIIGQYCGHN--SPGTIRSGSNKLVVVFLADHTVSKGGFAATWS--TDSTGCGGIIHADTGTIKSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQ-CQNSYIKMWSDNIQNDENLLATGCGTTAPA-AIIAPRNVITARFQSS-DTPGKGFSAAFYTTCGANFTASSGRVVSPNYPDHYPANSNCNYIINAGEQFVVVLTF--RTFQIEAHSTCVYDGVKIYSGTTASSSPLATLCGNTIPGIFTTFGPMLINFYSDSIIH--DNGFLAEYTTIPCGGVFNGTAG--TIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLEAS-STCNFDYVAVYDGESTLAPLMGKFCGH--ELPPNLRSSTNHMFLQFVTDSSVAAE--GWRATYSETLGPQQGCGGFLSSPSGMFG---SPDIDMNGQYEPHMDCMWTIAVEVNKAINLTF----ISFELEGSTGTLCRYDHVTIYDGDSANFPLVGTFCGDVIPAPFISASNFLTVHFISDGTVSRRGFNATYSTVNSLCGGAFNATATSQTITSPLYPNAYP-PFTSCRWVLDAPSQEGVKVSVQQFHLDTSQSCTSNFLEFKDFPVGDYGQAHKFCSADSHVPDFYSYGRTMHITFKSEAF-----MTGNGFSLSYQVAGCSRVYEQEYGYLKSPG--WPDLYPHNLECSIVLQAPQ-NSFISLFFTSFDVETHPSCNFDYLEVRNGSTATSP-LLGKHCGNTLPNPVFPGSNELFIFFKSDFTTTRNGFEITWTSSPQ---GCGGVLYGDHGSFTSPNYPGTYANGSSCEWSIRAPSGRVVTVTFNQISI 3563          

HSP 2 Score: 424.861 bits (1091), Expect = 2.572e-118
Identity = 579/2465 (23.49%), Postives = 982/2465 (39.84%), Query Frame = 2
Query: 4076 CEFPITSSSGRIESKNEMLRY--------------CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP-NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKF---FSANDPNGGMRKFQGTYEFT--NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPN-YPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGF--EGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLC--TKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDI-RNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTE----FRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDN-GQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTL---------ILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDF-RNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-----AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNS-NRLHMTPHFIECKWHFTSPPGTRMQIDFEELVIS-RIICNESFLAFFDGSTTFTQKIGGQNFC-----GKTNSIFTIGNVLTILFKN---MDDFSYFRLKVKI-GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYSTV-RIIFKTNTVTTRKGFKLKY------FFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN---QGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATIS-----FSYNSDQPSLCGSNIYPNNNESGVITIENV------NISLCQYNIHNYPEDEGTLSMFMSD-NTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFI---NPADT-----CNGIIF--NTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLI---PGWENHLQVVYIYPNFFGCRYHDNQIQID--LE-----DQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKN---YNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVN------VENFKQKKYSHNLICNLTLITP-APNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPS--FVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-KYCGY 11089
            C+ P     G +ES      Y              C+W + +     + I    FD+    +  C + F+++ D    S  ++ K CG+      F+S N      ++  RS HS    +  G  + +Q+Q  +            +   G I+S  +P N   N DC W     PG  +   F  + +E   NC+    L   +  + +++ + + C+         +Q++  + ++ F   FS +D     R F  TY  +  +  C    + +EGII SPN+PN Y HN +C + +++  S  + L     + E  + C +D+VE+          +   CG   N +     S  N + I+F++D +VS  GF+A Y   CGG        +    P+ YPH     + +CEW  V N  E G  +   F+ F  EG S    C+ D+ + + +G  ++S +    C     P         +++    ++  N  F A +G     CG       G FTSP +P       +C + I   PG  I LS   F+ E   +   +D++D+  NG   T +LLGRF      R+   +    DS+   L       +    F A Y  IN  T+    FR+  G L+SP +   Y  + E  + +  E + ++   F  F    +L+    C    L I D  Y+     G     +A   PP+ +           S     Y GF   W    D      G        T  +   TSPNYP        C W I T     + +    F LE + +C Y ++ + + G+ +      +         +++S  N++         +  + D      GF  +Y   C      N   G ++++ YPN    + +C++ ++++  N I N T +      +  C    +K+        N+  T CG N+PP   P  T S   +  +F +  S S Y GFQ+ + +    CGG  EL       +   NS       P   EC WH  + PG+ + I   E  +     CN   L  + G      ++     C          + + GN +T+ F +   +    +    V++ G CGG +    G I SP YP NYP  + C W I+  +   +   F D D++   +CS   + +       + ++   C +S     T  + V  + F+++     +GF  ++      F      GGE +   R        +  SW +R     N         +++ L  N        +    V   SV  Y  C SNL +      ++M+  F S   +       +Y +   S CG  +   N ESG     N       N+  C + + + P +   LS  M        CSN Y   + G+     V  F   C +       S  G ++   F     ++ + +R    + +   G  +T S G I SP YP  YP+N D  W +    +  IQ+    + +E   +C YD L I      +S    + CGL   NP+ +       + + L F SD  +   GF+IE+  +    P  T     C G +   +T   + SP +P+ Y  NL C+W I  P      + F L   L+     +C +DSL I D  +NA  L++++CG   P + ++S+ + M L F++D + N  GF+A +   CGG     +G + S         ++ C + +   PG+   + V +  P  F  + + NQ      LE     D N   L G R+CG +          S+   + +   +  N     F A       +   +D   P  + +P++PS Y  N +  WI   P G    ++         + GC +D++      ++ +D I   CGN T  S        + +RF++D S    H GF A  +     +  CGG     +G  GVI+S     +  Y +N  C+W +  P GH + + +   +  L+  +    C  D++ I +   S R ++   CG++    + T  +  Y+ F +D +    GF L+F A  S       +      + SP YPN  P+  R     I   +   +T+T+ DL++     C+ D   I +       ++++ C ++       SS + + + +        +S ++  F   Y     +  E A  G I+N        +F    YS+NL C   +  P   N          +LE   TC +DY++F L        +L ++CG + PPS   V ++  + + F++D+++   G+  TY  +     +CGG    D GVI+SPG+   Y     C+W ++      +   FT  ++  ++       S T F   S G+  + +YCG+
Sbjct:  468 CQTPQQECGGILESPAGTFSYPNNPGTGDYDHQVSCAWVIRTDPNQILRITFPFFDIE--NSASCNFDFLQVHDGESASAFVIGKYCGSAAPAELFSSHNS----LYFWFRSDHS---VSAGGFTVAWQSQAPV-------CGGQLTNTYGDIKSPGYPGNYPPNRDCYWTVNVNPGLLITFAFGTLSLEHHDNCNFD-FLEIRDGLLPEDSLLGKYCSTASPPP---LQTTGPSAWIHFHSDFSISD-----RGFHITYTTSPSDPGCGGVFTETEGIIISPNWPNNYAHNRQCIYIIRMPRSEQVALNFTHMDLEIHTGCLFDFVEVRDGTGETDPLIGKYCG---NTLPAPILSTTNGLWIRFQSDSSVSRAGFRAMYELACGGTLSGTGQIRTPFHPDPYPH-----NKVCEW--VINQPE-GYVVTLNFLTFDVEGSS---TCAFDH-VEVRDGPSSSSPLIGRYCGVEMPPMLESTQKSMFIQFKTDASVSNHGFTAEFGSAEQGCGETLTEPTGSFTSPGHPTEYPHGANCTWYISVPPGHLIRLSFSYFNMEFHTN-CAYDYVDVYDNGTALTGTLLGRFCG----RSVPPSLTSTDSLMTVLLVSDSSLSAE-GFSADYISINATTDCSKVFRTSTGELSSPNYPDNYPTNRECVYRIIVEVNMQIMLNFTDF----QLEGFSSCGFDYLEIRDGGYETSPLIGQYCGTNA---PPIIVSHSNRLWMKFRSDHSLTYRGFQAHW----DGTQTGCGG-----TLTTSSGGFTSPNYPLPYPANAECYWHIKTSAGSRIQLSFGDFHLEDTVDC-YFDYLMVYDGNNSNAHQLAKLCGNQIPAPISSSRENMY---------VKLRTDSIIHTGGFLANYHSTCNGMLIANRSRGMIESLNYPNDYPSHADCSWTIQAYMGNTI-NYTFIAFEVEQSDGCGYDHVKLYDGPNDQANLIGTFCG-NVPP---PAGTTSGTSLHIVFRSDMSIS-YRGFQMDWYQNG--CGG--ELF----GPVGTFNSPGYPGQYPMNRECVWHIHTSPGSSISITILEFDVEYHPDCNYDKLEVYGGPDLSAPRLA--QLCTTRPPSNPLQVSSTGNAVTVRFTSDAVVSGRGFNATWVEVPGGCGGSVTAPSGEIHSPQYPSNYPDNADCSWVITVDAGHRVFFNFTDLDIENQFSCSYDYVAIHDGPHEHSPLLAQVCGTSRPPPVTSSTNVIYVCFRSDHSLNHRGFSAQFSEACGSFIVTDDVGGEIAS-PRYPYPYPPNQDCSWIIRAQEPFNHVTLSFTDFELEMLNSNCTHDSVEILDGDNVQAPSVGRY--CGSNLPHPVTSLSNAMVVKFVSDHAVGRKGFRATYMAST-SGCGGLL---NMESGAFNSPNYPDVYPPNVE-CVWTLTSSPGNRIQLSFIMFQLQPSSDCSNDYLEIREGHSTGALVGRF---CGDSLPTNYTSITGHILWIKFISDSSISGAGFRAVFSHLY---GNDITGSTGLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIEDLFNCLYDKLKIYDGPSTNSFLLGEFCGLTLPNPVRSS-----GSAITLEFQSDTVIGGKGFLIEWTAVQGSGPLPTIEPGACGGTLVTGDTPQFLFSPGWPELYQHNLDCSWVIRSPSSI---VEFNL-LSLDMEDEVSCLHDSLDIRDGETNASPLIAKVCGRQLPGS-LHSTGDAMLLRFTSDGSINGRGFNATFSRGCGGFLHTDRGVLSSPQYPQNYKPNLNCNWQVMVTPGFR--VSVTFQSP--FQVQGYGNQCSTGDYLELRNGPDGNSPTLSG-RLCGSNVPSTFQTTDNSLYAHFVSDGSNEGNGFKLLFEAHSSACGGLIELNDGDPPGYITSPDYPSNYPQNIDCVWIITVPNGEAVQLDFEGDFYIEPHSGCLFDYIEIRDGPTSDADLIGRLCGN-TRPSTQHSSGTTMYLRFRTDAS--VTHIGFKAKYS-----IAVCGG---TYIGQNGVIRSPGFPGSN-YPDNSNCEWYLEGPTGHYLTLTY--TAFDLQSSAN---CNSDYVEIREYNASGR-LLGKHCGNNLPAPMDTGDSFAYVKFVSDASANAGGFSLSFEA--SIEECGGDLNAPFGTISSPNYPNLYPHS-RICRWSITVPQGRRVTLTINDLRLEDQSTCAFDFVEILNGLTPSAPRLDRLCGTVPAGTQVKSSGNTMTVIFSTD-----SSVSNGGFTADY-----SSEESAVCGGILNEPGNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQTCEWDYLEFRLDIGDHNGELLTRLCGQT-PPSIPIVVSTPSLWVHFLSDEAVGDLGFKATYYFS-----ECGGTQSGDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEVEEHSQC--VWDSVTIFNGASSGSPIIGQYCGH 2776          

HSP 3 Score: 256.144 bits (653), Expect = 3.547e-67
Identity = 486/2216 (21.93%), Postives = 819/2216 (36.96%), Query Frame = 2
Query: 1607 SPSRSLHFP-----------CIW--TIISSNDQFLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNH-GFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCS-------DSDYLQINFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESP----AIPADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQ-LSVFEITTSGRIQNHFITCQTREMLSENHLKVENE-FYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNS--NDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSF------FLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT------KRFCGNH-AKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKV-PQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQR-------EEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSI----HLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN----------------HIRSGSVDET----KLCNDKNPVLKFVTAKKEINIVCSEQITKMHV---FEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDP--NGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPN---YPNF----YPHNLRCSWNLK----VKESMSIHLKILDFETEESLCRYDYVEIFSPI---NNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSI------DLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEI--RNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKK--IGDCEYIIKAT---------NQTQILTSPNYPNFDITRRF-CTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIF------------ENKNCTFILRSHFLNYILNLT--ALDLPPPTNGKCVNGFLKILAMN-----INKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQ--NFCGKTNSI---FTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSC--IWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN 7798
            +PS  +H P           C W  T+ + +  F     ++++    CS +YV +H+     E + L+ + C  S   P     T S  +I    +++   NH GF  +                A GS  +T    G   SP +P  Y  N +C+   +A+      V L     +L  L SNC+       D D +Q   V R      C  N+      + N  +V F SD        R  FR     S   CG  + M   A   SP      P +VE  C W +  +  +R+      F+     DCS   L + E  ++G +   F      + L  N+  +     +I F     IS   F+    +  GN +     ST    S  YP+ Y  N+   +    ++   I I FLD DI D   C +D +KI    S +  L   +C       +TL +        I + F+S++   G GF  + +     G             L+ G     L    + E   Y+ N  C+W I +      F +     +E   +C +D L+ I D +T       + CG     S  +    +++RF SD S++G GF   F      + C     +  G++++P   +    +  C + + V P F+       VS +  S F +   G          + +    N  PT   R          +T+ N+    + V    N G   + + + +    CG +         G+I SP+YP   P N  C W I    G+ + +                    IR G   +     +LC +  P  +  +             T M++    +    H+ F+   S       Y  Q+    +  S G   S       C W L    G  + +    FDL    N    Y  +R  + S  LL K CGN L     T  ++   ++  +D S ++        +  E   + C           D +   G I S  +PN   +   C+W+     G  V L  + + +E    C+    +            + + C  +  G  +    S+ N     FS +    NGG           +YS E E +   GI+  P     P+F    Y +NL C W ++       S+ + +  L  E  ++ C +DY+E    I   N +L  L  LCG+    I    S+ +  + + F +D  V   GFKA Y F  CGG +        + SP YP+VY  P   C W L A      +  F YF   E    +  C  D S+TI  G  + S +    C  +    I S  + L V+  +  T     F A +   S+ CGG  + D G   SP YP +   +++C + I    G+ +      D  I + S +   SYI     +I+N  N  ++  G     + I  RN            I  R Q  D T    F A ++      F +  G + SP +   Y  ++   + + A     +  TF  F         Q    +  +YD     K++ G+    +A  +P  TL     G   PG    + P +   +    I D  ++ + T              + SP++   +      CT+ I       ++++  SF+LE+S  C ++   V + G         ++       +L +S  ++F  ++ +S   +  A+ +           +A Y +   P +G    +  P+ +F             + +C + +    +N  +NLT  + +L   T   C    + I   +     +  T CG  IP    P I+ S+++ V+   + +   R  GF   YS  +  CGG    T    +    +  N     P F  C+W   +P    +++  ++  + +   C  +FL F D    F     GQ   FC   + +   ++ G  + I FK+    +   F L  ++  C  +  +  GY+ SP +P  YP    C  + Q    S+ ++  T  D +   +C+   L V     + + ++  +C N+    ++   + + I FK++  TTR GF++ +      CGG          S NYP T +    C W I     + + V   ++ ++
Sbjct: 1528 APSGEIHSPQYPSNYPDNADCSWVITVDAGHRVFFNFTDLDIENQFSCSYDYVAIHDGP--HEHSPLLAQVCGTSRPPPV----TSSTNVIYVCFRSDHSLNHRGFSAQFSE-------------ACGSFIVTDDVGGEIASPRYPYPYPPNQDCSWIIRAQEPFN-HVTLSFTDFELEMLNSNCTHDSVEILDGDNVQAPSVGRY-----CGSNLPHPVTSLSNAMVVKFVSDHAVG----RKGFRATYMASTSGCGGLLNMESGAF-NSPNYPDVYPPNVE--CVWTLTSSPGNRIQLSFIMFQLQPSSDCSNDYLEIREGHSTGALVGRFC----GDSLPTNYTSITGHILWIKFISDSSISGAGFRAVFSHLYGNDITG---STGLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIEDLFNCLYDKLKIYDGPSTNSFLLGEFCG------LTLPNPVRSSGSAITLEFQSDTVIGGKGFLIEWTAVQGSGPLPTIEPGACGGTLVTGDTPQFLFSPGWPE--LYQHNLDCSWVIRSPSSIVEFNLL-SLDMEDEVSCLHDSLD-IRDGETNASPLIAKVCGRQLPGSLHSTGDAMLLRFTSDGSINGRGFNATF-----SRGCGGFLHTDRGVLSSPQYPQNYKPNLNCNWQVMVTPGFR-------VSVTFQSPFQVQGYGNQCSTGDYLELRNGPDGNS-PTLSGRLCGSNVPSTFQTTDNSL-YAHFVSDGSNEGN-GFKLLFEAHSSACGGLIELNDGDPPGYITSPDYPSNYPQNIDCVWIITVPNGEAVQLDFEGDFYIEPHSGCLFDYIEIRDGPTSDADLIGRLCGNTRPSTQHSSG------------TTMYLRFRTDASVTHIGFKAKYSIAVCGGTYIGQNG---VIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTLTYTAFDLQSSANCNSDYVEIREYNASGRLLGKHCGNNLPAPMDTGDSF-AYVKFVSDASANAGGFS----LSFEASIEEC---------GGDLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLEDQSTCAFD-FVEILNGLTPSAPRLDRLCGTVPAGTQV---KSSGNTMTVIFSTDSSVSNGGFTA--------DYSSE-ESAVCGGILNEPGNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQT-CEWDYLEFRLDIGDHNGEL--LTRLCGQTPPSIPIVVSTPS--LWVHFLSDEAVGDLGFKATYYFSECGGTQSG--DGGVISSPGYPNVYPSPS-RCTWLLEAPVGHTVVLTFTYFEVEE----HSQCVWD-SVTIFNGASSGSPIIGQYCGHNSPGTIRSGSNKLVVVFLADHTVSKGGFAATWSTDSTGCGGIIHADTGTIKSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQCQNSYIKMWSDNIQNDENLLATGCGTTAPAAIIAPRNV-----------ITARFQSSD-TPGKGFSAAFYTTCGANFTASSGRVVSPNYPDHYPANSNCNYIINAGEQFVVVLTFRTF---------QIEAHSTCVYDG---VKIYSGT----TASSSPLATLC----GNTIPGIFTTFGPMLINFYSDSIIHDNGFLAEYTTIPCGGVFNGTAGTIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLEASSTCNFDYVAV-YDGESTLAPLMGKFCGHELPPNLRSSTNHMFLQFVTDS---SVAAEGW-----------RATYSETLGPQQGCGGFLSSPSGMFGSPDIDMNGQYEPHMDCMWTIAVE-VNKAINLTFISFELEGSTGTLCRYDHVTIYDGDSANFPLVGTFCGDVIP---APFISASNFLTVHFISDGTVSRR--GFNATYSTVNSLCGGAFNATATSQTITSPLYPNAY---PPFTSCRWVLDAPSQEGVKVSVQQFHLDTSQSCTSNFLEFKD----FPVGDYGQAHKFCSADSHVPDFYSYGRTMHITFKSEAFMTGNGFSLSYQVAGCSRVYEQEYGYLKSPGWPDLYPHNLECSIVLQAPQNSFISLFFTSFDVETHPSCNFDYLEVRNGSTATSPLLGKHCGNTLPNPVFPGSNELFIFFKSDFTTTRNGFEITWTSSPQGCGGVLYGDHGSFTSPNYPGTYANGSSCEWSIRAPSGRVVTVTFNQISID 3564          

HSP 4 Score: 247.669 bits (631), Expect = 1.418e-64
Identity = 437/1968 (22.21%), Postives = 762/1968 (38.72%), Query Frame = 2
Query: 1634 CIWTIISSNDQFLQI--IPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNT-TGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI-------NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEP--------CGAT-ITMNPNAIIESPAIPADVE--AFCTWKIKQTNSS---RLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLD-FDIND-DSECKF-DFIKI---SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFD--CGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFD-QFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSGPTVTHK----LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL--EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVT-AKKEINIVCSEQITKMHVFEE-QSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY---------------CSWKLSSLR--GSKILIQIDKFDLPPLQNGQCYSFVR----ISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIV------DENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKIL-DFETEES--LCRYDYVEIFSP-INNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKS------PYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYP-NSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF--YTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQ--FGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYD----AKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGD-CEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILAMNINKTL-----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRI-ICNESFLAFFDGSTTFTQKIGGQNFCGKTNSI 7228
            C+WT+ SS    +Q+  I   LQ   DCS +Y+++ E         L+G++C   +S PT Y + TG IL IK    ++I    G   + + +++   ++       GST       GL  SP +P  Y  N +   ++     +   +++Q   +D+ DL  NC   D L+I       +F+  E     C   +    +   +   + F SD+   +    F   W       P        CG T +T +    + SP  P   +    C+W I+  +S     L+ L        + + S      +I       +  I       L  +     +   + F     I+   F  +    CG  ++ D        S  YPQNY  N +C +Q       +++++F   F +    ++C   D++++      NS  L  R C  N         N     +   F S+ +  G GF+         CGG   L +    GY  S       D  + Y +N  C W IT      +   F+  F++E H  C +DY+E I D  T       R CGN   + P+  H     + +RF +D SV+  GF  ++        C  ++   +G+I +P        ++  C + ++ P    + +  T  +   S        +       G +      N  P       + T  + A + ++     NAG F  ++++ +  EECG    +  G I+SPNYP   P +  CRW I    G+R+ + IN +R    D++    D   +L  +T +   ++ +C        V     ++ VIF   +S        +T D     ++  G I   NE   +               C W + +     S I++ ID+  L   Q  + + ++     I D +  LL + CG    +     S   + +   +D +      +A               T+Y+       S   GVI S  +PN   +   C W  +   G +V L F   E+E    C        W++  +          + Q C     G    I+S ++   + F + +  + G   F  T+   +  C   +    G I+SPNYP  +P N+ CSW +   +   + +    DF+  +S   C+  Y++++S  I ND   L   CG  A        +  N +  +F++  T   +GF A ++ TCG    A  S+  ++SPNYP  Y   +  C + + A    + +  F  F   E  S    C  D  + I  G   +SS  A LC  +       + P++ N +   +I  +      F A Y   +  CGG F    G   SP +  ++ + +++C Y I       I+L    F+ E A S    D++ + +G +  + L+G+F  + L      + N+ F   V     +  G    + + L            S  G+  SP       Y    +  WT+  E ++ +  TF  F +        C   ++ IYD +         FCG  VI +   +    L +    +   G + R     +  +  +   C     AT  +Q +TSP YPN       C W +     E + + +  F L++S  C   NF +EF       F   +Y    K  S  +S    F +Y   ++ IT+K++ F    GF LSY+ A          G L++  +P+    N  C+ +L++   ++I L  T+ D+   T+  C   +L++   +   +      CG+ +P    P+   S+ + +    +F++    +GF+I ++   + CGG      Y D      + N      +   C+W   +P G  + + F ++ I     C  ++L  FDG    +  +G   +CG   +I
Sbjct: 1781 CVWTLTSSPGNRIQLSFIMFQLQPSSDCSNDYLEIREG---HSTGALVGRFC--GDSLPTNYTSITGHILWIKFISDSSIS---GAGFRAVFSHLYGNDI------TGST-------GLIASPLYPRTYPNNAD--YRWTVTVDSDSHIQIQFLDIDIEDL-FNCL-YDKLKIYDGPSTNSFLLGEF----CGLTLPNPVRSSGSAITLEFQSDTV--IGGKGFLIEWTAVQGSGPLPTIEPGACGGTLVTGDTPQFLFSPGWPELYQHNLDCSWVIRSPSSIVEFNLLSLD------MEDEVSCLHDSLDIRDGETNASPLIAKVCGRQLPGSLHSTGDAMLLRFTSDGSINGRGFNATFSRGCGGFLHTDRGV---LSSPQYPQNYKPNLNCNWQVMVTPGFRVSVTFQSPFQVQGYGNQCSTGDYLELRNGPDGNSPTLSGRLCGSNVPSTFQTTDN----SLYAHFVSDGSNEGNGFKLLFEAHSSACGGLIELNDGDPPGYITSP------DYPSNYPQNIDCVWIITVPNGEAVQLDFEGDFYIEPHSGCLFDYIE-IRDGPTSDADLIGRLCGN---TRPSTQHSSGTTMYLRFRTDASVTHIGFKAKYSIA----VCGGTYIGQNGVIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTLTYTAFDLQSSANCNSDYVEIREYNASGRLLGKHCGNNLPA-----PMDTGDSFAYVKFVSDASANAGGF--SLSFEASIEECGGDLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRL--EDQSTCAFDFVEILNGLTPSAPRLDRLCGTVPAGTQVKSSGNTMTVIFSTDSSVS---NGGFTADYSSEESAVCGGI--LNEPGNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQTCE-WDYLEFRLDIGDHNGELLTRLCGQTPPSIPIVVSTPSLWVHFLSDEAVGDLGFKA---------------TYYFSECGGTQSGDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEVEEHSQC-------VWDSVTIFNGASSGSPIIGQYCGHNSPGT---IRSGSNKLVVVFLADHTVSKG--GFAATWSTDSTGCGGIIHADTGTIKSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQCQNSYIKMWSDNIQNDENLLATGCGTTA---PAAIIAPRNVITARFQSSDT-PGKGFSAAFYTTCGANFTA--SSGRVVSPNYPDHYPA-NSNCNYIINAGEQFVVVLTFRTFQ-IEAHST---CVYDG-VKIYSGTTASSSPLATLCGNTIPGIFTTFGPMLINFYSDSIIHDNG-----FLAEYT--TIPCGGVFNGTAGTIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLE-ASSTCNFDYVAVYDGESTLAPLMGKFCGHELPPNLRSSTNHMFLQFVTDSSVAAEGWRATYSETLGPQQ-GCGGFLSSPSGMFGSPDIDMNGQYEPHMDCMWTIAVEVNKAINLTFISFELEGSTGT-LCRYDHVTIYDGDSANFPLVGTFCGD-VIPAPFISASNFLTVH---FISDGTVSRRG--FNATYSTVNSLCGGAFNATATSQTITSPLYPNAYPPFTSCRWVLDAPSQEGVKVSVQQFHLDTSQSCT-SNF-LEFKD-----FPVGDYGQAHKFCSA-DSHVPDFYSY-GRTMHITFKSEAFMTGNGFSLSYQVAGCSRVYEQEYGYLKSPGWPDLYPHNLECSIVLQAPQNSFISLFFTSFDV--ETHPSCNFDYLEVRNGSTATSPLLGKHCGNTLP---NPVFPGSNELFIFFKSDFTTTR--NGFEITWTSSPQGCGG----VLYGDHGSF-TSPNYPGTYANGSSCEWSIRAPSGRVVTVTFNQISIDDPGDCQNNYLKLFDGPDANSPAVG--PYCGLETNI 3597          

HSP 5 Score: 236.498 bits (602), Expect = 3.087e-61
Identity = 469/2111 (22.22%), Postives = 811/2111 (38.42%), Query Frame = 2
Query: 1634 CIWTIISSNDQF----LQIIPINLQLL-GDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITA------CNQNMYFNKKFIVNRFM-VHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRL------IRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQ---------TREMLSENHLKVENE-------FYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQ-FHLESHPN-CAY-DYLELIHDNQ------TKRFCGNHAKSG-PTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFE----SSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIP---CLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFA-PANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-DKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYY---TQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDR---SNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNS--IANIDCQWNFQTI--PGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDEN--YVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMA-NFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET---CGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVA---NTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLL---------GRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYH-INYNTEFRSDYGVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPN----YPNFDITRRF-----CTWTILTDRTEALDIQMLSFDLESSYE--CKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFR-NPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNI------NKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLH------MTPHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKIG------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSST 7546
            C W II + + F    L      L++L  +C+ + V++ +    +  +  +G+YC   ++ P    +  + +++K      + +  GF+   + +             +G   +  + +G F SPN+P  Y  N+ C     +  G R ++   +  L      S+CS+ DYL+I    RE   T       C  ++  N   I    + + F SDS   ++   F+  +      +  G+T       +I SP  P      A   W +   + S +      I ++  F   +D     +L +++    G   N F+  +          R   S   L+ +++       F I +  ++G S P   I    ACG ++   +   + F S  +P+ Y  N  C +   + +  +  + L  D+ D+  C  D + I    +N+  L  + C   +    +L+S  +   +++ F S+ +  G GF A  S   CGG F  T++ ++  P+   N         Y+ N  C W++       +   F   F ++ + N C+  DYLEL +         + R CG++  S   T  + L   FVSD S  G GF + F        C    E       G IT+P        +  C + I VP  + + ++      +G  +  P   CL             +  I  +C     R   + SS T T+        +     +   YS     CG  ++   G I SP +P    P N+ C W +    G  + +         +  +  CN D   + ++  + + +   C   +       +   +V F + AS     F L +    ++C   + +  G I S N        R C W ++  +G ++ + I+   L   Q+   + FV I +    S   L + CG         SS   + +   TD S       ++ G   +Y ++                 + G   S  F N     N++C+W  Q       S+ +  D + +E    C E   L  +  +I D N   + + C +     SI I  ST + ++ F S  D   G   F+ TY F+   C    SG  G+I SP YPN YP   RC+W L+     ++ L    FE EE S C +D V IF+  ++    +   CG  +   I++G    +N++++ F  DHTVS  GF A +      CGG+  A      + SPNYP     P  I C W ++A   N  E+G    F      G      C +       + I N+ ++ A  C  +    II+  + +    +S  T G     A Y    +TCG +F    G   SP YP+    + +C Y+I       + L+   F  E A S  ++D + I +G   +SS L         G F T   +     N+ ++DS+   +   G        FLA+Y  I     F    G + SP      Y+ +   T+ ++  ++  +   F+ F++     +  CN   + +YD           FCG  +       PP   + S+  + +  F+   +  V     +    E +         L+SP+     P+ D+  ++     C WTI  +  +A+++  +SF+LE S    C+Y++ T+    S N  F  +       CG +  + F     +L     + + +D      GF  +Y      C   F       ++ +  YPN      +C ++L +     +  ++       T+  C + FL+     +      +K     +  PD              +   F SE+  +G     S +   C           SR+ +     L       + PH +EC     +P  + + + F    V +   CN  +L   +GST  +  +G    CG T  N +F   N L I FK+  DF+  R   +I        CGG+L+   G   SPNYP  Y   SSC W I   S   + +TF    +D+  +C  + L +    ++ +  +   C   T
Sbjct: 1663 CSW-IIRAQEPFNHVTLSFTDFELEMLNSNCTHDSVEILDGDNVQAPS--VGRYC--GSNLPHPVTSLSNAMVVKFVSDHAVGRK-GFRATYMAS------------TSGCGGLLNMESGAFNSPNYPDVYPPNVECVWTLTSSPGNRIQLSFIMFQLQP---SSDCSN-DYLEI----REGHSTGALVGRFCGDSLPTNYTSITGHILWIKFISDSS--ISGAGFRAVFSHLYGNDITGST------GLIASPLYPRTYPNNADYRWTVTVDSDSHIQIQFLDIDIEDLFNCLYD-----KLKIYD----GPSTNSFLLGEFCGLTLPNPVRSSGSAITLEFQSDTVIGGKGFLIEWTAVQG-SGPLPTIEPG-ACGGTLVTGDTPQFLF-SPGWPELYQHNLDCSWVIRSPSSIVEFNLLSLDMEDEVSCLHDSLDIRDGETNASPLIAKVCG--RQLPGSLHSTGD--AMLLRFTSDGSINGRGFNATFSR-GCGG-FLHTDRGVLSSPQYPQN---------YKPNLNCNWQVMVTPGFRVSVTFQSPFQVQGYGNQCSTGDYLELRNGPDGNSPTLSGRLCGSNVPSTFQTTDNSLYAHFVSDGSNEGNGFKLLFE--AHSSACGGLIELNDGDPPGYITSPDYPSNYPQNIDCVWIITVPNGEAVQLDF-----EGDFYIEPHSGCLFDYIEIRDGPTSDADLIGRLCGN--TRPSTQHSSGT-TMYLRFRTDASVTHIGFKAKYSI--AVCGGTYIGQNGVIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTLTYTAF---DLQSSANCNSDYVEIREYNASGRLLGKHCGNNLPAPMDTGDSFAYVKFVSDASANAGGFSLSFEASIEECGGDLNAPFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLED-QSTCAFDFVEILNGLTPSAPRLDRLCGTVPAGTQVKSSGNTMTVIFSTDSSV------SNGGFTADYSSEESAVC-------GGILNEPGNFTSPDFGNGNYSNNLNCEWLIQNPHHTNSSIVVIIDELHLEHHQTC-EWDYLE-FRLDIGDHNGELLTRLCGQTP--PSIPIVVSTPSLWVHFLS--DEAVGDLGFKATYYFSE--CGGTQSGDGGVISSPGYPNVYPSPSRCTWLLEAPVGHTVVLTFTYFEVEEHSQCVWDSVTIFNGASSGSPIIGQYCGHNSPGTIRSG----SNKLVVVFLADHTVSKGGFAATWSTDSTGCGGIIHADTGT--IKSPNYPQ--NFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSG-----QCQNSYIKMWSDNIQNDENLLATGCGTTAPAAIIAPRNVITARFQSSDTPGKGFSAAFY----TTCGANFTASSGRVVSPNYPDHYPANSNCNYIINAGEQFVVVLTFRTFQIE-AHSTCVYDGVKIYSGTTASSSPLATLCGNTIPGIFTTFGPML---INF-YSDSI---IHDNG--------FLAEYTTIPCGGVFNGTAGTIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLEA---SSTCNFDYVAVYDGESTLAPLMGKFCGHEL-------PPN--LRSSTNHMFLQFVT--DSSVAAEGWRATYSETLGPQQGCGGFLSSPSGMFGSPDIDMNGQYEPHMDCMWTIAVEVNKAINLTFISFELEGSTGTLCRYDHVTIYDGDSAN--FPLVGTF----CGDVIPAPFISASNFL----TVHFISDGTVSRRGFNATYSTVNSLCGGAFNATATSQTITSPLYPNAYPPFTSCRWVLDAPSQEGV-KVSVQQFHLDTSQSCTSNFLEFKDFPVGDYGQAHKFCSADSHVPDFYSYGRT-------MHITFKSEAFMTGNGFSLSYQVAGC-----------SRVYEQEYGYLKSPGWPDLYPHNLECSIVLQAPQNSFISLFFTSFDVETHPSCNFDYLEVRNGSTATSPLLG--KHCGNTLPNPVFPGSNELFIFFKS--DFTTTRNGFEITWTSSPQGCGGVLYGDHGSFTSPNYPGTYANGSSCEWSIRAPSGRVVTVTFNQISIDDPGDCQNNYLKLFDGPDANSPAVGPYCGLET 3595          

HSP 6 Score: 176.407 bits (446), Expect = 5.953e-43
Identity = 313/1457 (21.48%), Postives = 560/1457 (38.44%), Query Frame = 2
Query: 1607 SPSRSLHFP----CIWTIISSNDQFLQIIPINLQLLGD--------CSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNH-GFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFP-LKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQS--NCSDSDYLQINFVDREIKITA--CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPA--DVEAFCTWKIKQTNSSRL------IRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGIS----TPEFQISAEYACGNSVNM-DEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIAISFLD-FDINDDSECKFDFIKIS---GSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLI--IGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHA----KSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILI----NITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLC-NDKNPVLKFVTAKKE-INIVCSEQITKMHV-FEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRY------CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDRSNTL---LKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDEN-----YVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSC--EHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTL 5755
            SP    ++P    C+W I   N + +Q     L   GD        C  +Y+++ +  P  +A +LIG+ C   N+ P+  +++G+ + ++   +T+    H GFK K         ++  C    G T + Q  NG+ +SP FP   Y  N NC    +   G    +     T    DLQS  NC +SDY++I   +   ++    C  N+        +   V F SD+ +  N+  F   ++ +I  E CG  +   P   I SP  P        C W I      R+      +RL+      FD    V++      ++ R+     T      +  +     N   + F     +S    T ++       CG  +N     ++ +F + NY  N   N   + Q    T    +  +D   +     C++D+++     G ++G L  R C      +  + S   T  + + F S+      GF+A     +CGG+      +I   GYP              Y     CTW +   +   +   F  F +E H  C +D + + +   +      ++CG+++    +SG   ++KLV+ F++D++VS  GF   + T      C     + +G I +P   +    +  C ++I       + +    +  + +S G C       Q +   +           +   C         +    IT         G+      Y++    CG+   ++ G + SPNYP   PAN+ C + I +  G++ ++ +   R+  ++    C  D   +    TA    +  +C   I  +   F    ++    ++         Y T  C      ++G I S +  +        C++ +       I ++ + F+L    +  C + +V + D  +TL   + K CG++L     +S+N+ + ++  TD S  +   RA     L  Q QGC   F   P  S       +  + Q+     ++DC W        ++ L F   E+E S     G + R     I D +      V   C  +     I    S  NF    F  +D     R F  TY   N  C      + +   I SP YPN YP    C W L       + + +  F  + S  C  +++E       D  +    C   ++     F S    M I F+++  ++  GF   Y +  G  R+  +   +L SP +P +Y  P  + E ++V    +    I  +F  F+    +P+C+ D  L +  G    S +    C  +  +P+    + L +  KS  T+    F+  +      CGG  Y D G FTSP YP +      C + IR   G  + ++  + S ++      ++++ + +GP+  S  +G +  L
Sbjct: 2245 SPDYPSNYPQNIDCVWIITVPNGEAVQ-----LDFEGDFYIEPHSGCLFDYIEIRD-GPTSDA-DLIGRLC--GNTRPSTQHSSGTTMYLR--FRTDASVTHIGFKAKY--------SIAVC----GGTYIGQ--NGVIRSPGFPGSNYPDNSNCEWYLEGPTGHYLTL-----TYTAFDLQSSANC-NSDYVEIREYNASGRLLGKHCGNNLPAPMDTGDSFAYVKFVSDASA--NAGGFSLSFEASI--EECGGDLNA-PFGTISSPNYPNLYPHSRICRWSITVPQGRRVTLTINDLRLEDQSTCAFD---FVEILNGLTPSAPRLDRLCGTVPAGTQVKSS----GNTMTVIFSTDSSVSNGGFTADYSSEESAVCGGILNEPGNFTSPDFGNGNYSNNL--NCEWLIQNPHHTNSSIVVIIDELHLEHHQTCEWDYLEFRLDIGDHNGELLTRLCGQTPPSIPIVVS---TPSLWVHFLSDEAVGDLGFKATYYFSECGGTQSGDGGVISSPGYPN------------VYPSPSRCTWLLEAPVGHTVVLTFTYFEVEEHSQCVWDSVTIFNGASSGSPIIGQYCGHNSPGTIRSG---SNKLVVVFLADHTVSKGGFAATWSTDSTG--CGGIIHADTGTIKSPNYPQNFPTNIECSWTIIAHDGNHLEMGFASDFQIPDSSGQC-------QNSYIKMWSDNIQNDENLLATGCGTTAPAAIIAPRNVITARFQSSDTPGKGFSAAFYTT----CGANFTASSGRVVSPNYPDHYPANSNCNYIINA--GEQFVVVLT-FRTFQIEAHSTCVYDGVKIYSGTTASSSPLATLCGNTIPGIFTTFGPMLINFYSDSIIHDNGFLAEYTTIPCGGVFNGTAGTIGSPSHSISNYHHNINCTYHIYVRNNRVINLKFNSFNLE--ASSTCNFDYVAVYDGESTLAPLMGKFCGHELPPNLRSSTNH-MFLQFVTDSSVAAEGWRATYSETLGPQ-QGC-GGFLSSP--SGMFGSPDIDMNGQYE---PHMDCMWTIAVEVNKAINLTFISFELEGST----GTLCRYDHVTIYDGDSANFPLVGTFCGDVIPAPFI----SASNFLTVHF-ISDGTVSRRGFNATYSTVNSLCGGAFNATATSQTITSPLYPNAYPPFTSCRWVLDAPSQEGVKVSVQQFHLDTSQSCTSNFLEFKDFPVGDYGQAHKFCSADSHVPD--FYSYGRTMHITFKSEAFMTGNGFSLSY-QVAGCSRVYEQEYGYLKSPGWPDLY--PHNL-ECSIVLQAPQNSF-ISLFFTSFDV-ETHPSCNFD-YLEVRNGSTATSPLLGKHCGNTLPNPVFPGSNELFIFFKSDFTTTRNGFEITWTSSPQGCGGVLYGDHGSFTSPNYPGTYANGSSCEWSIRAPSGRVVTVTFNQISIDDP-GDCQNNYLKLFDGPDANSPAVGPYCGL 3593          

HSP 7 Score: 137.887 bits (346), Expect = 2.493e-31
Identity = 148/606 (24.42%), Postives = 248/606 (40.92%), Query Frame = 2
Query: 9416 PNFPSP--YHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFT--DMQLGNNTSLEPTCYSNTDFVKVSYGNQAL------KYCGY--------------ILLDEEFQIPSSSFTVEYKSL 11152
            PN P    Y H  +  W+       I  I     DIE S   CN+DF+      S S+  I  +CG+      F    N L   F+SD  H  +  GF VA+ +  P     CGG +     TYG IKS     N  Y  N  C W +    G  + + F   ++SLE       C +D + I DG      ++   C       + T     ++ F +DF+I   GF +T+T  PS        T    ++ SP +PNN  ++ + +  +I    ++ + +    + +     C  D   ++D + + +  I K+C +     + +S+ + + I++Q     + +S +   F+  YEL  C  T    +G+I     F    Y HN +C   +  P         F  F++E SSTCA+D+++   G P     ++ + CG  +PP   +    + + F TD S++  G+   +         CG  +   +G  TSPG  T Y     C+W I +     I+  F+  +M+   N +         D+V V     AL      ++CG               +LL  +  + +  F+ +Y S+
Sbjct:  489 PNNPGTGDYDHQVSCAWVIRTDPNQILRITFPFFDIENSAS-CNFDFLQVHDGESASAFVIGKYCGSAAPAELFS-SHNSLYFWFRSD--HSVSAGGFTVAWQSQAPV----CGGQL---TNTYGDIKSPGYPGN--YPPNRDCYWTVNVNPG--LLITFAFGTLSLEHHDN---CNFDFLEIRDGLLPEDSLLGKYCSTASPPPLQTTGPSAWIHFHSDFSISDRGFHITYTTSPSDPGCGGVFTETEGIIISPNWPNNYAHNRQCI-YIIRMPRSEQVALNFTHMDLEIHTGCLFDFVEVRDGTGETDPLIGKYCGNTLPAPI-LSTTNGLWIRFQ-----SDSSVSRAGFRAMYEL-ACGGTLSG-TGQIRTP--FHPDPYPHNKVCEWVINQPE-GYVVTLNFLTFDVEGSSTCAFDHVEVRDG-PSSSSPLIGRYCGVEMPPMLESTQKSMFIQFKTDASVSNHGFTAEFGSAEQ---GCGETLTEPTGSFTSPGHPTEYPHGANCTWYISVPPGHLIRLSFSYFNMEFHTNCAY--------DYVDVYDNGTALTGTLLGRFCGRSVPPSLTSTDSLMTVLLVSDSSLSAEGFSADYISI 1052          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Zebrafish
Match: cdcp2 (CUB domain containing protein 2 [Source:ZFIN;Acc:ZDB-GENE-070705-485])

HSP 1 Score: 152.14 bits (383), Expect = 1.208e-37
Identity = 118/364 (32.42%), Postives = 163/364 (44.78%), Query Frame = 2
Query: 8318 RCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYA-EEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS-ICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFG-------------CRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYL 9358
            +CGG+L+ S G + SP +P  YP +TDC WLI+  E   + LT     LE+H DC YD++ I     E +     K CG   +S    S   N M + FHSD  V++ GF++ Y      D C G++    G I SP YP+ Y +N  C+WT+ V     VSL F L F LE      C++D + + D   V    L   CGN  P N I +S NQ+ +VF +DFN    GF A Y S  C        G   S +   I   +I C      W   L   Y    FF              C Y  + + +   D   + + GQ    +    +T   +K + ++ T RNF  K   F A YL
Sbjct:   13 KCGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKFCG--DVSPPQFSSSWNVMSIIFHSDRHVARKGFLVGYR----KDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVF-LDFQLENN--EGCNFDYVALFDGPTVKHHHLGNYCGNEQPPNTITTS-NQLLVVFKSDFNIGGRGFKAYYFSGECQQFLKDISGNFTSPHYPNIYPNNINCH-----WTITLAAGYRVKLFFPFLELEDRNSLTSMCDY--DSVAVYDGDSEADSVLGQWCGSEQPPSLTSRGNKLLVVLNTDRNFAFK--GFTASYL 357          

HSP 2 Score: 138.658 bits (348), Expect = 3.383e-33
Identity = 98/303 (32.34%), Postives = 149/303 (49.17%), Query Frame = 2
Query: 8147 KIGNGLREPVEDF-GTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFR-----KLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHT-CHYDSLRII--DSNAVTLLSELCGN-IPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI 9025
            KI NG+ E   +  G  C + +    FS+   V++ IF   R V    + V  GY+   CGG+LT   G I SPGYP+ Y +N +C W +      ++ L      LE++  CN+D     Y   FD P  +       CG     N   +   N++ + F SDF++   GF   Y     +  C   + +  G+  SP+YP  YP+N+ C+WTI +  GY+V L F      +R SL + C YDS+ +   DS A ++L + CG+  PPS  + S  N++ +V +TD N   +GF A Y  +
Sbjct:   73 KIYNGISEDEGNLLGKFCGDVSPP-QFSSSWNVMSIIFHSDRHVARKGFLV--GYRKDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFD-----YVALFDGPTVKHHHLGNYCGNEQPPNTITT--SNQLLVVFKSDFNIGGRGFKAYYF----SGECQQFLKDISGNFTSPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCGSEQPPS--LTSRGNKLLVVLNTDRNFAFKGFTASYLGV 359          

HSP 3 Score: 107.842 bits (268), Expect = 4.752e-23
Identity = 98/329 (29.79%), Postives = 152/329 (46.20%), Query Frame = 2
Query: 4790 EFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVK-LQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYF-ETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNL-VANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGDFYLD-DGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDL---SIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF 5746
            E +   C   +S S G + SPN+P  YP++  C+W + V E  S+ L    FE E  + C YDY++I++ I+ D    L   CG ++      FSS  N M I F +D  V+ +GF   Y  + CGG+   +     + SP YP  Y+  +  C W + V+N S + L     F+ F+   NN  C+ D  + + +G           C        I+  + L V+ KS    G   FKA Y  G       F  D  G FTSP YPN    +++C + I  + G  + L    +E   R +  S   +D + + +G +E  S+LG++
Sbjct:    8 ELSGVKCGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKFCGDVS---PPQFSSSWNVMSIIFHSDRHVARKGFLVGYRKDMCGGVLTGLSG--VIASPGYPQDYS-NNAECSWTVQVSNQSLVSL----VFLDFQ-LENNEGCNFD-YVALFDGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYFSGECQ---QFLKDISGNFTSPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQW 321          

HSP 4 Score: 103.605 bits (257), Expect = 8.744e-22
Identity = 101/364 (27.75%), Postives = 155/364 (42.58%), Query Frame = 2
Query: 4460 STKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDE-NYVFQACNRIDDGK--------SIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFL-------LSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKA 5494
            S  +G + S  FP     + DC W      G SV L F   E+E   +C+   I + +     DE N + + C  +   +        SII  S  H     F        G RK           C   ++G  G+I SP YP  Y +N  CSW ++V     + L  LDF+ E +  C +DYV +F   +   VK  HL     N       + +N++L+ F++D  +  RGFKA YF        + E  QFL        SP+YP++Y  P+ I C W +    +   +++FF F+  E  ++  +    +S+ + +G     SV    C       + S G+ L V+L +T  N  FK 
Sbjct:   19 SASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYI-KIYNGISEDEGNLLGKFCGDVSPPQFSSSWNVMSIIFHSDRHVARKGFLV------GYRKDM---------CGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYVALF---DGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYF--------SGECQQFLKDISGNFTSPHYPNIY--PNNINCHWTITL-AAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCGSEQPPSLTSRGNKLLVVL-NTDRNFAFKG 351          

HSP 5 Score: 96.2857 bits (238), Expect = 2.027e-19
Identity = 103/454 (22.69%), Postives = 191/454 (42.07%), Query Frame = 2
Query: 9737 CGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDG-PDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVII---QYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLER----SSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCG-GEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSY-IKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQ 11068
            CGG ++A+ G    + S +    GLY  +  C W I    G +V + F +    LE  +    C YD+I IY+G  +    ++   CGD      ++  NVM +IF +D ++ + GF + +     ++     +T  S ++ SP YP +   +      +  +N++  +++   D ++ ++  C+ D   + D      + +  +C +        +S+  +++    + +G          R F+  Y    C +  K  SG   +        Y +N+ C+ T IT A   R + +F +  LE     +S C YD +    G+  E   VL + CGS  PPS  +  +++ ++  TD++  + G+  +Y+     +I C   E  +       P         G  S + +L   SY I  RF +           T   N+ ++ VS G Q
Sbjct:   14 CGGILSASSGN---VSSPNFP--GLYPYDTDCTWLIVVSEGSSVLLTFHH--FELEYHTD---CAYDYIKIYNGISEDEGNLLGKFCGDVSPPQFSSSWNVMSIIFHSDRHVARKGFLVGY----RKDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQS-LVSLVFLDFQLENNEGCNFDYVALFDGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIG---------GRGFKAYYFSGECQQFLKDISGNFTSPH--YPNIYPNNINCHWT-ITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGD-SEADSVLGQWCGSEQPPSLTSRGNKLLVVLNTDRNFAFKGFTASYLGVVPVNISCTRTEFQIQISRQALPQLERENVYLGNPSCSAQLTETSYKILGRFVNCGTAAQKRQNITMLVNSLYIDVSDGPQ 439          

HSP 6 Score: 93.9745 bits (232), Expect = 1.245e-18
Identity = 85/325 (26.15%), Postives = 140/325 (43.08%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI---FCGNLTNISP--FMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGEL-IAANETDHITITVKDLKIRSSVN--CSLDQFIIQDASLKHENKIEKFCES 10357
            + +PNFP  Y ++ + TW+     G    +     ++E   D C YD++      S     +   FCG+   +SP  F    NV+ + F SD      H     F+      M  CGG +    G  GVI S     +  Y NN  C W +       V ++F +    LE      GC +D++ ++DGP      +   CG++Q  +  T SN + ++F +DFNI   GFK  + +   Q  L     NF+    SP YPN  P ++     + +AA     +     +L+ R+S+   C  D   + D   + ++ + ++C S
Sbjct:   25 VSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTD-CAYDYIKIYNGISEDEGNLLGKFCGD---VSPPQFSSSWNVMSIIFHSD-----RHVARKGFLVGYRKDM--CGGVL---TGLSGVIASPGYPQD--YSNNAECSWTVQVSNQSLVSLVFLD--FQLENNE---GCNFDYVALFDGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYFSGECQQFLKDISGNFT----SPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCGS 324          

HSP 7 Score: 87.8113 bits (216), Expect = 9.829e-17
Identity = 92/372 (24.73%), Postives = 155/372 (41.67%), Query Frame = 2
Query: 4076 CEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVR----ISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-----SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYF 5146
            C   +++SSG + S N    Y     C+W +    GS +L+    F+L        Y +++    IS+    LL K CG+ +    F+SS   + I  ++DR        A +G ++ Y+   C             +  +GVI S  +P   + N +C W  Q      V L F   ++E++  C+   +   ++   V  +++   C       +I    +T N  L  F + D N G R F+  Y F+   C+  +    G   SP+YPN YP+N+ C W + +     + L     E E+     S+C YD V ++   +     L   CG          +S  N++L+   TD   + +GF A Y 
Sbjct:   14 CGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFEL-EYHTDCAYDYIKIYNGISEDEGNLLGKFCGD-VSPPQFSSSWNVMSIIFHSDRHV------ARKGFLVGYRKDMCGGVL---------TGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYV-ALFDGPTVKHHHLGNYCGNEQPPNTI----TTSNQLLVVFKS-DFNIGGRGFKAYY-FSG-ECQQFLKDISGNFTSPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCGSEQ---PPSLTSRGNKLLVVLNTDRNFAFKGFTASYL 357          

HSP 8 Score: 86.6557 bits (213), Expect = 2.295e-16
Identity = 93/369 (25.20%), Postives = 152/369 (41.19%), Query Frame = 2
Query: 9026 CGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF-----FGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGR-SRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAV 10105
            CGG+     G + S N   +      C +LI   E    V+  + +F       C Y   +I   + +  GN L   + CG             + I++ + + H+    F   Y  D    V +      V+ +P +P  Y +NA  +W        + S+      +E + +GCN+D+V+     +     +  +CGN     P  I T N L+V F+SD +      GF A+          C  ++    G +    S    N  +Y NN+ C W I    G+ VK+ F    + LE R S    C YD + +YDG   A  V+   CG +Q  S+T++ N + ++ +TD N    GF  ++  V
Sbjct:   14 CGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGS-SVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLL--GKFCGDVSPPQFSSSWNVMSIIFHS-DRHVARKGFLVGYRKDMCGGVLTGLSG--VIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENN-EGCNFDYVALFDGPTVKHHHLGNYCGN--EQPPNTITTSNQLLVVFKSDFNI--GGRGFKAYYFSGE-----CQQFLKDISGNF---TSPHYPN--IYPNNINCHWTITLAAGYRVKLFFP--FLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCGSEQPPSLTSRGNKLLVVLNTDRNFAFKGFTASYLGV 359          

HSP 9 Score: 69.707 bits (169), Expect = 4.395e-11
Identity = 64/275 (23.27%), Postives = 118/275 (42.91%), Query Frame = 2
Query: 2684 STYEFQSDNYPQNYSGNSHCVYQFY-AETRKIAISFLDFDINDDSECKFDFIKIS---GSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLII--GYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR-----FCGNHAKSGP-TVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEKL-SNSFTCFYSIKV 3469
            S+    S N+P  Y  ++ C +    +E   + ++F  F++   ++C +D+IKI      + G+L  ++C        + + N     + I F S+   A  GF        CGG     + +I   GYP+             Y  N  C+W +     + +  VF  F LE++  C +DY+ L      K      +CGN       T +++L++ F SD ++ G GF   +++ +    C +  +  SG  T+P    +  N+  C ++I +
Sbjct:   21 SSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKFCGDVSPPQFSSSWN----VMSIIFHSDRHVARKGFLVGYRKDMCGGVLTGLSGVIASPGYPQ------------DYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYVALFDGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYFSGE----CQQFLKDISGNFTSPHYPNIYPNNINCHWTITL 275          

HSP 10 Score: 68.1662 bits (165), Expect = 1.280e-10
Identity = 52/179 (29.05%), Postives = 85/179 (47.49%), Query Frame = 2
Query: 7313 CGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVI-PVKESENAVIWSNCN-------SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK----KLKMNQGC 7807
            CGG+L    G ++SPN+P  YP  + C W I     S++ LTF   +L+   +C+   + +   + E E  ++   C        SS+W++ +      IIF ++    RKGF + Y     MCGG  +     + S  YP+  S    C+W   V VS + +V +     +L+ N+GC
Sbjct:   14 CGGILSASSGNVSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKFCGDVSPPQFSSSWNVMS------IIFHSDRHVARKGFLVGY--RKDMCGGVLTGLSGVIASPGYPQDYSNNAECSW--TVQVSNQSLVSLVFLDFQLENNEGC 182          

HSP 11 Score: 65.4698 bits (158), Expect = 1.109e-9
Identity = 56/252 (22.22%), Postives = 107/252 (42.46%), Query Frame = 2
Query: 7037 MTPHFIECKWHFTSPPGTRMQIDFEELVIS-RIICNESFLAFFDGSTTFTQKIGGQNFCGKTN--SIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRI 7768
            + P+  +C W      G+ + + F    +     C   ++  ++G +     + G+ FCG  +     +  NV++I+F +    +   F +  +   CGG+L    G IASP YP +Y   + C W +   + S + L F+D  L+  E C+   + +      ++  + + C N    +  T  + + ++FK++     +GFK  YF  +  C     D      S +YP      + C W I +    R+
Sbjct:   33 LYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGK-FCGDVSPPQFSSSWNVMSIIFHSDRHVARKGFLVGYRKDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYVALFDGPTVKHHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYFSGE--CQQFLKDISGNFTSPHYPNIYPNNINCHWTITLAAGYRV 281          

HSP 12 Score: 63.1586 bits (152), Expect = 4.949e-9
Identity = 62/266 (23.31%), Postives = 106/266 (39.85%), Query Frame = 2
Query: 3098 YERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIH------DNQTKRFCGNHAKSGPTVTHK---LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQ---FKKILINITVSESDGSCFA-IPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRI 3853
            Y  +  CTW I     + +   F  F LE H +CAYDY+++ +       N   +FCG+   S P  +     + I F SD  V+ +GF++ +    R   C       SG+I +P   +  SN+  C ++++V        + ++  +  ++G  F  +      T+K            ++   C   +   T + +  +  +     N G   +   Y S   EC        G+  SP+YP   P N  C W I    G R+
Sbjct:   34 YPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKFCGD--VSPPQFSSSWNVMSIIFHSDRHVARKGFLVGY----RKDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYVALFDGPTVK----------HHHLGNYCGNEQPPNTITTSNQLLVVFKSDFNIGGRGFKAYYFS--GECQQFLKDISGNFTSPHYPNIYPNNINCHWTITLAAGYRV 281          

HSP 13 Score: 58.9214 bits (141), Expect = 9.310e-8
Identity = 78/369 (21.14%), Postives = 150/369 (40.65%), Query Frame = 2
Query: 6236 CEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINK-----TLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHF-------IECKWHFTSPPGTRMQIDFEELVIS-----RIICNESFLAFFDGSTTFTQKIGGQNFCGKTN--SIFTIGNVLTILFKNMDDFSY 7285
            C  I+ A++    ++SPN+P        CTW I+     ++ +    F+LE   +C Y+   +    S++      ++     CG ++  +F    +  +N + I + +D      GF + Y+K         L G + +  YP     N  C++ ++    + +++L  LD     N  C   ++ +      K       CG+  PP+    IT S+ ++V    +F+   R  GF+  Y     EC             + D++ N    +PH+       I C W  T   G R+++ F  L +        +C+   +A +DG +     +G   +CG     S+ + GN L ++     +F++
Sbjct:   14 CGGILSASSGN--VSSPNFPGLYPYDTDCTWLIVVSEGSSVLLTFHHFELEYHTDCAYDYIKIYNGISEDEGNLLGKF-----CGDVSPPQF----SSSWNVMSIIFHSDRHVARKGFLVGYRKDMCGGVLTGLSGVIASPGYPQDYSNNAECSWTVQVSNQS-LVSLVFLDFQLENNEGCNFDYVALFDGPTVKHHHLGNYCGNEQPPN---TITTSNQLLVVFKSDFNIGGR--GFKAYYFSG--EC----------QQFLKDISGN--FTSPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLG--QWCGSEQPPSLTSRGNKLLVVLNTDRNFAF 349          

HSP 14 Score: 54.299 bits (129), Expect = 2.560e-6
Identity = 58/234 (24.79%), Postives = 105/234 (44.87%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAETRK-IAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPN----CAYDYLELIH-----DNQTKRFCGNHAKSGPTVT---HKLVIRFVSDNSVSGEGFIMRFYTV 3358
            S  YPQ+YS N+ C +      +  +++ FLDF + ++  C FD++ +    +   H    YC GN+    T+ ++++   +++ FKS+    G GF+A     +C    FL  K I G      N ++      Y  N  C W IT      +   F    LE   +    C YD + +       D+   ++CG  ++  P++T   +KL++   +D + + +GF   +  V
Sbjct:  142 SPGYPQDYSNNAECSWTVQVSNQSLVSLVFLDFQLENNEGCNFDYVALFDGPTVKHHHLGNYC-GNEQPPNTITTSNQ---LLVVFKSDFNIGGRGFKAYYFSGEC--QQFL--KDISG------NFTSPHYPNIYPNNINCHWTITLAAGYRVKLFFPFLELEDRNSLTSMCDYDSVAVYDGDSEADSVLGQWCG--SEQPPSLTSRGNKLLVVLNTDRNFAFKGFTASYLGV 359          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 155.221 bits (391), Expect = 5.790e-37
Identity = 156/604 (25.83%), Postives = 241/604 (39.90%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNIS------------------LCQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII--DSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLI 9118
            + K  +    CG    D     +S  YP     +  C W+I+V   ++I++    + + +   C+   I  R G   ++ LL   C   +    + T S M IE   S   +   + +   ++CG  I           YP++       +  + +S                   C Y+                    ++ PED  + S      F+SD T    +   F +       E ++    GC +R      +TLG        PG E+       E     + CGGLLT+  G I +PG+P++YP N +C W ++AP    I +  +   LE +  C YD++ +R     DS    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       NG I +                 T G+I SPN+P  YPS   C W I    G++V ++F   F++E+     C YD L     DS+   +LS LCGN  P  P+ S+ N+M L F +D +   +GF A + + CGG    + RQ  + S A     NY G   CE+LI
Sbjct:  348 QAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGT---VNKAGFAANFFKEEDECLKPDNGGCEQR----CVNTLGSF-KCACDPGYELAPDKKSCE-----AACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTE--VPEVITSQYNNMRIEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFN-EFEIEQH--QECAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI 930          

HSP 2 Score: 132.494 bits (332), Expect = 5.143e-30
Identity = 160/679 (23.56%), Postives = 261/679 (38.44%), Query Frame = 2
Query: 8678 TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFKRPY--------------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDT--NVLIVRFQSD--ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTY------------------------------GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY 10471
             C   + ++ G+  SP YP  YPS   C W I V  G K+ L F    DL ++SL  C YD + + D       LL   CG+  P   + S+ ++M + F +  N   +GF A Y++ICGG      G+I S N       S  C + I   E +   V +    F    HD+     LE ++G   N     R CG  + +     S ++ + + + +  +    F A +  +E+              V     FK                              + TP +P  Y  N N  W   AP  Y  S+   + ++E + + C YD+V   +  S+ S     +CG      P +I +  N + + F+SD  +S       F +  +       GC      T+G+Y                              G I S +  +   Y +   C W I A  GH VK+ F  N   +E       C YDH+  +DG     P++  LCG+   + + +  N MYL F +D ++Q+ GF+ T +        +K       L    ++ +N+         LI A     I +T    ++    +C  D   + D      +KI +FC S   E ++ S+ D V+I +      + ++ + + F I Y
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTT-MDLYKSSL--CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLV-STDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGY--SVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVS-DGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEV---PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDK--YPSRKECTWDITATPGHRVKISF--NEFEIEQHQE---CAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST--ECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELY-SAGDAVLIHFH-----SDDTISKKGFHIRY 1009          

HSP 3 Score: 114.39 bits (285), Expect = 1.629e-24
Identity = 146/673 (21.69%), Postives = 264/673 (39.23%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH----EGIVLEYQTQGCMET---------------FYYDPHESDYSTK--------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINC------------SEGPILRAWENEIVDENYVFQACN-RIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLL-------SPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGV 5506
            CG     ++G+ +SP YP   P+ T+C W I  TPG++I++    +    + ++ LC      ++    +K   +   C ++I ++ V  +  + + F++ ++   + F   Y   C   I+  SG+I+S N    Y     C W+++   G  + +    F++    +   Y ++ + D    ++ L+ + CG        ++SN  + ++  +D + +     A+    E   L+    GC +                +   P +              NG I +  +P     N +C W       + + ++F+  E+E +  C            S+  +   +    V E    Q  N RI+      +  S   F   FFS  D     NGG +                     +  ++     CEH++  + G I SPN+P+ YP    C+W++       + +   +FE E+   C YD++E F   ++    L  LCG   N I     S  N+M ++F +D +V  +GF+A +   CGG R+  E+ Q  L         NYP         CEW +VA   E G  I   F  FE      +C  D  + + +G    +      C   P   + S G    V++   S + I K  + +
Sbjct:  358 CGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTM---DLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIE-RHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNN-LWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTV--SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG---NKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGG-RLKAEARQKNLYSHAQFGDNNYPGHTD-----CEWLIVA---ESGYGIELTFTTFE-VEEEADCGYD-YIELYDGYDTGAHKIGRFCGSGPREELYSAGD--AVLIHFHSDDTISKKGFHI 1007          

HSP 4 Score: 105.531 bits (262), Expect = 9.445e-22
Identity = 138/632 (21.84%), Postives = 238/632 (37.66%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFET----EESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAY---------------------GVGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYNT--------EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDA----KVFCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYE 6412
            +C   +  S G   SP YPN YP    C W + V     I   +L+F T    + SLC YDY+E+          L   CG   + I     S ++ M I+FR+      +GF A Y   CGG  ++ +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ +C+ D  L + +G+  NS +    C       I   SN  ++K +   T   A F A +                      +GS                   + CGG     +G  T+P +P     + +CV+ +       I +  E F  E       +D++++R+G +  S L G++          S+  N    +K +++V  +              +  GG     I  +  Y          H N +         +  S  G ++SP +   Y    E TW + A    +++ +F++F + +   + +C   +L  +D + D        CG+ + +  I T     +  +S    +  GF    +           +C   +KA  + + L S       NYP        C W I+ +    +++   +F++E   +C Y+
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKI---VLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGG-EISKDSGQ-IQSPNYPDDYR-PSKECVWRITVSE---GYSVGLSFQVFEIERHD-SCAYD-YLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQ---HQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST----------ECGGRLKAEARQKNLYSHAQFGDNNYPG----HTDCEWLIVAESGYGIELTFTTFEVEEEADCGYD 956          

HSP 5 Score: 97.0561 bits (240), Expect = 3.782e-19
Identity = 157/728 (21.57%), Postives = 259/728 (35.58%), Query Frame = 2
Query: 5432 SNGHYLKVILKSTSGNAIFKAAYGVGSST------------------CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHI--KFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR---------RLDNGQCNRGNLI----IYDSNYDAKV--------FCGSGVIDSA-----IFTPPVTLILSAEG---YRYPGFLIRWNPPVDENFKKIGD---CEYIIKA--TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFK---LSYKKACYKD------------------FRNPL---------------------EGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGR-----HELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFS 7282
            S G +L  IL S   N +  A   +G  T                  CG       G F+SP YPN       CV+ I  +PG  I L+        + S   +D+I++R+G    + LLGRF    + E+   T     +  +WI  RS     +N +   F A Y      E   D G + SP +   Y    E  W +       +  +F  F + R          + +G      LI     YD   D +         F   G ++ A      F      +    G    R    L  +    D  ++   D   CE       T     +T+P +P      + C W ++      + +Q  +F+LE +  CKY+   V    S +              G    +E     T  +N+++I +K+D      GFK    S K  C KD                   RN                        G++ +  +P+K    K CT+ + +    + + ++  +     + +C    L+    + +KT     LCG+ IP   +P+I+  + + +    + S + +  GFQ  +S    ECGGR      +   Y  ++  D N       P   +C+W   +  G  +++ F    V     C   ++  +DG  T   KIG   FCG      +++ G+ + I F + D  S
Sbjct:  314 SRGMFLDTILPSRDENGVRPA---IGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVST-----DSRMWIEFRSS----SNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLH----------GKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITA-TPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIP---EPLISTGNKMYLRFISDASVQRK--GFQATHST---ECGGRLKAEARQKNLYSHAQFGDNN------YPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIG--RFCGSGPREELYSAGDAVLIHFHSDDTIS 1001          

HSP 6 Score: 93.5893 bits (231), Expect = 4.215e-18
Identity = 69/247 (27.94%), Postives = 109/247 (44.13%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   +  + G I SP +P+KYP   +C W I A     ++++     +E H +C YDHL     +   +P   +LCG N I  E L    N+M L F SD SV + GF   +     +  C G +   +   +  N           YP +  C W I    GY + LTF   F++E  +   C YD + + D        +   CG+  P   + S+ + + + F +D   + +GFH +Y S
Sbjct:  779 KEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG-NKIP-EPLISTGNKMYLRFISDASVQRKGFQATH-----STECGGRL---KAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTT-FEVEEEA--DCGYDYIELYDGYDTGAHKIGRFCGS-GPREELYSAGDAVLIHFHSDDTISKKGFHIRYTS 1011          

HSP 7 Score: 88.5817 bits (218), Expect = 1.210e-16
Identity = 69/244 (28.28%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F S  YP  Y   +HCV++       KI ++F   D+   S C +D+I++         L  R+C G+K   + ++++    ++ I F+S+S + G GF A      CGG         I      +    Y ++  Y  +K C W IT      +   F  F +E H +CAYDYLE + D  ++      RFCG +  +   + ++ L ++FVSD +V+  GF   F+
Sbjct:  357 ACGETL---QDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFC-GDKIPEVLVSTD---SRMWIEFRSSSNWVGKGFAAVYEAI-CGGE--------ISKDSGQIQSPNYPDD--YRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLE-VRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFF 581          

HSP 8 Score: 87.0409 bits (214), Expect = 4.191e-16
Identity = 79/275 (28.73%), Postives = 123/275 (44.73%), Query Frame = 2
Query: 2639 SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV------------------------SVFDCGGSFFL-TNKLIIGYPE-SHLNESTY------DEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            S E ACG  +     +     +  +P+ Y  N +CV+Q  A T+ +I++ F  F++  +  CK+D++++ SG S+   L  +YC     E+IT   N+    + I FKS++T +  GF+A                           V  C   F L  NK      E  H   ST       +   +Y   K CTW+IT      +   F++F +E H  CAYD+LE    +  K     R CGN     P ++  +K+ +RF+SD SV  +GF
Sbjct:  622 SCEAACGGLLTKLNGT---ITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNN----MRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPE-PLISTGNKMYLRFISDASVQRKGF 888          

HSP 9 Score: 79.7221 bits (195), Expect = 6.132e-14
Identity = 88/466 (18.88%), Postives = 173/466 (37.12%), Query Frame = 2
Query: 9830 CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGEL---IAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV-------------------------FISSHDKVII-------QYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENF-----KQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            C W+I+   G   K++    ++ L   S    C YD+I + DG     P++   CGD   + + +  + M++ F +  N    GF   + A+         ++  S  ++SP YP+    D R   E    I  +E   + ++ +  +I    +C+ D   ++D   ++   I +FC     E +                         F    D+ +        Q  V  + +   A D  ++++ +  +C   E A  G +  +          K+Y  N  C   ++ P    R    F+ F LE +  C YDY++   G   + + +  K CG+ +P    +  + + + F +D +++  G+   +  ++D   K                                     C  +I+  +G I+SP +   Y    EC+W+I       +K  F + ++
Sbjct:  384 CVWRISVTPGE--KIVLNFTTMDLYKSSL---CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGE-----ISKDSGQIQSPNYPD----DYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSC---EAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPT-QYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSK-LHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEI 830          

HSP 10 Score: 78.9518 bits (193), Expect = 1.323e-13
Identity = 61/242 (25.21%), Postives = 100/242 (41.32%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW   A  G+   I+    +IE+  + C YD +      S+ +  +   CGN     P +   N + +RF SD S      GF A  +        CGG + A      +       +N  Y  +  C+W I A  G+ +++ F    +  E       C YD+I +YDG D+    I   CG    + + +  + + + F +D  I K GF + +T+   Q  L
Sbjct:  793 TISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQE-CAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDAS--VQRKGFQATHSTE------CGGRLKAEARQKNLYSHAQFGDNN-YPGHTDCEWLIVAESGYGIELTFTTFEVEEEAD-----CGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTKFQEAL 1018          

HSP 11 Score: 77.7962 bits (190), Expect = 2.666e-13
Identity = 63/239 (26.36%), Postives = 100/239 (41.84%), Query Frame = 2
Query: 2684 STYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            +T    S N+P  Y     C +   A    ++ ISF +F+I    EC +D ++     S+   +  R C     E +    N    K+ + F S+++    GF+A  S  +CGG      +    Y  +   ++ Y   T       C W I       I   F  F +E   +C YDY+EL     T      RFCG    SGP     +    ++I F SD+++S +GF +R+ + K
Sbjct:  790 TTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGN----KMYLRFISDASVQRKGFQATHST-ECGGRLKAEARQKNLYSHAQFGDNNYPGHTD------CEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCG----SGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTK 1013          

HSP 12 Score: 77.411 bits (189), Expect = 3.238e-13
Identity = 86/380 (22.63%), Postives = 146/380 (38.42%), Query Frame = 2
Query: 4139 CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH-------------------------------EGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQAC-NRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            C W++ +    +I +Q + F+L    N  C Y +V +       + L  K CG ++     TS    +RIE  +D +      +AH                                G +L      C E       E    +  G I S  +P+   +  +C W+    PG  VK+ F+  E+E    C+    L A++ +      + + C N+I +     + S+ +  YL+F S  D +   + FQ T+   +  C   +          ++  F    YP +  C W +  +    I L    FE EE   C YDY+E++   +    K+   CG      +    S  + +LI F +D T+S +GF  +Y  T
Sbjct:  653 CVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEV-PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEA----ECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDH-LEAFDGDSDKTPILSRLCGNKIPE----PLISTGNKMYLRFIS--DASVQRKGFQATH---STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGP---REELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          

HSP 13 Score: 71.633 bits (174), Expect = 2.099e-11
Identity = 131/599 (21.87%), Postives = 225/599 (37.56%), Query Frame = 2
Query: 6590 KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSS-WIIVNLFGNFSSESRY--SGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDD----------------FSYFRLKVKIG------------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GG-----------------------------EYSDPERELNST-------NYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCF--RIRA-RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYP 8071
            KL    AC +  ++ + G+  +  YPN      +C + I  +     +LN T +DL   +   C   ++++      K       CG  IP  L  + T+S  WI       F S S +   GF  +Y   +  CGG  E+++  DS  +   +      P   EC W  T   G  + + F+   I R   C   +L   DG +  +  IG   FCG  K   I +  N L +                 FK  D+                   F+     G            +CGGLL +  G I +P +P  YPP  +C+WQ+   +   I + F   +L+ N  C    + V     S++ +    C +   ++ T +Y+ +RI FK++   ++KGFK  +F +   C    GG                             + ++ E +++ST       N+P        CTW I      R+ +     +++ +Q C    + A  G   ++ +L  +C + +    I T + M   F S A++    + +   + CG  +     +  +        S  Q+  +NYP
Sbjct:  351 KLYRCPACGETLQDSV-GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSS--LCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVL--VSTDSRMWI------EFRSSSNWVGKGFAAVY---EAICGG--EISK--DSGQIQSPNYPDDYRPS-KECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIG--RFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNL-------YSHAQFGDNNYP 921          

HSP 14 Score: 64.6994 bits (156), Expect = 2.515e-9
Identity = 59/205 (28.78%), Postives = 90/205 (43.90%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGF 11176
            I+  P  +    F   +L +SS C YDYI+   G    +  +L + CG  IP   V+  SR+ + F +  +    G+   Y         CGGEI  DSG I SP +  +Y  S EC W I +     +   F   ++  + S         D+++V  G   N  L  ++CGY   D+   I S+S  +  K ++ G    AGF
Sbjct:  388 ISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGY-WRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY------EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCA------YDYLEVRDGLSENSPLIGRFCGY---DKPEDIRSTSNNLWMKFVSDGTVNKAGF 576          

HSP 15 Score: 64.3142 bits (155), Expect = 3.295e-9
Identity = 122/554 (22.02%), Postives = 209/554 (37.73%), Query Frame = 2
Query: 6245 IIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNP--IFSFIEY--------------VAMVKCGSLNNSEFNVFQTYLFNSIKITYKADE----------FDPF-----PGFKLSY-KKACYK---DFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMYSKKDEEC-----GGRHE--------LTRYQDSRIVDMNSN---------RLHMT-------------PHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKI---GSCGGLLH---RRQGYIASPNYPL-NYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTW-DIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            I K + Q Q   SPNYP+     + C W I      ++ +    F++E    C Y+   V    S+N   I  F  Y              +  V  G++N + F       F       K D              F     PG++L+  KK+C          L G++    +P +   NKNC + ++        +   A +L    N  C   ++++ +       ++   CG+ +P     +IT+      N+   F S++  S  GF+  +    +EC     G +HE        + + ++  I+  N +         ++H T             P   EC W  T+ PG R++I F E  I +   C    L  FDG +  T  +     CG      + + GN + + F  + D S  R   +      CGG L    R++   +   +   NYP  + C W I   S   I LTF   +++E  +C    + +    ++    I   C S    ++Y+    V I F ++   ++KGF ++Y
Sbjct:  475 ISKDSGQIQ---SPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGF---AANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPE----VITSQ---YNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPIL--SRLCGNKIPEPLISTGNKMYLRF--ISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRY 1009          

HSP 16 Score: 63.929 bits (154), Expect = 4.898e-9
Identity = 37/142 (26.06%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS---GVITSPGFGTNYYES-GECSWNIKLVSNSYIKWRFTDMQL 10996
            IT  P  R +  F  F +E+   CAYD+++   G+  ++  +L ++CG+ IP   ++  +++ + F++D S+   G+  T+      S +CGG +  ++    + +   FG N Y    +C W I   S   I+  FT  ++
Sbjct:  813 ITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGD-SDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATH------STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEV 947          

HSP 17 Score: 58.5362 bits (140), Expect = 1.694e-7
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 2
Query: 7274 DFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEY-STVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            D S  +   +  +CG  L    G  +SP YP  YP  + C+W+IS      I L F   DL ++  C    + V      +  ++   C     ++     S + I F++++    KGF   Y   + +CGGE S    ++ S NYP        C W+I V
Sbjct:  345 DISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY---EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITV 503          

HSP 18 Score: 55.0694 bits (131), Expect = 2.183e-6
Identity = 75/353 (21.25%), Postives = 144/353 (40.79%), Query Frame = 2
Query: 3722 SLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVF-------------EEQSVHVIFQNLASTKYRFRLYYTQ------DCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCY-----SFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            S +  CG +     G I +P +P   P N  C W++ +    RI ++                  +RSG   ++KL    C  + P  + +T++        K  N V S++  K H F             + + ++ I   +   +  F L+  +      +CE  I S++G I S N   +Y     C+W +++  G ++ I  ++F++   Q+ +C      +F   SD++  +L + CGN++     ++ N  + +   +D S         +G    + T+ C         +++   KN +   AQF   N   + DC+W      G+ ++L F   E+E   +C 
Sbjct:  622 SCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVP--EVITSQYNNMRIEFKSDNTV-SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIE--QHQECAYDHLEAFDGDSDKT-PILSRLCGNKIPEPLISTGN-KMYLRFISDASVQ------RKGFQATHSTE-CGGRL-----KAEARQKN-LYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCG 954          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 155.221 bits (391), Expect = 5.790e-37
Identity = 156/604 (25.83%), Postives = 241/604 (39.90%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNIS------------------LCQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII--DSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLI 9118
            + K  +    CG    D     +S  YP     +  C W+I+V   ++I++    + + +   C+   I  R G   ++ LL   C   +    + T S M IE   S   +   + +   ++CG  I           YP++       +  + +S                   C Y+                    ++ PED  + S      F+SD T    +   F +       E ++    GC +R      +TLG        PG E+       E     + CGGLLT+  G I +PG+P++YP N +C W ++AP    I +  +   LE +  C YD++ +R     DS    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       NG I +                 T G+I SPN+P  YPS   C W I    G++V ++F   F++E+     C YD L     DS+   +LS LCGN  P  P+ S+ N+M L F +D +   +GF A + + CGG    + RQ  + S A     NY G   CE+LI
Sbjct:  348 QAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGT---VNKAGFAANFFKEEDECLKPDNGGCEQR----CVNTLGSF-KCACDPGYELAPDKKSCE-----AACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTE--VPEVITSQYNNMRIEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFN-EFEIEQH--QECAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI 930          

HSP 2 Score: 132.494 bits (332), Expect = 5.143e-30
Identity = 160/679 (23.56%), Postives = 261/679 (38.44%), Query Frame = 2
Query: 8678 TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFKRPY--------------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDT--NVLIVRFQSD--ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTY------------------------------GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY 10471
             C   + ++ G+  SP YP  YPS   C W I V  G K+ L F    DL ++SL  C YD + + D       LL   CG+  P   + S+ ++M + F +  N   +GF A Y++ICGG      G+I S N       S  C + I   E +   V +    F    HD+     LE ++G   N     R CG  + +     S ++ + + + +  +    F A +  +E+              V     FK                              + TP +P  Y  N N  W   AP  Y  S+   + ++E + + C YD+V   +  S+ S     +CG      P +I +  N + + F+SD  +S       F +  +       GC      T+G+Y                              G I S +  +   Y +   C W I A  GH VK+ F  N   +E       C YDH+  +DG     P++  LCG+   + + +  N MYL F +D ++Q+ GF+ T +        +K       L    ++ +N+         LI A     I +T    ++    +C  D   + D      +KI +FC S   E ++ S+ D V+I +      + ++ + + F I Y
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTT-MDLYKSSL--CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLV-STDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGY--SVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVS-DGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEV---PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDK--YPSRKECTWDITATPGHRVKISF--NEFEIEQHQE---CAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST--ECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELY-SAGDAVLIHFH-----SDDTISKKGFHIRY 1009          

HSP 3 Score: 114.39 bits (285), Expect = 1.629e-24
Identity = 146/673 (21.69%), Postives = 264/673 (39.23%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH----EGIVLEYQTQGCMET---------------FYYDPHESDYSTK--------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINC------------SEGPILRAWENEIVDENYVFQACN-RIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLL-------SPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGV 5506
            CG     ++G+ +SP YP   P+ T+C W I  TPG++I++    +    + ++ LC      ++    +K   +   C ++I ++ V  +  + + F++ ++   + F   Y   C   I+  SG+I+S N    Y     C W+++   G  + +    F++    +   Y ++ + D    ++ L+ + CG        ++SN  + ++  +D + +     A+    E   L+    GC +                +   P +              NG I +  +P     N +C W       + + ++F+  E+E +  C            S+  +   +    V E    Q  N RI+      +  S   F   FFS  D     NGG +                     +  ++     CEH++  + G I SPN+P+ YP    C+W++       + +   +FE E+   C YD++E F   ++    L  LCG   N I     S  N+M ++F +D +V  +GF+A +   CGG R+  E+ Q  L         NYP         CEW +VA   E G  I   F  FE      +C  D  + + +G    +      C   P   + S G    V++   S + I K  + +
Sbjct:  358 CGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTM---DLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIE-RHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNN-LWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTV--SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG---NKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGG-RLKAEARQKNLYSHAQFGDNNYPGHTD-----CEWLIVA---ESGYGIELTFTTFE-VEEEADCGYD-YIELYDGYDTGAHKIGRFCGSGPREELYSAGD--AVLIHFHSDDTISKKGFHI 1007          

HSP 4 Score: 105.531 bits (262), Expect = 9.445e-22
Identity = 138/632 (21.84%), Postives = 238/632 (37.66%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFET----EESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAY---------------------GVGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYNT--------EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDA----KVFCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYE 6412
            +C   +  S G   SP YPN YP    C W + V     I   +L+F T    + SLC YDY+E+          L   CG   + I     S ++ M I+FR+      +GF A Y   CGG  ++ +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ +C+ D  L + +G+  NS +    C       I   SN  ++K +   T   A F A +                      +GS                   + CGG     +G  T+P +P     + +CV+ +       I +  E F  E       +D++++R+G +  S L G++          S+  N    +K +++V  +              +  GG     I  +  Y          H N +         +  S  G ++SP +   Y    E TW + A    +++ +F++F + +   + +C   +L  +D + D        CG+ + +  I T     +  +S    +  GF    +           +C   +KA  + + L S       NYP        C W I+ +    +++   +F++E   +C Y+
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKI---VLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGG-EISKDSGQ-IQSPNYPDDYR-PSKECVWRITVSE---GYSVGLSFQVFEIERHD-SCAYD-YLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQ---HQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST----------ECGGRLKAEARQKNLYSHAQFGDNNYPG----HTDCEWLIVAESGYGIELTFTTFEVEEEADCGYD 956          

HSP 5 Score: 97.0561 bits (240), Expect = 3.782e-19
Identity = 157/728 (21.57%), Postives = 259/728 (35.58%), Query Frame = 2
Query: 5432 SNGHYLKVILKSTSGNAIFKAAYGVGSST------------------CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHI--KFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR---------RLDNGQCNRGNLI----IYDSNYDAKV--------FCGSGVIDSA-----IFTPPVTLILSAEG---YRYPGFLIRWNPPVDENFKKIGD---CEYIIKA--TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFK---LSYKKACYKD------------------FRNPL---------------------EGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGR-----HELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFS 7282
            S G +L  IL S   N +  A   +G  T                  CG       G F+SP YPN       CV+ I  +PG  I L+        + S   +D+I++R+G    + LLGRF    + E+   T     +  +WI  RS     +N +   F A Y      E   D G + SP +   Y    E  W +       +  +F  F + R          + +G      LI     YD   D +         F   G ++ A      F      +    G    R    L  +    D  ++   D   CE       T     +T+P +P      + C W ++      + +Q  +F+LE +  CKY+   V    S +              G    +E     T  +N+++I +K+D      GFK    S K  C KD                   RN                        G++ +  +P+K    K CT+ + +    + + ++  +     + +C    L+    + +KT     LCG+ IP   +P+I+  + + +    + S + +  GFQ  +S    ECGGR      +   Y  ++  D N       P   +C+W   +  G  +++ F    V     C   ++  +DG  T   KIG   FCG      +++ G+ + I F + D  S
Sbjct:  314 SRGMFLDTILPSRDENGVRPA---IGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVST-----DSRMWIEFRSS----SNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLH----------GKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITA-TPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIP---EPLISTGNKMYLRFISDASVQRK--GFQATHST---ECGGRLKAEARQKNLYSHAQFGDNN------YPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIG--RFCGSGPREELYSAGDAVLIHFHSDDTIS 1001          

HSP 6 Score: 93.5893 bits (231), Expect = 4.215e-18
Identity = 69/247 (27.94%), Postives = 109/247 (44.13%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   +  + G I SP +P+KYP   +C W I A     ++++     +E H +C YDHL     +   +P   +LCG N I  E L    N+M L F SD SV + GF   +     +  C G +   +   +  N           YP +  C W I    GY + LTF   F++E  +   C YD + + D        +   CG+  P   + S+ + + + F +D   + +GFH +Y S
Sbjct:  779 KEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG-NKIP-EPLISTGNKMYLRFISDASVQRKGFQATH-----STECGGRL---KAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTT-FEVEEEA--DCGYDYIELYDGYDTGAHKIGRFCGS-GPREELYSAGDAVLIHFHSDDTISKKGFHIRYTS 1011          

HSP 7 Score: 88.5817 bits (218), Expect = 1.210e-16
Identity = 69/244 (28.28%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F S  YP  Y   +HCV++       KI ++F   D+   S C +D+I++         L  R+C G+K   + ++++    ++ I F+S+S + G GF A      CGG         I      +    Y ++  Y  +K C W IT      +   F  F +E H +CAYDYLE + D  ++      RFCG +  +   + ++ L ++FVSD +V+  GF   F+
Sbjct:  357 ACGETL---QDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFC-GDKIPEVLVSTD---SRMWIEFRSSSNWVGKGFAAVYEAI-CGGE--------ISKDSGQIQSPNYPDD--YRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLE-VRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFF 581          

HSP 8 Score: 87.0409 bits (214), Expect = 4.191e-16
Identity = 79/275 (28.73%), Postives = 123/275 (44.73%), Query Frame = 2
Query: 2639 SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV------------------------SVFDCGGSFFL-TNKLIIGYPE-SHLNESTY------DEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            S E ACG  +     +     +  +P+ Y  N +CV+Q  A T+ +I++ F  F++  +  CK+D++++ SG S+   L  +YC     E+IT   N+    + I FKS++T +  GF+A                           V  C   F L  NK      E  H   ST       +   +Y   K CTW+IT      +   F++F +E H  CAYD+LE    +  K     R CGN     P ++  +K+ +RF+SD SV  +GF
Sbjct:  622 SCEAACGGLLTKLNGT---ITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNN----MRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPE-PLISTGNKMYLRFISDASVQRKGF 888          

HSP 9 Score: 79.7221 bits (195), Expect = 6.132e-14
Identity = 88/466 (18.88%), Postives = 173/466 (37.12%), Query Frame = 2
Query: 9830 CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGEL---IAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV-------------------------FISSHDKVII-------QYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENF-----KQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            C W+I+   G   K++    ++ L   S    C YD+I + DG     P++   CGD   + + +  + M++ F +  N    GF   + A+         ++  S  ++SP YP+    D R   E    I  +E   + ++ +  +I    +C+ D   ++D   ++   I +FC     E +                         F    D+ +        Q  V  + +   A D  ++++ +  +C   E A  G +  +          K+Y  N  C   ++ P    R    F+ F LE +  C YDY++   G   + + +  K CG+ +P    +  + + + F +D +++  G+   +  ++D   K                                     C  +I+  +G I+SP +   Y    EC+W+I       +K  F + ++
Sbjct:  384 CVWRISVTPGE--KIVLNFTTMDLYKSSL---CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGE-----ISKDSGQIQSPNYPD----DYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSC---EAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPT-QYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSK-LHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEI 830          

HSP 10 Score: 78.9518 bits (193), Expect = 1.323e-13
Identity = 61/242 (25.21%), Postives = 100/242 (41.32%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW   A  G+   I+    +IE+  + C YD +      S+ +  +   CGN     P +   N + +RF SD S      GF A  +        CGG + A      +       +N  Y  +  C+W I A  G+ +++ F    +  E       C YD+I +YDG D+    I   CG    + + +  + + + F +D  I K GF + +T+   Q  L
Sbjct:  793 TISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQE-CAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDAS--VQRKGFQATHSTE------CGGRLKAEARQKNLYSHAQFGDNN-YPGHTDCEWLIVAESGYGIELTFTTFEVEEEAD-----CGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTKFQEAL 1018          

HSP 11 Score: 77.7962 bits (190), Expect = 2.666e-13
Identity = 63/239 (26.36%), Postives = 100/239 (41.84%), Query Frame = 2
Query: 2684 STYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            +T    S N+P  Y     C +   A    ++ ISF +F+I    EC +D ++     S+   +  R C     E +    N    K+ + F S+++    GF+A  S  +CGG      +    Y  +   ++ Y   T       C W I       I   F  F +E   +C YDY+EL     T      RFCG    SGP     +    ++I F SD+++S +GF +R+ + K
Sbjct:  790 TTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGN----KMYLRFISDASVQRKGFQATHST-ECGGRLKAEARQKNLYSHAQFGDNNYPGHTD------CEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCG----SGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTK 1013          

HSP 12 Score: 77.411 bits (189), Expect = 3.238e-13
Identity = 86/380 (22.63%), Postives = 146/380 (38.42%), Query Frame = 2
Query: 4139 CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH-------------------------------EGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQAC-NRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            C W++ +    +I +Q + F+L    N  C Y +V +       + L  K CG ++     TS    +RIE  +D +      +AH                                G +L      C E       E    +  G I S  +P+   +  +C W+    PG  VK+ F+  E+E    C+    L A++ +      + + C N+I +     + S+ +  YL+F S  D +   + FQ T+   +  C   +          ++  F    YP +  C W +  +    I L    FE EE   C YDY+E++   +    K+   CG      +    S  + +LI F +D T+S +GF  +Y  T
Sbjct:  653 CVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEV-PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEA----ECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDH-LEAFDGDSDKTPILSRLCGNKIPE----PLISTGNKMYLRFIS--DASVQRKGFQATH---STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGP---REELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          

HSP 13 Score: 71.633 bits (174), Expect = 2.099e-11
Identity = 131/599 (21.87%), Postives = 225/599 (37.56%), Query Frame = 2
Query: 6590 KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSS-WIIVNLFGNFSSESRY--SGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDD----------------FSYFRLKVKIG------------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GG-----------------------------EYSDPERELNST-------NYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCF--RIRA-RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYP 8071
            KL    AC +  ++ + G+  +  YPN      +C + I  +     +LN T +DL   +   C   ++++      K       CG  IP  L  + T+S  WI       F S S +   GF  +Y   +  CGG  E+++  DS  +   +      P   EC W  T   G  + + F+   I R   C   +L   DG +  +  IG   FCG  K   I +  N L +                 FK  D+                   F+     G            +CGGLL +  G I +P +P  YPP  +C+WQ+   +   I + F   +L+ N  C    + V     S++ +    C +   ++ T +Y+ +RI FK++   ++KGFK  +F +   C    GG                             + ++ E +++ST       N+P        CTW I      R+ +     +++ +Q C    + A  G   ++ +L  +C + +    I T + M   F S A++    + +   + CG  +     +  +        S  Q+  +NYP
Sbjct:  351 KLYRCPACGETLQDSV-GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSS--LCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVL--VSTDSRMWI------EFRSSSNWVGKGFAAVY---EAICGG--EISK--DSGQIQSPNYPDDYRPS-KECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIG--RFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNL-------YSHAQFGDNNYP 921          

HSP 14 Score: 64.6994 bits (156), Expect = 2.515e-9
Identity = 59/205 (28.78%), Postives = 90/205 (43.90%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGF 11176
            I+  P  +    F   +L +SS C YDYI+   G    +  +L + CG  IP   V+  SR+ + F +  +    G+   Y         CGGEI  DSG I SP +  +Y  S EC W I +     +   F   ++  + S         D+++V  G   N  L  ++CGY   D+   I S+S  +  K ++ G    AGF
Sbjct:  388 ISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGY-WRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY------EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCA------YDYLEVRDGLSENSPLIGRFCGY---DKPEDIRSTSNNLWMKFVSDGTVNKAGF 576          

HSP 15 Score: 64.3142 bits (155), Expect = 3.295e-9
Identity = 122/554 (22.02%), Postives = 209/554 (37.73%), Query Frame = 2
Query: 6245 IIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNP--IFSFIEY--------------VAMVKCGSLNNSEFNVFQTYLFNSIKITYKADE----------FDPF-----PGFKLSY-KKACYK---DFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMYSKKDEEC-----GGRHE--------LTRYQDSRIVDMNSN---------RLHMT-------------PHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKI---GSCGGLLH---RRQGYIASPNYPL-NYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTW-DIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            I K + Q Q   SPNYP+     + C W I      ++ +    F++E    C Y+   V    S+N   I  F  Y              +  V  G++N + F       F       K D              F     PG++L+  KK+C          L G++    +P +   NKNC + ++        +   A +L    N  C   ++++ +       ++   CG+ +P     +IT+      N+   F S++  S  GF+  +    +EC     G +HE        + + ++  I+  N +         ++H T             P   EC W  T+ PG R++I F E  I +   C    L  FDG +  T  +     CG      + + GN + + F  + D S  R   +      CGG L    R++   +   +   NYP  + C W I   S   I LTF   +++E  +C    + +    ++    I   C S    ++Y+    V I F ++   ++KGF ++Y
Sbjct:  475 ISKDSGQIQ---SPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGF---AANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPE----VITSQ---YNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPIL--SRLCGNKIPEPLISTGNKMYLRF--ISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRY 1009          

HSP 16 Score: 63.929 bits (154), Expect = 4.898e-9
Identity = 37/142 (26.06%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS---GVITSPGFGTNYYES-GECSWNIKLVSNSYIKWRFTDMQL 10996
            IT  P  R +  F  F +E+   CAYD+++   G+  ++  +L ++CG+ IP   ++  +++ + F++D S+   G+  T+      S +CGG +  ++    + +   FG N Y    +C W I   S   I+  FT  ++
Sbjct:  813 ITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGD-SDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATH------STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEV 947          

HSP 17 Score: 58.5362 bits (140), Expect = 1.694e-7
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 2
Query: 7274 DFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEY-STVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            D S  +   +  +CG  L    G  +SP YP  YP  + C+W+IS      I L F   DL ++  C    + V      +  ++   C     ++     S + I F++++    KGF   Y   + +CGGE S    ++ S NYP        C W+I V
Sbjct:  345 DISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY---EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITV 503          

HSP 18 Score: 55.0694 bits (131), Expect = 2.183e-6
Identity = 75/353 (21.25%), Postives = 144/353 (40.79%), Query Frame = 2
Query: 3722 SLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVF-------------EEQSVHVIFQNLASTKYRFRLYYTQ------DCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCY-----SFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            S +  CG +     G I +P +P   P N  C W++ +    RI ++                  +RSG   ++KL    C  + P  + +T++        K  N V S++  K H F             + + ++ I   +   +  F L+  +      +CE  I S++G I S N   +Y     C+W +++  G ++ I  ++F++   Q+ +C      +F   SD++  +L + CGN++     ++ N  + +   +D S         +G    + T+ C         +++   KN +   AQF   N   + DC+W      G+ ++L F   E+E   +C 
Sbjct:  622 SCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVP--EVITSQYNNMRIEFKSDNTV-SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIE--QHQECAYDHLEAFDGDSDKT-PILSRLCGNKIPEPLISTGN-KMYLRFISDASVQ------RKGFQATHSTE-CGGRL-----KAEARQKN-LYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCG 954          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Zebrafish
Match: tll1 (tolloid-like 1 [Source:NCBI gene;Acc:474335])

HSP 1 Score: 155.221 bits (391), Expect = 5.790e-37
Identity = 156/604 (25.83%), Postives = 241/604 (39.90%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNIS------------------LCQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII--DSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLI 9118
            + K  +    CG    D     +S  YP     +  C W+I+V   ++I++    + + +   C+   I  R G   ++ LL   C   +    + T S M IE   S   +   + +   ++CG  I           YP++       +  + +S                   C Y+                    ++ PED  + S      F+SD T    +   F +       E ++    GC +R      +TLG        PG E+       E     + CGGLLT+  G I +PG+P++YP N +C W ++AP    I +  +   LE +  C YD++ +R     DS    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       NG I +                 T G+I SPN+P  YPS   C W I    G++V ++F   F++E+     C YD L     DS+   +LS LCGN  P  P+ S+ N+M L F +D +   +GF A + + CGG    + RQ  + S A     NY G   CE+LI
Sbjct:  348 QAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGT---VNKAGFAANFFKEEDECLKPDNGGCEQR----CVNTLGSF-KCACDPGYELAPDKKSCE-----AACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTE--VPEVITSQYNNMRIEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFN-EFEIEQH--QECAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLI 930          

HSP 2 Score: 132.494 bits (332), Expect = 5.143e-30
Identity = 160/679 (23.56%), Postives = 261/679 (38.44%), Query Frame = 2
Query: 8678 TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFKRPY--------------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDT--NVLIVRFQSD--ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTY------------------------------GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISY 10471
             C   + ++ G+  SP YP  YPS   C W I V  G K+ L F    DL ++SL  C YD + + D       LL   CG+  P   + S+ ++M + F +  N   +GF A Y++ICGG      G+I S N       S  C + I   E +   V +    F    HD+     LE ++G   N     R CG  + +     S ++ + + + +  +    F A +  +E+              V     FK                              + TP +P  Y  N N  W   AP  Y  S+   + ++E + + C YD+V   +  S+ S     +CG      P +I +  N + + F+SD  +S       F +  +       GC      T+G+Y                              G I S +  +   Y +   C W I A  GH VK+ F  N   +E       C YDH+  +DG     P++  LCG+   + + +  N MYL F +D ++Q+ GF+ T +        +K       L    ++ +N+         LI A     I +T    ++    +C  D   + D      +KI +FC S   E ++ S+ D V+I +      + ++ + + F I Y
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTT-MDLYKSSL--CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLV-STDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGY--SVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVS-DGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEV---PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDK--YPSRKECTWDITATPGHRVKISF--NEFEIEQHQE---CAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST--ECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELY-SAGDAVLIHFH-----SDDTISKKGFHIRY 1009          

HSP 3 Score: 114.39 bits (285), Expect = 1.629e-24
Identity = 146/673 (21.69%), Postives = 264/673 (39.23%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH----EGIVLEYQTQGCMET---------------FYYDPHESDYSTK--------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINC------------SEGPILRAWENEIVDENYVFQACN-RIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLL-------SPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGV 5506
            CG     ++G+ +SP YP   P+ T+C W I  TPG++I++    +    + ++ LC      ++    +K   +   C ++I ++ V  +  + + F++ ++   + F   Y   C   I+  SG+I+S N    Y     C W+++   G  + +    F++    +   Y ++ + D    ++ L+ + CG        ++SN  + ++  +D + +     A+    E   L+    GC +                +   P +              NG I +  +P     N +C W       + + ++F+  E+E +  C            S+  +   +    V E    Q  N RI+      +  S   F   FFS  D     NGG +                     +  ++     CEH++  + G I SPN+P+ YP    C+W++       + +   +FE E+   C YD++E F   ++    L  LCG   N I     S  N+M ++F +D +V  +GF+A +   CGG R+  E+ Q  L         NYP         CEW +VA   E G  I   F  FE      +C  D  + + +G    +      C   P   + S G    V++   S + I K  + +
Sbjct:  358 CGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTM---DLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIE-RHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNN-LWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTV--SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG---NKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGG-RLKAEARQKNLYSHAQFGDNNYPGHTD-----CEWLIVA---ESGYGIELTFTTFE-VEEEADCGYD-YIELYDGYDTGAHKIGRFCGSGPREELYSAGD--AVLIHFHSDDTISKKGFHI 1007          

HSP 4 Score: 105.531 bits (262), Expect = 9.445e-22
Identity = 138/632 (21.84%), Postives = 238/632 (37.66%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFET----EESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAY---------------------GVGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYNT--------EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDA----KVFCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYE 6412
            +C   +  S G   SP YPN YP    C W + V     I   +L+F T    + SLC YDY+E+          L   CG   + I     S ++ M I+FR+      +GF A Y   CGG  ++ +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ +C+ D  L + +G+  NS +    C       I   SN  ++K +   T   A F A +                      +GS                   + CGG     +G  T+P +P     + +CV+ +       I +  E F  E       +D++++R+G +  S L G++          S+  N    +K +++V  +              +  GG     I  +  Y          H N +         +  S  G ++SP +   Y    E TW + A    +++ +F++F + +   + +C   +L  +D + D        CG+ + +  I T     +  +S    +  GF    +           +C   +KA  + + L S       NYP        C W I+ +    +++   +F++E   +C Y+
Sbjct:  357 ACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKI---VLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCG---DKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGG-EISKDSGQ-IQSPNYPDDYR-PSKECVWRITVSE---GYSVGLSFQVFEIERHD-SCAYD-YLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGN-EVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQ---HQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHST----------ECGGRLKAEARQKNLYSHAQFGDNNYPG----HTDCEWLIVAESGYGIELTFTTFEVEEEADCGYD 956          

HSP 5 Score: 97.0561 bits (240), Expect = 3.782e-19
Identity = 157/728 (21.57%), Postives = 259/728 (35.58%), Query Frame = 2
Query: 5432 SNGHYLKVILKSTSGNAIFKAAYGVGSST------------------CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHI--KFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR---------RLDNGQCNRGNLI----IYDSNYDAKV--------FCGSGVIDSA-----IFTPPVTLILSAEG---YRYPGFLIRWNPPVDENFKKIGD---CEYIIKA--TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFK---LSYKKACYKD------------------FRNPL---------------------EGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGR-----HELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFS 7282
            S G +L  IL S   N +  A   +G  T                  CG       G F+SP YPN       CV+ I  +PG  I L+        + S   +D+I++R+G    + LLGRF    + E+   T     +  +WI  RS     +N +   F A Y      E   D G + SP +   Y    E  W +       +  +F  F + R          + +G      LI     YD   D +         F   G ++ A      F      +    G    R    L  +    D  ++   D   CE       T     +T+P +P      + C W ++      + +Q  +F+LE +  CKY+   V    S +              G    +E     T  +N+++I +K+D      GFK    S K  C KD                   RN                        G++ +  +P+K    K CT+ + +    + + ++  +     + +C    L+    + +KT     LCG+ IP   +P+I+  + + +    + S + +  GFQ  +S    ECGGR      +   Y  ++  D N       P   +C+W   +  G  +++ F    V     C   ++  +DG  T   KIG   FCG      +++ G+ + I F + D  S
Sbjct:  314 SRGMFLDTILPSRDENGVRPA---IGQRTRLSKGDISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVST-----DSRMWIEFRSS----SNWVGKGFAAVYEAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLH----------GKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITA-TPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIP---EPLISTGNKMYLRFISDASVQRK--GFQATHST---ECGGRLKAEARQKNLYSHAQFGDNN------YPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIG--RFCGSGPREELYSAGDAVLIHFHSDDTIS 1001          

HSP 6 Score: 93.5893 bits (231), Expect = 4.215e-18
Identity = 69/247 (27.94%), Postives = 109/247 (44.13%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   +  + G I SP +P+KYP   +C W I A     ++++     +E H +C YDHL     +   +P   +LCG N I  E L    N+M L F SD SV + GF   +     +  C G +   +   +  N           YP +  C W I    GY + LTF   F++E  +   C YD + + D        +   CG+  P   + S+ + + + F +D   + +GFH +Y S
Sbjct:  779 KEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCG-NKIP-EPLISTGNKMYLRFISDASVQRKGFQATH-----STECGGRL---KAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTT-FEVEEEA--DCGYDYIELYDGYDTGAHKIGRFCGS-GPREELYSAGDAVLIHFHSDDTISKKGFHIRYTS 1011          

HSP 7 Score: 88.5817 bits (218), Expect = 1.210e-16
Identity = 69/244 (28.28%), Postives = 114/244 (46.72%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F S  YP  Y   +HCV++       KI ++F   D+   S C +D+I++         L  R+C G+K   + ++++    ++ I F+S+S + G GF A      CGG         I      +    Y ++  Y  +K C W IT      +   F  F +E H +CAYDYLE + D  ++      RFCG +  +   + ++ L ++FVSD +V+  GF   F+
Sbjct:  357 ACGETL---QDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFC-GDKIPEVLVSTD---SRMWIEFRSSSNWVGKGFAAVYEAI-CGGE--------ISKDSGQIQSPNYPDD--YRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLE-VRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFF 581          

HSP 8 Score: 87.0409 bits (214), Expect = 4.191e-16
Identity = 79/275 (28.73%), Postives = 123/275 (44.73%), Query Frame = 2
Query: 2639 SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV------------------------SVFDCGGSFFL-TNKLIIGYPE-SHLNESTY------DEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            S E ACG  +     +     +  +P+ Y  N +CV+Q  A T+ +I++ F  F++  +  CK+D++++ SG S+   L  +YC     E+IT   N+    + I FKS++T +  GF+A                           V  C   F L  NK      E  H   ST       +   +Y   K CTW+IT      +   F++F +E H  CAYD+LE    +  K     R CGN     P ++  +K+ +RF+SD SV  +GF
Sbjct:  622 SCEAACGGLLTKLNGT---ITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNN----MRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPE-PLISTGNKMYLRFISDASVQRKGF 888          

HSP 9 Score: 79.7221 bits (195), Expect = 6.132e-14
Identity = 88/466 (18.88%), Postives = 173/466 (37.12%), Query Frame = 2
Query: 9830 CKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGEL---IAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV-------------------------FISSHDKVII-------QYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENF-----KQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            C W+I+   G   K++    ++ L   S    C YD+I + DG     P++   CGD   + + +  + M++ F +  N    GF   + A+         ++  S  ++SP YP+    D R   E    I  +E   + ++ +  +I    +C+ D   ++D   ++   I +FC     E +                         F    D+ +        Q  V  + +   A D  ++++ +  +C   E A  G +  +          K+Y  N  C   ++ P    R    F+ F LE +  C YDY++   G   + + +  K CG+ +P    +  + + + F +D +++  G+   +  ++D   K                                     C  +I+  +G I+SP +   Y    EC+W+I       +K  F + ++
Sbjct:  384 CVWRISVTPGE--KIVLNFTTMDLYKSSL---CWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGE-----ISKDSGQIQSPNYPD----DYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSC---EAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPT-QYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSK-LHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEI 830          

HSP 10 Score: 78.9518 bits (193), Expect = 1.323e-13
Identity = 61/242 (25.21%), Postives = 100/242 (41.32%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW   A  G+   I+    +IE+  + C YD +      S+ +  +   CGN     P +   N + +RF SD S      GF A  +        CGG + A      +       +N  Y  +  C+W I A  G+ +++ F    +  E       C YD+I +YDG D+    I   CG    + + +  + + + F +D  I K GF + +T+   Q  L
Sbjct:  793 TISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQE-CAYDHLEAFDGDSDKTPILSRLCGNKIP-EPLISTGNKMYLRFISDAS--VQRKGFQATHSTE------CGGRLKAEARQKNLYSHAQFGDNN-YPGHTDCEWLIVAESGYGIELTFTTFEVEEEAD-----CGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTKFQEAL 1018          

HSP 11 Score: 77.7962 bits (190), Expect = 2.666e-13
Identity = 63/239 (26.36%), Postives = 100/239 (41.84%), Query Frame = 2
Query: 2684 STYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-----KRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            +T    S N+P  Y     C +   A    ++ ISF +F+I    EC +D ++     S+   +  R C     E +    N    K+ + F S+++    GF+A  S  +CGG      +    Y  +   ++ Y   T       C W I       I   F  F +E   +C YDY+EL     T      RFCG    SGP     +    ++I F SD+++S +GF +R+ + K
Sbjct:  790 TTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGN----KMYLRFISDASVQRKGFQATHST-ECGGRLKAEARQKNLYSHAQFGDNNYPGHTD------CEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCG----SGPREELYSAGDAVLIHFHSDDTISKKGFHIRYTSTK 1013          

HSP 12 Score: 77.411 bits (189), Expect = 3.238e-13
Identity = 86/380 (22.63%), Postives = 146/380 (38.42%), Query Frame = 2
Query: 4139 CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH-------------------------------EGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQAC-NRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            C W++ +    +I +Q + F+L    N  C Y +V +       + L  K CG ++     TS    +RIE  +D +      +AH                                G +L      C E       E    +  G I S  +P+   +  +C W+    PG  VK+ F+  E+E    C+    L A++ +      + + C N+I +     + S+ +  YL+F S  D +   + FQ T+   +  C   +          ++  F    YP +  C W +  +    I L    FE EE   C YDY+E++   +    K+   CG      +    S  + +LI F +D T+S +GF  +Y  T
Sbjct:  653 CVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEV-PEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEA----ECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDH-LEAFDGDSDKTPILSRLCGNKIPE----PLISTGNKMYLRFIS--DASVQRKGFQATH---STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGP---REELYSAGDAVLIHFHSDDTISKKGFHIRYTST 1012          

HSP 13 Score: 71.633 bits (174), Expect = 2.099e-11
Identity = 131/599 (21.87%), Postives = 225/599 (37.56%), Query Frame = 2
Query: 6590 KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSS-WIIVNLFGNFSSESRY--SGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDD----------------FSYFRLKVKIG------------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GG-----------------------------EYSDPERELNST-------NYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCF--RIRA-RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYP 8071
            KL    AC +  ++ + G+  +  YPN      +C + I  +     +LN T +DL   +   C   ++++      K       CG  IP  L  + T+S  WI       F S S +   GF  +Y   +  CGG  E+++  DS  +   +      P   EC W  T   G  + + F+   I R   C   +L   DG +  +  IG   FCG  K   I +  N L +                 FK  D+                   F+     G            +CGGLL +  G I +P +P  YPP  +C+WQ+   +   I + F   +L+ N  C    + V     S++ +    C +   ++ T +Y+ +RI FK++   ++KGFK  +F +   C    GG                             + ++ E +++ST       N+P        CTW I      R+ +     +++ +Q C    + A  G   ++ +L  +C + +    I T + M   F S A++    + +   + CG  +     +  +        S  Q+  +NYP
Sbjct:  351 KLYRCPACGETLQDSV-GNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSS--LCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVL--VSTDSRMWI------EFRSSSNWVGKGFAAVY---EAICGG--EISK--DSGQIQSPNYPDDYRPS-KECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIG--RFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGFAANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPEVITSQYNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATHSTECGGRLKAEARQKNL-------YSHAQFGDNNYP 921          

HSP 14 Score: 64.6994 bits (156), Expect = 2.515e-9
Identity = 59/205 (28.78%), Postives = 90/205 (43.90%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGF 11176
            I+  P  +    F   +L +SS C YDYI+   G    +  +L + CG  IP   V+  SR+ + F +  +    G+   Y         CGGEI  DSG I SP +  +Y  S EC W I +     +   F   ++  + S         D+++V  G   N  L  ++CGY   D+   I S+S  +  K ++ G    AGF
Sbjct:  388 ISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGY-WRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY------EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCA------YDYLEVRDGLSENSPLIGRFCGY---DKPEDIRSTSNNLWMKFVSDGTVNKAGF 576          

HSP 15 Score: 64.3142 bits (155), Expect = 3.295e-9
Identity = 122/554 (22.02%), Postives = 209/554 (37.73%), Query Frame = 2
Query: 6245 IIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNP--IFSFIEY--------------VAMVKCGSLNNSEFNVFQTYLFNSIKITYKADE----------FDPF-----PGFKLSY-KKACYK---DFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMYSKKDEEC-----GGRHE--------LTRYQDSRIVDMNSN---------RLHMT-------------PHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKI---GSCGGLLH---RRQGYIASPNYPL-NYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTW-DIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            I K + Q Q   SPNYP+     + C W I      ++ +    F++E    C Y+   V    S+N   I  F  Y              +  V  G++N + F       F       K D              F     PG++L+  KK+C          L G++    +P +   NKNC + ++        +   A +L    N  C   ++++ +       ++   CG+ +P     +IT+      N+   F S++  S  GF+  +    +EC     G +HE        + + ++  I+  N +         ++H T             P   EC W  T+ PG R++I F E  I +   C    L  FDG +  T  +     CG      + + GN + + F  + D S  R   +      CGG L    R++   +   +   NYP  + C W I   S   I LTF   +++E  +C    + +    ++    I   C S    ++Y+    V I F ++   ++KGF ++Y
Sbjct:  475 ISKDSGQIQ---SPNYPDDYRPSKECVWRITVSEGYSVGLSFQVFEIERHDSCAYDYLEVRDGLSENSPLIGRFCGYDKPEDIRSTSNNLWMKFVSDGTVNKAGF---AANFFKEEDECLKPDNGGCEQRCVNTLGSFKCACDPGYELAPDKKSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELE--GNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVPE----VITSQ---YNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGDSDKTPIL--SRLCGNKIPEPLISTGNKMYLRF--ISDASVQRKGFQATHSTECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCGYDYIELYDGYDTGAHKIGRFCGSGPREELYSAGDAVLIHFHSDDTISKKGFHIRY 1009          

HSP 16 Score: 63.929 bits (154), Expect = 4.898e-9
Identity = 37/142 (26.06%), Postives = 71/142 (50.00%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS---GVITSPGFGTNYYES-GECSWNIKLVSNSYIKWRFTDMQL 10996
            IT  P  R +  F  F +E+   CAYD+++   G+  ++  +L ++CG+ IP   ++  +++ + F++D S+   G+  T+      S +CGG +  ++    + +   FG N Y    +C W I   S   I+  FT  ++
Sbjct:  813 ITATPGHRVKISFNEFEIEQHQECAYDHLEAFDGD-SDKTPILSRLCGNKIPEPLISTGNKMYLRFISDASVQRKGFQATH------STECGGRLKAEARQKNLYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEV 947          

HSP 17 Score: 58.5362 bits (140), Expect = 1.694e-7
Identity = 44/162 (27.16%), Postives = 69/162 (42.59%), Query Frame = 2
Query: 7274 DFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEY-STVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            D S  +   +  +CG  L    G  +SP YP  YP  + C+W+IS      I L F   DL ++  C    + V      +  ++   C     ++     S + I F++++    KGF   Y   + +CGGE S    ++ S NYP        C W+I V
Sbjct:  345 DISQAKKLYRCPACGETLQDSVGNFSSPGYPNGYPSYTHCVWRISVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKAPLLGRFCGDKIPEVLVSTDSRMWIEFRSSSNWVGKGFAAVY---EAICGGEISKDSGQIQSPNYPDDYRPSKECVWRITV 503          

HSP 18 Score: 55.0694 bits (131), Expect = 2.183e-6
Identity = 75/353 (21.25%), Postives = 144/353 (40.79%), Query Frame = 2
Query: 3722 SLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVF-------------EEQSVHVIFQNLASTKYRFRLYYTQ------DCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCY-----SFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            S +  CG +     G I +P +P   P N  C W++ +    RI ++                  +RSG   ++KL    C  + P  + +T++        K  N V S++  K H F             + + ++ I   +   +  F L+  +      +CE  I S++G I S N   +Y     C+W +++  G ++ I  ++F++   Q+ +C      +F   SD++  +L + CGN++     ++ N  + +   +D S         +G    + T+ C         +++   KN +   AQF   N   + DC+W      G+ ++L F   E+E   +C 
Sbjct:  622 SCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVVAPTQYRISMQFEAFELEGNEVCKYDYVEVRSGLSSDSKLHGKYCGTEVP--EVITSQYNNMRIEFKSDNTV-SKKGFKAHFFSDKDECSKDNGGCQHECINTIGSYVCQCRNGFILHENKHDCKEAECEHKIHSTTGTISSPNWPDKYPSRKECTWDITATPGHRVKISFNEFEIE--QHQECAYDHLEAFDGDSDKT-PILSRLCGNKIPEPLISTGN-KMYLRFISDASVQ------RKGFQATHSTE-CGGRL-----KAEARQKN-LYSHAQFGDNNYPGHTDCEWLIVAESGYGIELTFTTFEVEEEADCG 954          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Xenopus
Match: wdr81 (WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-6258221])

HSP 1 Score: 967.607 bits (2500), Expect = 0.000e+0
Identity = 971/3842 (25.27%), Postives = 1602/3842 (41.70%), Query Frame = 2
Query:  155 DDSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYP-DHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPS------PSRSLH---FPCIWTIISSNDQFLQIIPI-----NLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEA--FCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF--DCGGSFFLTNKLII--GYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL------IHDNQTKRFCGNHAKSGPTVTHK---LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINIT--------------VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKF----VTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITS--SSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRI---SDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIY---DSNYDA-KVFCGSGVIDSAIFTPPVTLILSAEGY----------RYPGFLIRWNP--PVDENFKKI--GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCT--FILRSHFLNYILNLTALDLPPPTNGKCVNG-FLKIL-----------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEE--LVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSYFRLKV-------------KIGSCGGLLHRRQGYIASPNYPL-NYPPISSCIWQISGYS--YSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGC---FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVF----GSGATISF--SYNSDQPSLCGSNIY-PNN---NESGVITIENVNISL-CQYNIHNYPEDEGTLSMF----MSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF-FGCRYHDNQIQIDLEDQNGNYLPGQR------ICGKS-REKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFM-IDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC--ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLER-SSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALK-----YCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISW 11188
            ++ PR+ +++GN+IF T+ +K+I F T   G+I++N+ DL+ L                      ++  +K EI   K  S  T+ T +N +++ L  +   +  K     C +NPC N   C++  +SF C+CP  ++G  C EDVNEC +  GT  GCQNG  C+NT GS+ C C  +W G LC +  + C   +  DIC HG C   D    N   + C+CD GW   P +  C AD+DEC +   PCS +P V C+NT G   C  CP G++GNG++C DINEC       +  P  +C+N  G+Y C           + C   + C  NNGGC   A+C+     I    C C PGY+G+G G +GC+ +S          C +   C NG  C+ +++G+ C+C PG+ G  C   I+ +C S PC NGGNC     N Y C+C   ++G NCE+    CGG            + T L  S      P    H     C+W +I +  + ++I+ I     +L+    CS E++Q+H+      ++ ++GKYC      P   +++ + L        +I    GF+I     +      +C        E+ + T+G   SP +P  Y  N +C        G    +     TL L D   NC   DYL+I         +    C+       +       +HFHSDS  +     F   +  + S   CG   T N    I SP  P        C + I+Q  + ++       E      CS  LS  EI          I       +        N  +I FK    ++   F+   + ACG  +    +      + +YP  Y     C +     E   ++++F  FDI   + C  +F+++  ++  HL  +YC               T  +   F     FA    ++    F   CGG+   T   I   GYP              Y     CTW I+      I   FD F+LE   +C+YDYL++      I +++  RFCG      P++T +   + +  V+D + + EGF  R+ ++     C  S+  +SG+ ++P    +  N+  C Y+I V   K+IL+N T              V   DG     P LG+                  C   P    I + SN   + +      +  E  ++ ++ S    CG    S  G   SPN+P+    N+ C W++ ++ G    I+  H      D     N +N  L       T    +  +C +++         +V+V F+   S  +  F   Y Q C+  + +  S G +ES N    Y     C+W + +  G+ I      F++    +  C  +V++    D+   L+   CGNQL     T+      + H  D  T         G  +++   GC E         + S   G   S  FP     N +C W+ QT PG S+++      +E    CS   +L  +    V    + Q C        + + S+ +   ++F    D     R F  T+      C        G I SPNYP  Y  N  CSW ++V     + L   DF+ E  S C +D V + +  +     L  LCG     +    SS  N M ++ R+D +   RGF AK+ E CG L  A      + SP YP  Y  P+   C W  +    E    +   F   E    N NC+ D  + I++G   ++ V+   C ++  HPI   SN   +K I  +++    F A +   +S CGG  +++ G F SP YP +   + +CV+ I +SPG+ + L+   FS +++ S   HD+++IR G NET SL+GRF    +I            +WI+  S G    +   F A +   +      D G +ASP +   Y   +   W +  +SS+ +Q    +  +    D+  C    L IY   D++Y     +CG         TPP  +  S                 GFL+ W       ENF  I  G C  I++  +    L SP +PN   +   CTW I    +  +++ +LS D+E    C Y+   +   G  N              G + +S  ++F         I +  D      GF  SY K+C   + +   G + +  YP     N NCT  F++ S F          ++ P ++  C  G +L++                N   CG++ P  +    T  + + V+   + S+E +  GFQ+ Y      CGG   ++    S  V  +       P   +C W  T P G  ++++F+E   +     C+ ++L   DG+    + +     C         GN L I +K++    Y R                KI +CGG    + G I SP YPL NYP  S C W  +G +  Y  I+   MD     +CS+ +   I    +   ++   CNS    D+ T  S   I F ++     +GF+++Y      CGG+Y+     ++S NYP        C W+I V   +R+ + +  L +   Q C   +     G   +S LL  +C +     E+ +  + + V     GS ++  F  ++NS + ++CG  +  P     +  G   + N   +L C++ I N P  E + +      +     + C   +   +  N   E +      C         + +   V   F    EV   N      Y F+ CGG+    +G I SP +P  Y   + C WL+ APE  II L+     +E H  C +D + I       SP   + CG    S  T+    N++ + F+SD S+   GF    N+ + +  C G +    G+I+SP +P+ +P+N RC WTI         L+F   F +   + H C    +++       LL+  CG+  P+ P+ S  N + + F +  +    GF A + S CG  +    G I+S N       ++ C Y I   E ++ +V  + NF   C+   ++  +           G+R      +CG S    I+   S S+   YT  + ++  + F A Y     +     F   Y  L++P +  + YH+N N T+        I  +    +D+E S   C YD+++     ++SS  +  +CGN+  + P +   +N L + F +D  ++    G+ A    T GPM GCGGY+    GT+G   S D + +G Y++NL C W I AP    + + F  ++  LE +SR   CRYD++ ++DG  +   +  T CG  +     + SNV+ ++F +D ++++ GF  ++             T+ S    SP +PN  P     M  +I A   +H+ ++V+  ++++  +CS +   ++D+ + H     ++C  E+      +      V++       ++ N      F  +Y+   C+R      G + +      + Y HN  C   L  P PN     +F  F++E  SS+  YD+++   G       ++ K CG ++P    + ++ + + F +D  ++  GY+IT+  + +    CGG ++ D G  TSP +  +Y  +  C W I       I   F  + + ++ S +      ++++KV  G  A       +CG           +    +++ +    + +GFR++W
Sbjct:   39 NEQPRMSTESGNLIFCTSQTKNIEFKTGPYGKIKINENDLTELL--------------------AQIHKNKEEIAELKASSAGTNQTITN-QVAQLNTKVGLLCRKA----CNSNPCQNAGTCLNLLDSFFCLCPDQWQGPTCAEDVNECQRYGGTALGCQNGGLCQNTPGSYSCSCPPEWYGPLCTMRFDDC-RTNPVDICIHGICIDLDREQANQPKYSCVCDVGWMSPPGSSACTADVDECALPNPPCSQNPPVQCINTMGSFTCGPCPTGWQGNGYSCQDINECETENGGCSVAPAVKCLNTMGSYHCGPCPPGYEGDGHTCTQTDSCSVNNGGCHPLASCAPAILPI----CVCPPGYAGNGYGPSGCLALS--------DICEKHNPCVNG-QCKPTVSGYECRCNPGWTGTNCTENID-ECSSRPCQNGGNCTDGI-NSYTCNCPNGWTGFNCESPKQECGG------------VLTGLTGSFGYPNNPGTDQHGHMLSCMW-VIKTEPRKVRILHITFTNFHLEQSTPCSTEFLQVHDGDSI--SSFMLGKYC--GTGVPQEISSSHNSLFFWFH-SDHISSAGGFRI-----SWESRQPEC------GGELME-THGSIMSPGYPGNYPPNRDCYWTISTNPG--LYITFAFGTLSLED-HENCGK-DYLEIRDGLLPQDRVLGKYCSTLSPAPLQTSGPYAWLHFHSDSTGE--DRGFHITYITSPSDPGCGGNFTDN-EGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENSSGCS--LSYMEIRDGDTETAPLIGRYCNTTIPPPISSSSNALWIKFKSDASVTRSSFKAFYQVACGGFLTGAGV----IHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDILAGTNCGSNFVEVIFTSYTHL--KYCK-------------PTIFVFRLFTFALLFAELQGKSTDCCFFTGCGGTLTDTQGTITSPGYP------------AVYPHGIQCTWFISIPPGNLIRLTFDSFNLEHGYSCSYDYLDIYDSASAIMESRIGRFCGRSIP--PSITSRGNTMTVLLVTDTNTAVEGFSARYTSLNATTACDASYTEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLSTSTNCDKDHVEIRDGGYEISPLLGK-----------------FCQGPP--PVIVSHSNKLWVKFR--SDSSYSETGFSAHWDSATTGCGGTLTSVSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHF-----DLESHSNCQNDYLAVYDGNTTHSHLLEKLCGKRLPDPIRSSGSNVYVKFRTDNSISFSGFFATYKQTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNVEGYFS--CNDYVQLYDGPDKQARLIGTYCGNQLPPSGTTTGTSLHVVFHSDDTITR-------PGFQMQWYVNGCGE---------ELSGPFGSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIEYHSTCSYD-VLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRF--KTDAYVSGRGFNTTWREIPGGCGGVFQAPNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIESHSSCSFDSVTVSTYSD----PLAVLCGTQ---LPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSLITADSIGATISSPLYPANY--PNNQNCMW--IIQAQEPYNHVTLSFTDLEIEFRNDNCTLD-YVEILDGNNPDAPVQGRYCGRTIPHPITSFSNALVVKFISNNSTSAKGFHATFAASTSACGGTLHMETGAFNSPSYPENYPANTECVWNILSSPGNRLLLT---FSVQHSDS-CSHDYLEIREG-NETGSLMGRF--CGDILPSNITTITGHILWIKFVSDGS--LSGSGFQATFSHLFGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDI---EDHSGCIYDKLKIYDGPDTHYHVIGTYCG--------ITPPPDIFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGS-TVELNILSVDIEKHRSCNYDKLVIR-DGDNNNSPQLAVVCGKGVPGPIRSSGDSMF---------IRFSTDGSVSGTGFNASYHKSC-GGYLHANRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEI-PNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMH---TTDNEMFVHFVSDNSNEGK--GFQLKYEALSLACGGSIYISESDPSGFV-TSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPSENCSSNYLELRDGADASKRLLA--KLC---------GNALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQSGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFEAMDLHNSTDCSR-DFVEIREYNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENGRGFRIRYDASTEECGGDYTASSGIISSPNYPNLYPHNRVCEWRITVPAGRRVTLTINALLLQDQQNCDYDYVAVYNGYQNQSPLLRKLCGNVAPETEVKSSGNTMRVIFVTDGSVSSGGFLATFNSMEDAVCGGALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQN-PNTENSTTFISFKRLQLEYHLNCQRDFIELRFDNADGELITRL---CGRNTPSVPLAIVASQVWVHFVSNAEVE--NIGFNASYSFTDCGGIQAGEYGVIASPNFPASYNSMSHCAWLLDAPEGHIITLSFIHFDIESHQICRWDSVTILNGASPGSPLIGQFCGT--TSPGTIQSGSNKLLVIFNSDDSLHGRGFYA--NWTSDSLGCGGHVHADSGTIRSPAWPQHFPANSRCTWTIETHASSHYELSFNNNFHIPDDNGH-CQRSYVKVWSGAEEELLATGCGDTAPA-PVISPRNVIRVTFQSQ-DAPGSGFFASFISKCGANFTNSSGRIMSPNYPNKYGNNLRCNYTIHA-EANMFIVLFFQNFEVECK---SKTSLSCSKDGLKIFGGERTSPLANLCGASVPASISARGSMSLNF-YTDSDINM--HGFMATY---RVIPCGGTFNASYGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEAS-SSCLYDYIAVYDGLNSSSPLLGRYCGNV--LPPILRSSSNNLFLLFVTD--NHITSRGWRATFRQTLGPMQGCGGYLTNAAGTFG---SPDSNLDGRYDSNLNCAWHIIAPINTQINLTF--SAFFLEAQSR-STCRYDYVKVFDGSTTDSNLQGTYCGSSRPAPFLSTSNVLTVLFVSDSSVERQGFNASYVTKDLLCGGSYNATSTSVTTSSPNFPNLYPPFTSCM-WIIDAPVKEHVKLSVQSFRLQTDGDCSQNYIELKDSPVVH-----RYCGTETFGIPDFYSYGQTAVVV------FKSQNYMQGNGFIFTYQTANCSREYNQTFGYLKSPG--WPENYPHNAECTTVLRAP-PNHTISLFFNSFSIEATSSSICYDFLEVRNGSDSNSP-LIGKYCGDTLPDPIFSKNNVLRLFFKSDLVLSSRGYEITWTSSPN---ACGGTLFGDHGSFTSPSYPGSYSNNTNCEWTILAPLGRLITLNFAVLNIDDSGSCD------SNYLKVYNGPDASSALAGTFCGMGSSIAPLTSTTHQMFIKFHAEQVALPSGFRLTW 3598          

HSP 2 Score: 362.073 bits (928), Expect = 4.424e-99
Identity = 549/2351 (23.35%), Postives = 937/2351 (39.86%), Query Frame = 2
Query: 4472 GVIQSAQFPNSIAN------IDCQWNFQTIPGFS--VKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKI--LDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTG-FSSLNNEMLIKFRTDHTVSSRGFKAKYFET-----CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSG--NAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYT----LSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNG-QCNRGNLIIYDSN---YDAKV--FCGSGVIDS--AIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNC----NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM-NQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNIYPNN----NESGVITIENVNISLCQYNIH-NYPEDEGTLSM------FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLII-APENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI--------------CGGVYDLRQGE---IVSANVALINYGS-ITCEYLI--PGWENHLQVVYI-YPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLR-SVDIERSYDGCNY-DFV--------XXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG--YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFT-AVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYT--CNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSR-VSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGV-ITSPGFG--TNYYESGECSWNIK--LVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSY----GNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            G+  S  +PN+         + C W  +T P     + + F    +E S  CS    L+  + + +    + + C     G    I SS ++ +  F S +  + G   F+ ++E     C  E+  + G I SP YP  YP N  C W +     + I      L  E  E+ C  DY+EI     + L+    + GK  + +      +      + F +D T   RGF   Y  +     CGG     ++  F+ SP +P  YT  +  C + +    +E   +I   F   E   N+  CS  + + I +G    + +    C  +   PI S+ + L +  KS +    + FKA Y V    CGG F    G+  +P YP++   +  C ++I    G  + L+   F              DI  G N  S+ +   +T    L   +   + ++      +    QG   T+   F        +T+     G + SP +  VY    + TW +       ++ TFD F+    L++G  C+   L IYDS     ++++  FCG  +  S  +       L+++       GF  R+      N     D  Y    T  + I +SPNYPN       C +TI  +  + + +   +F L +S  C  ++  +   G          Y      G        V  ++  N + + +++D      GF   +  A   C     + + G   +  +P   + N  C + ++ S    + +     DL   +N  C N +L +   N   +     LCG  +P    PI ++ S    N++  F +++  S F   ++   + C G     R   SR +  + N  +  PH  +C W   +  G  +   F    +        ++  +DG     + IG   +CG     S  T G  L ++F + D  +   F+++  +  CG  L    G   SP +P+ YP    CIW I     S+I++T  + +++    CS   L +       +  +   C      +   + +  +T+ + FKT+   + +GF   +      CGG +  P  E++S NYP+       C+W I VD   R+++  +   + +       +  V   S  L ++C + L      T+++M + +   G+     +++     CGS I  ++      S +      N   C + I    P +  TLS       F +DN    C+  Y     GN    PV+    G    + + SFS    VV FI       +   +        S CGG L    G   SP YPE YP NT+C W I+ +P N +    + T  ++H   C++D+L IR   E  S   R    + P +  T++ H   + + F SD S+S +GF   ++ +   +     I    G I SP +P+ YP      W I+V +  ++     L  D+E  S   C YD L+I D       ++   CG  PP + I SS + M++ F++D + N++GF  ++ ++              CGG+  LR G+    + +     NY S + C ++I  PG    L ++ +       C Y D  +  D ++ N   L    +CGK           S+ I ++     +    F A Y       + ++     ++ +PN+P  Y  N N TW F    G+  + +   + +I  S   C   D++        S     +++ +  FCG     +    D N + V F SD S+         F        L CGG  Y++ +  + G + S     N  Y  N  C W I  P G AV++ F+     +E       C  +++ + DG D+++ ++  LCG+    +  +    MYL F TD    + GFK  +  A     H  +     S +++SP YP  +  D              ++TI  + + + +S +CS D   I++ +      +  FC S+    + ++S     I++     EN      R F+I Y+  T  C     A SG I++  N+    Y HN +C   +  PA   R         L+    C YDY+    G    Q  +L K+CG+  P + V +S   + +IFVTD S++  G+  T+    D    CGG +   +G   +SPG+    NY  +  C W I+     NS     F  +QL  + + +       DF+++ +    G    + CG         I +S   V + S       GF  S+S
Sbjct:  470 GLTGSFGYPNNPGTDQHGHMLSCMWVIKTEPRKVRILHITFTNFHLEQSTPCST-EFLQVHDGDSISSFMLGKYCGT---GVPQEISSSHNSLFFWFHSDHISSAG--GFRISWESRQPECGGELMETHGSIMSPGYPGNYPPNRDCYWTISTNPGLYITFAFGTLSLEDHEN-CGKDYLEI----RDGLLPQDRVLGKYCSTLSPAPLQTSGPYAWLHFHSDSTGEDRGFHITYITSPSDPGCGG--NFTDNEGFISSPRWPQPYT-GNKQCIYIIQQPANE---KISLRFTNLEL-ENSSGCSL-SYMEIRDGDTETAPLIGRYCNTTIPPPISSSSNALWIKFKSDASVTRSSFKAFYQVA---CGG-FLTGAGVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSF--------------DILAGTNCGSNFVEVIFTSYTHLKYCKPTIFVFRLFTFALLFAELQGKS-TDCCFFTGCGGTLTDTQ-----GTITSPGYPAVYPHGIQCTWFISIPPGNLIRLTFDSFN----LEHGYSCSYDYLDIYDSASAIMESRIGRFCGRSIPPSITSRGNTMTVLLVTDTNTAVEGFSARY---TSLNATTACDASY----TEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLSTSTNCDKDHVEIRDGG----------YEISPLLGKFCQGPPPVIVSHS-NKLWVKFRSDSSYSETGFSAHWDSATTGCGGTLTS-VSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLESHSN--CQNDYLAVYDGNTTHSHLLEKLCGKRLP---DPIRSSGS----NVYVKFRTDNSIS-FSGFFATYKQTCQGVMIANR---SRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNVEGYFSCNDYVQLYDGPDKQARLIG--TYCGNQLPPSGTTTGTSLHVVFHSDDTITRPGFQMQWYVNGCGEELSGPFGSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIEYHSTCSYDVLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDAYVSGRGFNTTWREIPGGCGGVFQAPNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIESHSSCSFDSVTVSTYSDPLAVLCGTQLPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDN----CTLDYVEILDGNNPDAPVQGRYCGRTIPHPITSFSN-ALVVKFISN--NSTSAKGFHATFAASTSACGGTLHMETGAFNSPSYPENYPANTECVWNILSSPGNRL----LLTFSVQHSDSCSHDYLEIREGNETGSLMGRFCGDILPSNITTITGH--ILWIKFVSDGSLSGSGFQATFSHLFGNN-----IGGDRGQIASPLWPRNYPHYSNYLWKINV-DSSQIIQARILEIDIEDHS--GCIYDKLKIYDGPDTHYHVIGTYCGITPPPD-IFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGI--LRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGSTVELNILSVDIEKHRSCNY-DKLVIRDGDNNNSPQL--AVVCGKGVPGPIRSSGDSMFIRFSTDG-SVSGTGFNASYHKSCGGYLHANRG---LITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMHTTD-NEMFVHFVSDNSNEGK-----GFQLKYEALSLACGGSIYISESDPS-GFVTSPKYPEN--YPMNADCVWIITVPNGEAVELEFKEQ-FYIEPSEN---CSSNYLELRDGADASKRLLAKLCGNALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQ-----SGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFEAMDLHNSTDCSRDFVEIREYNASGR-ILGVFCNSMVPSDL-VTSDSFAYIKFVSDQSEN-----GRGFRIRYDASTEECGGDYTASSG-IISSPNYP-NLYPHNRVCEWRITVPA-GRRVTLTINALLLQDQQNCDYDYVAVYNGYQ-NQSPLLRKLCGNVAPETEVKSSGNTMRVIFVTDGSVSSGGFLATFNSMED--AVCGGALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLEYHLNCQ------RDFIELRFDNADGELITRLCGRNTPSVPLAIVASQVWVHFVSNAEVENIGFNASYS 2671          

HSP 3 Score: 57.7658 bits (138), Expect = 5.799e-7
Identity = 135/639 (21.13%), Postives = 238/639 (37.25%), Query Frame = 2
Query: 1535 IVCGGTYAVSNEYREISLFTSLLPSPSRSL-----HFPCIWTIISSNDQFLQII--PINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTN--GLFQSP--NFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI---NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATI-TMNPNAIIESPAIPADVEAF--CTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYA-CGNSVNMDEMSTYEF-QSDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDIN-DDSECKFDFIKI-SGSNSGH-LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRA--KVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR-----FCGNHAKSGP--TVTHKLVIRFVSDNSVSGEGFIMRFYT 3355
            I CGGT+  S            L SP+ +      +  C + +    ++ +++    ++L+    C  +Y+ +++      ++ L+G+YC   N  P    ++ + L +      +I  + G++     T   ++      C         LTN  G F SP  N   +Y  N+NCA    A   T+  +      L+    +S C   DY+++   +  D  ++ T C  +         N   V F SDS  +    R  F          CG +    + +    SP  P     F  C W I       +     +F    DGDCS      E+  S  +  +   C T      +         + FK    +    F  + + A C    N     T+ + +S  +P+NY  N+ C     A     I++ F  F I    S   +DF+++ +GS+S   L  +YC     + I   +N     + + FKS+   +  G+      S   CGG+ F            H + ++      Y  N  C W I   L   I   F   +++   +C  +YL++ +           FCG  +   P  + TH++ I+F ++      GF + + T
Sbjct: 3016 IPCGGTFNAS---------YGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEASSSCLYDYIAVYDG--LNSSSPLLGRYC--GNVLPPILRSSSNNLFLLFVTDNHIT-SRGWRATFRQTLGPMQG-----CGG------YLTNAAGTFGSPDSNLDGRYDSNLNCAWHIIAPINTQINLTFSAFFLE-AQSRSTCR-YDYVKVFDGSTTDSNLQGTYCGSSRPAPFLSTSNVLTVLFVSDSSVE----RQGFNASYVTKDLLCGGSYNATSTSVTTSSPNFPNLYPPFTSCMWIIDAPVKEHVKLSVQSFRLQTDGDCSQNY--IELKDSPVVHRY---CGTETFGIPDFYSYGQTAVVVFKSQNYMQGNGFIFTYQTANCSREYNQ----TFGYLKSPGWPENYPHNAECTTVLRAPPNHTISLFFNSFSIEATSSSICYDFLEVRNGSDSNSPLIGKYCGDTLPDPIFSKNN----VLRLFFKSDLVLSSRGYEITWTSSPNACGGTLF----------GDHGSFTSPSYPGSYSNNTNCEWTILAPLGRLITLNFAVLNIDDSGSCDSNYLKVYNGPDASSALAGTFCGMGSSIAPLTSTTHQMFIKFHAEQVALPSGFRLTWVT 3600          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Xenopus
Match: wdr81 (WD repeat domain 81 [Source:Xenbase;Acc:XB-GENE-6258221])

HSP 1 Score: 964.14 bits (2491), Expect = 0.000e+0
Identity = 970/3820 (25.39%), Postives = 1596/3820 (41.78%), Query Frame = 2
Query:  140 QPNSIDDSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYP-DHSPTNP-KPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPS------PSRSLH---FPCIWTIISSNDQFLQIIPI-----NLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEA--FCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVS--VFDCGGSFFLTNKLII--GYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL------IHDNQTKRFCGNHAKSGPTVTHK---LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINIT--------------VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKF----VTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITS--SSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRI---SDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIY---DSNYDA-KVFCGSGVIDSAIFTPPVTLILSAEGY----------RYPGFLIRWNP--PVDENFKKI--GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCT--FILRSHFLNYILNLTALDLPPPTNGKCVNG-FLKIL-----------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEE--LVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSYFRLKV-------------KIGSCGGLLHRRQGYIASPNYPL-NYPPISSCIWQISGYS--YSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGC---FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVF----GSGATISF--SYNSDQPSLCGSNIY-PNN---NESGVITIENVNISL-CQYNIHNYPEDEGTLSMF----MSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF-FGCRYHDNQIQIDLEDQNGNYLPGQR------ICGKS-REKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFM-IDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC--ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLER-SSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALK-----YCGYILL 11098
            Q   I + PR+ +++GN+IF T+ +K+I F T   G+I++N+ DL+ L                      ++  +K EI   K  S  T+ T +N +++ L        + L+   C +NPC N   C++  +SF C+CP  ++G  C EDVNEC +  GT  GCQNG  C+NT GS+ C C  +W G LC +  + C   +  DIC HG C   D    N  +   C+CD GW   P +  C AD+DEC +   PCS +P V C+NT G   C  CP G++GNG++C DINEC       +  P  +C+N  G+Y C           + C   + C  NNGGC   A+           IC C PGY+G+G G +GC+ +S          C +   C NG  C+ +++G+ C+C PG+ G  C   I+ +C S PC NGGNC     N Y C+C   ++G NCE+    CGG            + T L  S      P    H     C+W +I +  + ++I+ I     +L+    CS E++Q+H+      ++ ++GKYC      P   +++ + L        +I    GF+I     +      +C        E+ + T+G   SP +P  Y  N +C        G    +     TL L D   NC   DYL+I         +    C+       +       +HFHSDS  +     F   +  + S   CG   T N    I SP  P        C + I+Q  + ++       E      CS  LS  E+          I C T   +        N  +I FK    ++   F+   + ACG  +    +      + +YP  Y     C +     E   ++++F  FDI   + C  +F++I    S+   L  +YC       + + +    + + I F ++S+    GF       +  CGG+   T   I   GYP              Y     CTW I+      I   FD F+LE   +C+YDYL++      I +++  RFCG      P++T +   + +  V+D + + EGF  R+ ++     C  S+  +SG+ ++P    +  N+  C Y+I V   K+IL+N T              V   DG     P LG+                  C   P    I + SN   + +      +  E  ++ ++ S    CG    S  G   SPN+P+    N+ C W++ ++ G    I+  H      D     N +N  L       T    +  +C +++         +V+V F+   S  +  F   Y Q C+  + +  S G +ES N    Y     C+W + +  G+ I      F++    +  C  +V++    D+   L+   CGNQL     T+      + H  D  T         G  +++   GC E         + S   G   S  FP     N +C W+ QT PG S+++      +E    CS   +L  +    V    + Q C        + + S+ +   ++F    D     R F  T+      C        G I SPNYP  Y  N  CSW ++V     + L   DF+ E  S C +D V +             LCG     +    SS  N M ++ R+D +   RGF AK+ E CG L  A      + SP YP  Y  P+   C W  +    E    +   F   E    N NC+ D  + I++G   ++ V+   C ++  HPI   SN   +K I  +++    F A +   +S CGG  +++ G F SP YP +   + +CV+ I +SPG+ + L+   FS +++ S   HD+++IR G NET SL+GRF    +I            +WI+  S G    +   F A +   +      D G +ASP +   Y   +   W +  +SS+ +Q    +  +    D+  C    L IY   D++Y     +CG         TPP  +  S                 GFL+ W       ENF  I  G C  I++  +    L SP +PN   +   CTW I    +  +++ +LS D+E    C Y+   +   G  N              G + +S  ++F         I +  D      GF  SY K+C   + +   G + +  YP     N NCT  F++ S F          ++ P ++  C  G +L++                N   CG++ P  +    T  + + V+   + S+E +  GFQ+ Y      CGG   ++    S  V  +       P   +C W  T P G  ++++F+E   +     C+ ++L   DG+    + +     C         GN L I +K++    Y R                KI +CGG    + G I SP YPL NYP  S C W  +G +  Y  I+   MD     +CS+ +   I    +   ++   CNS    D+ T  S   I F ++     +GF+++Y      CGG+Y+     ++S NYP        C W+I V   +R+ + +  L +   Q C   +     G   +S LL  +C +     E+ +  + + V     GS ++  F  ++NS + ++CG  +  P     +  G   + N   +L C++ I N P  E + +      +     + C   +   +  N   E +      C         + +   V   F    EV   N      Y F+ CGG+    +G I SP +P  Y   + C WL+ APE  II L+     +E H  C +D + I       SP   + CG    S  T+    N++ + F+SD S+   GF    N+ + +  C G +    G+I+SP +P+ +P+N RC WTI         L+F   F +   + H C    +++       LL+  CG+  P+ P+ S  N + + F +  +    GF A + S CG  +    G I+S N       ++ C Y I   E ++ +V  + NF   C+   ++  +           G+R      +CG S    I+   S S+   YT  + ++  + F A Y     +     F   Y  L++P +  + YH+N N T+        I  +    +D+E S   C YD+++     ++SS  +  +CGN+  + P +   +N L + F +D  ++    G+ A    T GPM GCGGY+    GT+G   S D + +G Y++NL C W I AP    + + F  ++  LE +SR   CRYD++ ++DG  +   +  T CG  +     + SNV+ ++F +D ++++ GF  ++             T+ S    SP +PN  P     M  +I A   +H+ ++V+  ++++  +CS +   ++D S   + ++ ++C  E+      +      V++       ++ N      F  +Y+   C+R      G + +      + Y HN  C   L  P PN     +F  F++E  SS+  YD+++   G       ++ K CG ++P    + ++ + + F +D  ++  GY+IT+  + +    CGG ++ D G  TSP +  +Y  +  C W I       I   F  + + ++ S +      ++++KV  G  A       +CG ++L
Sbjct:   32 QKREIYNEPRMSTESGNLIFCTSQTKNIEFKTGPYGKIKINENDLTELL--------------------AQIHKNKEEIAELKASSAGTNQTITN-QVAQLN------TKALSRKACNSNPCQNAGTCLNLLDSFFCLCPDQWQGPTCAEDVNECQRYGGTALGCQNGGLCQNTPGSYSCSCPPEWYGPLCTMRFDDC-RTNPVDICIHGICIDLDREQANQVRKVLCVCDVGWMSPPGSSACTADVDECALPNPPCSQNPPVQCINTMGSFTCGPCPTGWQGNGYSCQDINECETENGGCSVAPAVKCLNTMGSYHCGPCPPGYEGDGHTCTQTDSCSVNNGGCHPLASSIL-------PICVCPPGYAGNGYGPSGCLALS--------DICEKHNPCVNG-QCKPTVSGYECRCNPGWTGTNCTENID-ECSSRPCQNGGNCTDGI-NSYTCNCPNGWTGFNCESPKQECGG------------VLTGLTGSFGYPNNPGTDQHGHMLSCMW-VIKTEPRKVRILHITFTNFHLEQSTPCSTEFLQVHDGDSI--SSFMLGKYC--GTGVPQEISSSHNSLFFWFH-SDHISSAGGFRI-----SWESRQPEC------GGELME-THGSIMSPGYPGNYPPNRDCYWTISTNPG--LYITFAFGTLSLED-HENCGK-DYLEIRDGLLPQDRVLGKYCSTLSPAPLQTSGPYAWLHFHSDSTGE--DRGFHITYITSPSDPGCGGNFTDN-EGFISSPRWPQPYTGNKQCIYIIQQPANEKISLRFTNLELENSSGCS--LSYMEVR---------IYCNT--TIPPPISSSSNALWIKFKSDASVTRSSFKAFYQVACGGFLTGAGV----IHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDILAGTNCGSNFVEIRDGSSSDSPLIGKYCGPE----MPVPAQSTQRALYIRFTTDSSATNHGFSISYQSLIEGCGGTLTDTQGTITSPGYP------------AVYPHGIQCTWFISIPPGNLIRLTFDSFNLEHGYSCSYDYLDIYDSASAIMESRIGRFCGRSIP--PSITSRGNTMTVLLVTDTNTAVEGFSARYTSLNATTACDASYTEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLSTSTNCDKDHVEIRDGGYEISPLLGK-----------------FCQGPP--PVIVSHSNKLWVKFR--SDSSYSETGFSAHWDSATTGCGGTLTSVSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHF-----DLESHSNCQNDYLAVYDGNTTHSHLLEKLCGKRLPDPIRSSGSNVYVKFRTDNSISFSGFFATYKQTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNVEGYFS--CNDYVQLYDGPDKQARLIGTYCGNQLPPSGTTTGTSLHVVFHSDDTITR-------PGFQMQWYVNGCGE---------ELSGPFGSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIEYHSTCSYD-VLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRF--KTDAYVSGRGFNTTWREIPGGCGGVFQAPNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIESHSSCSFDSVTV-----------TVLCGTQ---LPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSLITADSIGATISSPLYPANY--PNNQNCMW--IIQAQEPYNHVTLSFTDLEIEFRNDNCTLD-YVEILDGNNPDAPVQGRYCGRTIPHPITSFSNALVVKFISNNSTSAKGFHATFAASTSACGGTLHMETGAFNSPSYPENYPANTECVWNILSSPGNRLLLT---FSVQHSDS-CSHDYLEIREG-NETGSLMGRF--CGDILPSNITTITGHILWIKFVSDGS--LSGSGFQATFSHLFGNNIGGDRGQIASPLWPRNYPHYSNYLWKINVDSSQIIQARILEIDI---EDHSGCIYDKLKIYDGPDTHYHVIGTYCG--------ITPPPDIFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGILRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGS-TVELNILSVDIEKHRSCNYDKLVIR-DGDNNNSPQLAVVCGKGVPGPIRSSGDSMF---------IRFSTDGSVSGTGFNASYHKSC-GGYLHANRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEI-PNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMH---TTDNEMFVHFVSDNSNEGK--GFQLKYEALSLACGGSIYISESDPSGFV-TSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPSENCSSNYLELRDGADASKRLLA--KLC---------GNALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQSGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFEAMDLHNSTDCSR-DFVEIREYNASGRILGVFCNSMVPSDLVTSDSFAYIKFVSDQSENGRGFRIRYDASTEECGGDYTASSGIISSPNYPNLYPHNRVCEWRITVPAGRRVTLTINALLLQDQQNCDYDYVAVYNGYQNQSPLLRKLCGNVAPETEVKSSGNTMRVIFVTDGSVSSGGFLATFNSMEDAVCGGALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQN-PNTENSTTFISFKRLQLEYHLNCQRDFIELRFDNADGELITRL---CGRNTPSVPLAIVASQVWVHFVSNAEV--ENIGFNASYSFTDCGGIQAGEYGVIASPNFPASYNSMSHCAWLLDAPEGHIITLSFIHFDIESHQICRWDSVTILNGASPGSPLIGQFCGT--TSPGTIQSGSNKLLVIFNSDDSLHGRGFYA--NWTSDSLGCGGHVHADSGTIRSPAWPQHFPANSRCTWTIETHASSHYELSFNNNFHIPDDNGH-CQRSYVKVWSGAEEELLATGCGDTAPA-PVISPRNVIRVTFQSQ-DAPGSGFFASFISKCGANFTNSSGRIMSPNYPNKYGNNLRCNYTIHA-EANMFIVLFFQNFEVECK---SKTSLSCSKDGLKIFGGERTSPLANLCGASVPASISARGSMSLNF-YTDSDINM--HGFMATY---RVIPCGGTFNASYGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEAS-SSCLYDYIAVYDGLNSSSPLLGRYCGNV--LPPILRSSSNNLFLLFVTD--NHITSRGWRATFRQTLGPMQGCGGYLTNAAGTFG---SPDSNLDGRYDSNLNCAWHIIAPINTQINLTF--SAFFLEAQSR-STCRYDYVKVFDGSTTDSNLQGTYCGSSRPAPFLSTSNVLTVLFVSDSSVERQGFNASYVTKDLLCGGSYNATSTSVTTSSPNFPNLYPPFTSCM-WIIDAPVKEHVKLSVQSFRLQTDGDCSQNYIELKD-SPGDQGQVHRYCGTETFGIPDFYSYGQTAVVV------FKSQNYMQGNGFIFTYQTANCSREYNQTFGYLKSPG--WPENYPHNAECTTVLRAP-PNHTISLFFNSFSIEATSSSICYDFLEVRNGSDSNSP-LIGKYCGDTLPDPIFSKNNVLRLFFKSDLVLSSRGYEITWTSSPN---ACGGTLFGDHGSFTSPSYPGSYSNNTNCEWTILAPLGRLITLNFAVLNIDDSGSCD------SNYLKVYNGPDASSALAGTFCGMVVL 3561          

HSP 2 Score: 426.402 bits (1095), Expect = 1.458e-118
Identity = 725/3108 (23.33%), Postives = 1175/3108 (37.81%), Query Frame = 2
Query: 2387 CTWKIKQTNSSRLIRLKGTFENWF---DGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEY---ACGNSVNMDEMSTY-EFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKISGSNSGHLDQ-----RYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFR----AKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKRFCGNHAKSGP--TVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINIT--------------VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILI-----KINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIF---QNLASTKYRFR---LYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRS---NTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACN-RIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSG--SEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNL-VANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYH---PIISNGHYLKVILKS---TSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY--GVLASPQFGHVYNQDTEITWTVFA-ESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSN-YDAKV---FCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENF-----KKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNY----------ILNLTALDLPPPTNGKCVNGFLKI-----LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDE-----------ECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFSYFRLKVKI-GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQI---SGYS-YSNIRLTFMDRDLDENCSKSNLTVI---------PVKES-ENAVIWSNCNSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEY----SDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKK---LKMNQGC----FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGL---REPVED---------FGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFN-TEGSIKSPNYPKP--YPSNLRCNWTIHVP--EGYKVSLTFKLPFDLERTSLHTCHYDSLRI-IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK-SICGGVYDLRQGEIVSANVALINYGSIT-CEYLIPGWENH-LQVVYIYPNFFG---CRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDE---NVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIF--NAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG-YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYE-----LYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERS--STCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGE--IYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL--KYCGYILLDEEFQIP-----SSSFTVEYKSLTGGVGAGF 11176
            C W IK T   ++  L  TF N+       CS +    ++     I +  +       + +      N  + +F      S   F+IS E     CG  +    M T+    S  YP NY  N  C +         I  +F    + D   C  D+++I     G L Q     +YC+     L             + F S+ST    GF        S   CGG+F   N+  I  P              Y  NK C + I    +  I   F    LE+   C+  Y+E+      + +C N     P  + ++ L I+F SD SV+   F   FY     Q     F + +G+I  P   +      TC + I  P+ + + +                 V   DGS    P +G+                     C     +   S    +        +A    ++I+Y SL E CG     T G I SP YP   P    C W I   PG  I +      + H  S S D   + +  + +++       I   C   I         ++ V+     N A   +  R   L  T  C+   T +SG   S N   RY     C + ++     +IL+    F L    N      V I D     + LL K C  Q       S +  + ++  +D S       AH     +  T GC  T          ++ +G   S  FP     N +C W      G + +++F+  ++ES  NC +   L  ++      + + + C  R+ D     I+SS  N Y+KF + N        F G +     +C+  M    S GI++S NYPN YPHN +C+W ++     +I+     F  E      DYV+++   +     +   CG   N +    ++    + + F +D T++  GF+ +++    G  ++     F  SP +P  Y  PD   C W++  +  S I + I+ + + +        CS D  L I  G G +S   A LC   P      + S G+ + V  K+    SG   F   +      CGG F   +G   SP YP     + +C +VIR   G  + L+  +F  E+  S    D + +       + L G    L    + T N  F     +RLRS G +   H  F AK+     +   +D     ++SP +   Y  +    W + A E    +  +F    +  R DN  C    + I D N  DA V   +CG  +        P+T   +A   ++    I  N    + F          C   +    +T    SP+YP        C W IL+     L   +L+F ++ S  C ++   +        +           CG +  S       ++   + I + +D      GF+ ++       F N + G    +  P      +N       H+ NY          I+    L++    +  C+   LKI        ++  T CG   PPD   I ++ S + V    + S   +  GF + +   D             CGG   + R  D+ +   +    +    +++C W   +P G+ ++++   + I +   CN   L   DG    + ++     CGK     I + G+ + I F      S          SCGG LH  +G I SPNYP +Y    +C W     SG++  ++   TF   + D  C   +   +         P+  S  N         ST  ++T  + + + F ++     KGF+LKY      CGG      SDP   + S  YP+       C W I V   + + ++ K+   ++ ++ C      +R  G      LL  +C + L    I  KS      G+   + F  +S  P +    +Y      G    ++  I    Y + NYP D      + +  TG   +  +    + N     R+ VE           G  CN         T        F   +  N   +R+        CGG  T S G I SP YP  YP N  CEW I  P    + LTI  L L+   +C+YD++ +    +  SP  RKLCG N      +    N MR+ F +D SVS  GF+  +N +  A  C G + + T G   SP Y +   Y  NL C W I  P  E     ++FK    L+      C  D + +  D+    L++ LCG   PS P+    +Q+ + F ++      GF+A Y  + CGG+     G I S N    +Y S++ C +L+   E H + + +I+ +      CR+  + + I      G+ L GQ  CG +        S  + +++ + +  L    F A +  D       V +D      +++P +P  +  N+  TW    +A   Y  S N  +  I      C   +V   + +     A  CG+ T  +P +   NV+ V FQS  +       F +FI+        CG  + N++    G I S +  N   Y NNL C + I A     + + F+N  +  + ++ +  C  D + I+ G  ++   +  LCG     SI+ + + M L F TD +I   GF  T+  +P       T       L SP Y     ++       +   E   I +   +L + +S +C  D   + D        + ++C ++    +  SS + + + +        N  T R ++ ++      +  C       +G   + ++    +Y  NL C   +I P  N +    F  F LE    STC YDY++   G   +   +    CGSS P  F++ S+ ++++FV+D S+   G++ +YV      + CGG       S   +SP F   Y     C W I      ++K      +L      +  C  N   +K S G+Q    +YCG     E F IP       +  V +KS     G GF
Sbjct:  486 CMWVIK-TEPRKVRILHITFTNFHLEQSTPCSTEF--LQVHDGDSISSFMLGKYCGTGVPQEISSSHNSLFFWFHSDHISSAGGFRISWESRQPECGGEL----METHGSIMSPGYPGNYPPNRDCYWTISTNPGLYITFAFGTLSLEDHENCGKDYLEI---RDGLLPQDRVLGKYCS----TLSPAPLQTSGPYAWLHFHSDSTGEDRGFHITYITSPSDPGCGGNF-TDNEGFISSPR---------WPQPYTGNKQCIYIIQQPANEKISLRFTNLELENSSGCSLSYMEV------RIYC-NTTIPPPISSSSNALWIKFKSDASVTRSSF-KAFY-----QVACGGFLTGAGVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDILAGTNCGSNFVEIRDGSSSDSPLIGKY--------------------CGPEMPVPAQSTQRALYIRFTTDSSATNHGFSISYQSLIEGCGGTLTDTQGTITSPGYPAVYPHGIQCTWFISIPPGNLIRLTFDSFNLEHGYSCSYDYLDIYDSASAIME-----SRIGRFCGRSIPPSITSRGNTMTVLLVTDTNTAVEGFSARYTSLNATTACDASYTEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLSTSTNCD-KDHVEIRDGGYEISPLLGKFC--QGPPPVIVSHSNKLWVKFRSDSSYSETGFSAH----WDSATTGCGGTL---------TSVSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLESHSNC-QNDYLAVYDGNTTHSHLLEKLCGKRLPD----PIRSSGSNVYVKFRTDNS-----ISFSGFFATYKQTCQGVMIANRSRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNVEGYFSCNDYVQLYDGPDKQARLIGTYCG---NQLPPSGTTTGTSLHVVFHSDDTITRPGFQMQWYVNGCGEELSGPFGSFT-SPGFPMRY--PDNRECIWHIQTSPGSSIQITIWEFNIEYHS-----TCSYD-VLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDAYVSGRG-FNTTWREIPGGCGGVFQAPNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIESHSSCSF-DSVTV-------TVLCGT--QLPAAISSTQNTMF-----VRLRSDGSN--QHRGFSAKFTEACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDN--CTLDYVEILDGNNPDAPVQGRYCGRTIPH------PITSFSNALVVKF----ISNNSTSAKGFHATFAASTSACGGTLHM--ETGAFNSPSYPENYPANTECVWNILSSPGNRL---LLTFSVQHSDSCSHDYLEIREGNETGSLMGRF-------CGDILPSNITTITGHI---LWIKFVSDGSLSGSGFQATFSHL----FGNNIGGDRGQIASP---LWPRN-----YPHYSNYLWKINVDSSQIIQARILEIDIEDHSGCIYDKLKIYDGPDTHYHVIGTYCGITPPPD---IFSSGSSMTVQFTSDNSINMK--GFLLEWLAVDAFSENFPTIAPGACGG---ILRTGDTPLFLFSPGWPNNYASYLDCTWVIKAP-GSTVELNILSVDIEKHRSCNYDKLVIRDGDNNNSPQLA--VVCGKGVPGPIRSSGDSMFIRFSTDGSVSGTGFNASYHKSCGGYLHANRGLITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTSAPST--MHTTDNEMFVHFVSDNSNEGKGFQLKYEALSLACGGSIYISESDPSGFVTSPKYPENYPMNADCVWIITVPNGEAVELEFKEQFYIEPSENCSSNYLELR-DGADASKRLLAKLCGNALP---ITYKS-----LGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQSGIIQSPGYPLQNYP-DNSLCEWYFTGPTGHYLTIQFEAMDLHNSTDCSRDFVEIREYNASGRILGVFCNSMVPS-DLVTSDSFAYIKFVSDQSENGRGFRIRYDASTEECGGDYTASSGIISSPNYPNLYPHNRVCEWRITVPAGRRVTLTINALLLQDQQNCDYDYVAVYNGYQNQSPLLRKLCG-NVAPETEVKSSGNTMRVIFVTDGSVSSGGFLATFNSMEDA-VCGGALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFK---RLQLEYHLNCQRDFIELRFDNADGELITRLCGRNTPSVPLAIVASQVWVHFVSNAEVENIGFNASYSFTDCGGIQAGEYGVIASPNFP-ASYNSMSHCAWLLDAPEGHIITLSFIHFDIESHQICRW--DSVTILNGASPGSPLIGQ-FCGTTSPGTIQSGSNKLLVIFNSDD-SLHGRGFYANWTSDSLGCGGHVHADSG---TIRSPAWPQHFPANSRCTWTIETHASSHYELSFN-NNFHIPDDNGHCQRSYVKVWSGAEEELLATGCGD-TAPAPVISPRNVIRVTFQSQDAPGSGF--FASFISK-------CGANFTNSS----GRIMSPNYPNK--YGNNLRCNYTIHAEANMFIVLFFQNFEVECKSKTSL-SCSKDGLKIFGGERTSP--LANLCGASVPASISARGS-MSLNFYTDSDINMHGFMATYRVIPCGG----TFNASYGTLRSPTYAFTDYHNNMNCTYHVTVQENKIIELKFNELDLEASSSCLYDYIAVYDGLNSSSPLLGRYCGNV-LPPILRSSSNNLFLLFVTD-----NHITSRGWRATFRQTLGPMQGCGGYLTNAAGTFGSPDSNLDGRYDSNLNCAWHIIAPI-NTQINLTFSAFFLEAQSRSTCRYDYVKVFDGSTTDSN-LQGTYCGSSRPAPFLSTSNVLTVLFVSDSSVERQGFNASYVTK---DLLCGGSYNATSTSVTTSSPNFPNLYPPFTSCMWIIDAPVKEHVKLSVQSFRL----QTDGDCSQNYIELKDSPGDQGQVHRYCG----TETFGIPDFYSYGQTAVVVFKSQNYMQGNGF 3355          

HSP 3 Score: 374.4 bits (960), Expect = 7.479e-103
Identity = 553/2353 (23.50%), Postives = 946/2353 (40.20%), Query Frame = 2
Query: 4472 GVIQSAQFPNSIAN------IDCQWNFQTIPGFS--VKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKI--LDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTG-FSSLNNEMLIKFRTDHTVSSRGFKAKYFET-----CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSG--NAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNT-------EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNG-QCNRGNLIIYDSN---YDAKV--FCGSGVIDS--AIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNC----NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNIYPNN----NESGVITIENVNISLCQYNIH-NYPEDEGTLSM------FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLII-APENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI--------------CGGVYDLRQGE---IVSANVALINYGS-ITCEYLI--PGWENHLQVVYI-YPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLR-SVDIERSYDGCNY-DFV--------XXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG--YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFT-AVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYT--CNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSR-VSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGV-ITSPGFG--TNYYESGECSWNIK--LVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSY----GNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            G+  S  +PN+         + C W  +T P     + + F    +E S  CS    L+  + + +    + + C     G    I SS ++ +  F S +  + G   F+ ++E     C  E+  + G I SP YP  YP N  C W +     + I      L  E  E+ C  DY+EI     + L+    + GK  + +      +      + F +D T   RGF   Y  +     CGG     ++  F+ SP +P  YT  +  C + +    +E   +I   F   E  +     SS  SL+ +E          + C  +   PI S+ + L +  KS +    + FKA Y V    CGG F    G+  +P YP++   +  C ++I    G  + L+   F    A +    +F++IR+G +  S L+G+ Y   E+     + +   +++IR  +     TNH      + I+Y +             G + SP +  VY    + TW +       ++ TFD F+    L++G  C+   L IYDS     ++++  FCG  +  S  +       L+++       GF  R+      N     D  Y    T  + I +SPNYPN       C +TI  +  + + +   +F L +S  C  ++  +   G          Y      G        V  ++  N + + +++D      GF   +  A   C     + + G   +  +P   + N  C + ++ S    + +     DL   +N  C N +L +   N   +     LCG  +P    PI ++ S    N++  F +++  S F   ++   + C G     R   SR +  + N  +  PH  +C W   +  G  +   F    +        ++  +DG     + IG   +CG     S  T G  L ++F + D  +   F+++  +  CG  L    G   SP +P+ YP    CIW I     S+I++T  + +++    CS   L +       +  +   C      +   + +  +T+ + FKT+   + +GF   +      CGG +  P  E++S NYP+       C+W I VD   R+++  +   +             + SV + ++C + L      T+++M + +   G+     +++     CGS I  ++      S +      N   C + I    P +  TLS       F +DN    C+  Y     GN    PV+    G    + + SFS    VV FI       +   +        S CGG L    G   SP YPE YP NT+C W I+ +P N +    + T  ++H   C++D+L IR   E  S   R    + P +  T++ H   + + F SD S+S +GF   ++ +   +     I    G I SP +P+ YP      W I+V +  ++     L  D+E  S   C YD L+I D       ++   CG  PP + I SS + M++ F++D + N++GF  ++ ++              CGG+  LR G+    + +     NY S + C ++I  PG    L ++ +       C Y D  +  D ++ N   L    +CGK           S+ I ++     +    F A Y       + ++     ++ +PN+P  Y  N N TW F    G+  + +   + +I  S   C   D++        S     +++ +  FCG     +    D N + V F SD S+         F        L CGG  Y++ +  + G + S     N  Y  N  C W I  P G AV++ F+     +E       C  +++ + DG D+++ ++  LCG+    +  +    MYL F TD    + GFK  +  A     H  +     S +++SP YP  +  D              ++TI  + + + +S +CS D   I++ +      +  FC S+    + ++S     I++     EN      R F+I Y+  T  C     A SG I++  N+    Y HN +C   +  PA   R         L+    C YDY+    G    Q  +L K+CG+  P + V +S   + +IFVTD S++  G+  T+    D    CGG +   +G   +SPG+    NY  +  C W I+     NS     F  +QL  + + +       DF+++ +    G    + CG         I +S   V + S       GF  S+S
Sbjct:  464 GLTGSFGYPNNPGTDQHGHMLSCMWVIKTEPRKVRILHITFTNFHLEQSTPCST-EFLQVHDGDSISSFMLGKYCGT---GVPQEISSSHNSLFFWFHSDHISSAG--GFRISWESRQPECGGELMETHGSIMSPGYPGNYPPNRDCYWTISTNPGLYITFAFGTLSLEDHEN-CGKDYLEI----RDGLLPQDRVLGKYCSTLSPAPLQTSGPYAWLHFHSDSTGEDRGFHITYITSPSDPGCGG--NFTDNEGFISSPRWPQPYT-GNKQCIYIIQQPANE---KISLRFTNLELEN-----SSGCSLSYME--------VRIYCNTTIPPPISSSSNALWIKFKSDASVTRSSFKAFYQVA---CGG-FLTGAGVIHTPHYPDAYFRERTCEWIITQPEGEVVSLTFNSFDIL-AGTNCGSNFVEIRDGSSSDSPLIGK-YCGPEMPVPAQSTQ--RALYIRFTTDS-SATNH-----GFSISYQSLIEGCGGTLTDTQGTITSPGYPAVYPHGIQCTWFISIPPGNLIRLTFDSFN----LEHGYSCSYDYLDIYDSASAIMESRIGRFCGRSIPPSITSRGNTMTVLLVTDTNTAVEGFSARY---TSLNATTACDASY----TEASGIFSSPNYPNRYPNNLECIYTITVETNKQILLNFTTFVLSTSTNCDKDHVEIRDGG----------YEISPLLGKFCQGPPPVIVSHS-NKLWVKFRSDSSYSETGFSAHWDSATTGCGGTLTS-VSGGFTSPNFPMPYYHNSECYWQMMASSGSTFEIQFEHFDLESHSN--CQNDYLAVYDGNTTHSHLLEKLCGKRLP---DPIRSSGS----NVYVKFRTDNSIS-FSGFFATYKQTCQGVMIANR---SRGILESLNYPNSYPHNQQCNWTIQATLGNTINYTFTTFNVEGYFSCNDYVQLYDGPDKQARLIG--TYCGNQLPPSGTTTGTSLHVVFHSDDTITRPGFQMQWYVNGCGEELSGPFGSFTSPGFPMRYPDNRECIWHIQTSPGSSIQITIWEFNIEYHSTCSYDVLEIYGGPGVSSPRLAQLCAPRPQENPLQVSSTGNTMTVRFKTDAYVSGRGFNTTWREIPGGCGGVFQAPNGEIHSPNYPRPYEDNTECSWVIRVDFGHRVLLTFRDFDIES------HSSCSFDSVTVTVLCGTQLPAAISSTQNTMFVRLRSDGSNQHRGFSAKFTEACGSLITADSIGATISSPLYPANYPNNQNCMWIIQAQEPYNHVTLSFTDLEIEFRNDN----CTLDYVEILDGNNPDAPVQGRYCGRTIPHPITSFSN-ALVVKFISN--NSTSAKGFHATFAASTSACGGTLHMETGAFNSPSYPENYPANTECVWNILSSPGNRL----LLTFSVQHSDSCSHDYLEIREGNETGSLMGRFCGDILPSNITTITGH--ILWIKFVSDGSLSGSGFQATFSHLFGNN-----IGGDRGQIASPLWPRNYPHYSNYLWKINV-DSSQIIQARILEIDIEDHS--GCIYDKLKIYDGPDTHYHVIGTYCGITPPPD-IFSSGSSMTVQFTSDNSINMKGFLLEWLAVDAFSENFPTIAPGACGGI--LRTGDTPLFLFSPGWPNNYASYLDCTWVIKAPGSTVELNILSVDIEKHRSCNY-DKLVIRDGDNNNSPQL--AVVCGKGVPGPIRSSGDSMFIRFSTDG-SVSGTGFNASYHKSCGGYLHANRG---LITSPNYPEHYSANLNCTWHFLVTSGFTIAAHFEPTFEIPNSDSTCGTGDYLELKNGPDDSSPPMGTSTRNGKFCGTSAPSTMHTTD-NEMFVHFVSDNSNEGK-----GFQLKYEALSLACGGSIYISESDPS-GFVTSPKYPEN--YPMNADCVWIITVPNGEAVELEFKEQ-FYIEPSEN---CSSNYLELRDGADASKRLLAKLCGNALPITYKSLGTAMYLRFMTDSGTPRVGFKAMYKIATCGGTHFGQ-----SGIIQSPGYPLQNYPDNSLCEWYFTGPTGHYLTIQFEAMDLHNSTDCSRDFVEIREYNASGR-ILGVFCNSMVPSDL-VTSDSFAYIKFVSDQSEN-----GRGFRIRYDASTEECGGDYTASSG-IISSPNYP-NLYPHNRVCEWRITVPA-GRRVTLTINALLLQDQQNCDYDYVAVYNGYQ-NQSPLLRKLCGNVAPETEVKSSGNTMRVIFVTDGSVSSGGFLATFNSMED--AVCGGALADPTGGHFSSPGYDQVNNYTRNLNCEWIIQNPNTENSTTFISFKRLQLEYHLNCQ------RDFIELRFDNADGELITRLCGRNTPSVPLAIVASQVWVHFVSNAEVENIGFNASYS 2660          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Xenopus
Match: ENSXETT00000007717.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 161.384 bits (407), Expect = 6.756e-39
Identity = 149/573 (26.00%), Postives = 227/573 (39.62%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGCF----RIRARGVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNISL------------------CQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIF-----------------NTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG 9034
            + K  ++   CG    D     ++  YP     +  C W+I+V   ++II+    + +  ++ C+     IR  G   ++ LL  +C   L    I + S + IE   S   +   + +   ++CG +I           YP++       I  + +S                   C Y+                    +  PED  + S      F+SD +    +   F +     + E       GC++R      +TLG     + +PG E+     + E     + CGG +T+  G I SPG+P++YP N +C W ++AP    I L  +   LE +  C YD L IR     +S    K CG  P   E ++   N +RL F SD +VSK GF +  NF +  D C                       NG I                  N EG+I SPN+P  YPS   C W I V  G++V L F    D E      C YD L + D       +L   CG+  P NP+ +S N M L F +D +   +GF A+Y + CGG
Sbjct:  239 QAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRD-GYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGS---INKAGFSANFFKEMDECSRPDNGGCSQR----CVNTLGSY-KCVCEPGFELTADKKQCE-----AACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCG--PEKPEVITSQGNTVRLEFKSDNTVSKRGFKV--NFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFT---DFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEP-NPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGG 789          

HSP 2 Score: 132.88 bits (333), Expect = 4.884e-30
Identity = 156/689 (22.64%), Postives = 263/689 (38.17%), Query Frame = 2
Query: 8591 NRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFK---RPY-----------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDF--VXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYG-----VIKSLDLDNNG--------------------------LYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE-LIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             R+RLS          G + +   +     C   + ++ G+  +P YP  YPS   C W I V  G K+ L F    DL ++ L  C YD + I D       LL  LCG+  P  PI SS +++ + F +  N   +GF A Y++ICGG      G+I S N       +  C + I   E  L  V +    F    HDN     LE ++G   ++    R CG  + +     S  + I + + +  +    F A +  + +              V     +K    P                         + +P +P  Y  N N  W   AP  Y  S+     ++E + D C YDF  +    +S +     FCG      P +I +    VR +    +  +  GF V F +         GG  +  V T+G           L  NG                           Y +   C W IA   GH VK++F +  I          C YDH+ +YDGP+    ++   CG  + + +   +N M+L F +D ++Q+ GF+  ++        +K       +    ++ +N+ Y ++   E +I A +   + +  +  +I    +C  D   + D       ++ ++C S   E ++ S+ D ++I++  
Sbjct:  228 QRIRLS---------QGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNF-TAMDLFKSRL--CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFL--VGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVS-DGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPE---KPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-----CAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST--ECGGRLKAEIQTKDIYSHAQFGDNN-YPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMY-SAGDSIMIRFHT 887          

HSP 3 Score: 119.013 bits (297), Expect = 7.651e-26
Identity = 136/649 (20.96%), Postives = 263/649 (40.52%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQT--------QGCMETF-------------YYDPHESDYSTK------NGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPI-LRAWENEIVDENYVFQACNRID----DGKSIIIQSSTHN------FYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCG-KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGG-LRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKV 5455
            CG     + G+ ++P YPL  P+ T+C W I  TPG++I++    +    + +++LC      ++    +K   +  +C +++ +  +  +  + + F++ ++   + F   Y   C   I   SG+I+S N        + C WK++   G  + +    F++    N   Y ++ + D     + L+ + CG +      ++SN  + I+  +D S +     A+    ++  +        Q C+ T                D  + + +        NG I S  +P     N +C W       + + L+F++ E+E +  C    + +R+  +     +  F    + +     G ++ ++  + N      F + FFS  D     NGG +                     +  ++     CE ++  +EG I SPN+P+ YP    C+W++ V     + L   DFE E+   C YD++E++   N     L   CG K  N +     +  N M ++F +D +V  +GF+AKY   CGG L+  +++        +          CEW +VA   E G  +   F  FE      +C  D  + + +G  + +      C   P   + S G  + +
Sbjct:  249 CGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAM---DLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA-YDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN-KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPV----IASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVA---EDGYGVELIFQTFE-IEEESDCGYD-YMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMI 883          

HSP 4 Score: 104.375 bits (259), Expect = 2.669e-21
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   L  + G I SP +P+KYP   +C W I       ++L      +E H +C YDHL +       S    + CG    NP+   T     N M L F+SD SV + GF  +Y     +  C G +   +  I++ +           YP    C W I   +GY V L F+  F++E  S   C YD + + D   +    L   CG+ PP   + S+ + + + F TD   N +GFH QY S
Sbjct:  670 KEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAST-----NSMFLRFYSDASVQRKGFQAKY-----STECGGRL---KAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQT-FEIEEES--DCGYDYMEVYDGYDSTAPRLGRYCGSGPPEE-MYSAGDSIMIRFHTDDTINKKGFHGQYTS 902          

HSP 5 Score: 103.605 bits (257), Expect = 4.920e-21
Identity = 164/746 (21.98%), Postives = 264/746 (35.39%), Query Frame = 2
Query: 4211 LQNGQCYSFVRISDRSNTLLKKS---------CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLE----YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQAC--NRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGD----------------------FYLD------------------DGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSG 6109
            +Q GQ Y+F+++       L ++           N      F  +  P RI+    R T    IR  +G + +    Y+   C ET              G   +  +P    +   C W     PG  + L F  +++  S  C        W + I + + Y  +A    R+  D     I SS    +++F S+++  G  + F   YE     C  ++    G IQSPNYP+ Y     C W + V E   + L    FE E    C YDY+E+    + D   +   CG           S +N++ IKF +D +++  GF A +F+                                            CGG    +  N  + SP +P  Y   +  C W +VA       RI   F  FE   N+  C  D  L I  G+ + S +    C       I S G+ +++  KS  T     FK  +      C  D                      F L                   +G  +SP +P+      +C + I  + G  + L   +F  E       +D +++ +GPN  S++LGRF    E      +    +S+++R  S          F AKY        +++     + +  QFG + Y   +   W + AE    ++  F  F +    D   C    + +YD  YD+       +CGSG
Sbjct:  168 IQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSV-RPTIGQRIRLSQGDIAQAKKLYKCPACGETL---------QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLC--------WYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILG--KGFFAVYEAI---CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEK---PEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQL--NGTITSPGWPKEYPT-NKNCVWQVVAPAQ---YRISLQFEVFELEGNDV-CKYD-FLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQH-QECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAS---TNSMFLRFYSDAS--VQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESD---CGYDYMEVYD-GYDSTAPRLGRYCGSG 869          

HSP 6 Score: 98.9821 bits (245), Expect = 1.303e-19
Identity = 139/635 (21.89%), Postives = 238/635 (37.48%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYG-------------------------VGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYN--------TEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV 6424
            +C   +  S G   +P YP  YP    C W + V     I L     +  +S LC YDY+EI          L  LCG   + +     S ++++ I+FR+   +  +GF A Y   CGG  +  +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ NC+ D  L + +G   + ++    C       I S  +  K+ +K  S  +I KA +                          +GS                   + CGG     +G  TSP +P     + +CV+ +       I L  E F  E       +DF++IR+G +  S L G+F          S+       +K +++V  R              +  GG   + +     Y          H N +         +  +  G ++SP +   Y    E TW +   +  +++  F  F + +   + +C   +L +YD  N  + +   FCGS   +  I +     +   S    +  GF  +++           +C   +KA  QT+ + S       NYP     +  C W I+ +    +++   +F++E   +C Y+   V
Sbjct:  248 ACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGG-DIKKDSGQ-IQSPNYPDDYR-PAKECIWKITVSE---GFLVGLSFQAFEIERHD-NCAYD-YLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN--KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ---HQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST----------ECGGRLKAEIQTKDIYSHAQFGDNNYP----VQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEV 851          

HSP 7 Score: 92.0485 bits (227), Expect = 1.752e-17
Identity = 85/298 (28.52%), Postives = 135/298 (45.30%), Query Frame = 2
Query: 2609 KGISTPEFQISA-----EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF---------------DCGGSFF-----LTNKLII----------GYPESHLNE----STYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTV--THKLVIRFVSDNSVSGEGFIMRFYT 3355
            K +  P F+++A     E ACG  +     +     S  +P+ Y  N +CV+Q  A  + +I++ F  F++  +  CK+DF++I SG S+   L  ++C   K E+IT   N     + + FKS++T +  GF  KV+ F               DC  +F        N  I+          G  +  +N     S+ +   +Y   K CTW+I       +  VF  F +E H  CAYD+LEL      K     RFCG+  +  P +  T+ + +RF SD SV  +GF  ++ T
Sbjct:  498 KCVCEPGFELTADKKQCEAACGGFITQLNGT---ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGN----TVRLEFKSDNTVSKRGF--KVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST 785          

HSP 8 Score: 87.0409 bits (214), Expect = 6.000e-16
Identity = 67/243 (27.57%), Postives = 107/243 (44.03%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDL-DNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW      G+   +     +IE+  + C YD +      +  S  +  FCG+    +P +  TN + +RF SD S      GF A  +        CGG + A + T  +       DNN   ++N  C+W I A  G+ V++IF+   I  E       C YD++ +YDG DS  P +   CG    + + +  + + + F TD  I K GF   +T+   Q+ L
Sbjct:  684 TISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDAS--VQRKGFQAKYSTE------CGGRLKAEIQTKDIYSHAQFGDNNYPVQSN--CEWVIVAEDGYGVELIFQTFEIEEESD-----CGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTKFQDAL 909          

HSP 9 Score: 84.3445 bits (207), Expect = 3.494e-15
Identity = 71/244 (29.10%), Postives = 107/244 (43.85%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F +  YP  Y   +HC+++       KI ++F   D+     C +D+I+I         L  R C     E I  + +    K+ I F+S+S   G GF A      CGG         I      +    Y ++  Y   K C W+IT      +   F  F +E H NCAYDYLE + D  ++      RFCG    +   + ++KL I+FVSD S++  GF   F+
Sbjct:  248 ACGETL---QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDS----KLWIEFRSSSNILGKGFFAVYEAI-CGGD--------IKKDSGQIQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLE-VRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFF 472          

HSP 10 Score: 79.337 bits (194), Expect = 1.234e-13
Identity = 120/598 (20.07%), Postives = 220/598 (36.79%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF------------------------------------TAVPSQNHLI--KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQI----------------------SYELYTC-------------NRTEKAYSGRIVNVENFKQK-----KYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLD---SGVITSPGFGTNYYE-SGECSWNI 10945
               P +P  Y    +  W  +   G    +N  ++D+ +S   C YD++         +  +   CG+     P +   + L + F+S  S      GF A           CGG +    G    I+S +  ++  Y     C W+I    G  V + F+   I      R   C YD++ + DG      +I   CG ++ + I + SN +++ F +D +I K+GF   F                                    TA   Q        +T  +  + SP +P   P +   + +++A  +   I++  +  ++  +  C  D F+   + L  E+K+  KFC     E V  S  + V ++++     + N+ + R F++                      ++  Y C             +  E     +++N E          KY     C   +   A + R +  F  F +E+   CAYD+++   G P  +  +L + CGS  P   + +++ + + F +D S+   G+   Y      S +CGG +  +     + +   FG N Y     C W I
Sbjct:  260 FSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRL-CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRS--SSNILGKGFFAVYEAI------CGGDIKKDSGQ---IQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIE-----RHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQY-RISLQFEVFELEGNDVCKYD-FLEIRSGLSSESKLHGKFCGPEKPE-VITSQGNTVRLEFK-----SDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGH-RVKLVFTDFEIEQHQECAYDHLELYDG-PNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKY------STECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI 821          

HSP 11 Score: 75.0998 bits (183), Expect = 2.210e-12
Identity = 52/230 (22.61%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKISGSNSGH--LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTKRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +        ++ + F DF+I    EC +D +++    +G   +  R+C   +   +  ++N     + + F S+++    GF+AK S  +CGG      +    Y  +   ++ Y  ++       C W I       +  +F  F +E   +C YDY+E+   +D+   R  G +  SGP     +    ++IRF +D++++ +GF  ++ + K
Sbjct:  687 SPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN----SMFLRFYSDASVQRKGFQAKYST-ECGGRLKAEIQTKDIYSHAQFGDNNYPVQSN------CEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRL-GRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTK 904          

HSP 12 Score: 73.9442 bits (180), Expect = 5.463e-12
Identity = 129/550 (23.45%), Postives = 203/550 (36.91%), Query Frame = 2
Query: 6728 ILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDDFSY------------------------FRL----KVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GGEYSD------------------------------------PERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCFRIRAR---GVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNI-SLCQYNIHNYP 8071
            ILN TA+DL    +  C   +++I      K      LCG  +P   +PII++ S     L+  F S S   G +  ++  +  CGG  +    +DS  +   +      P   EC W  T   G  + + F+   I R   C   +L   DG +     IG   FCG  K   I +  N L I                 FK MD+ S                         F L    K    +CGG + +  G I SP +P  YP   +C+WQ+   +   I L F   +L+ N  C    L +     SE+ +    C     ++ T + +TVR+ FK++   +++GFK+ +F +   C    GG   D                                     E  ++S N+P        CTW I V    R+ +     +++ +Q C         G   +S +L   C S   N  I + +SM   F S A++    + +   + CG  +           I+  +I S  Q+  +NYP
Sbjct:  288 ILNFTAMDLF--KSRLCWYDYIEIRDGYWRKAALLGRLCGDKLP---EPIISSDS----KLWIEFRSSSNILG-KGFFAVYEAICGGDIK----KDSGQIQSPNYPDDYRPA-KECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIG--RFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAE--------IQTKDIYSHAQFGDNNYP 812          

HSP 13 Score: 67.3958 bits (163), Expect = 4.790e-10
Identity = 88/398 (22.11%), Postives = 148/398 (37.19%), Query Frame = 2
Query: 4088 ITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTH-------------------------------SNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFT-NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFE-TEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            IT  +G I S      Y     C W++ +    +I +Q + F+L    N  C Y F+ I       + L  K CG +      TS    +R+E  +D +                                 S + +   G +L      C E       E       G I S  +P+   +  +C W+     G  VKL F   E+E    C+    L  ++        + + C   +    I   +ST++ +L+F+S  D +   + FQ  Y        + E+   +    +    N YP    C W +  ++   + L    FE  EES C YDY+E++   ++   +L   CG           S  + ++I+F TD T++ +GF  +Y  T
Sbjct:  522 ITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE--GNDVCKYDFLEIRSGLSSESKLHGKFCGPEK-PEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA----GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDH-LELYDGPNGKSAILGRFCGSKEPNPVI---ASTNSMFLRFYS--DASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGP---PEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 903          

HSP 14 Score: 62.003 bits (149), Expect = 2.167e-8
Identity = 53/213 (24.88%), Postives = 93/213 (43.66%), Query Frame = 2
Query: 7043 PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK---NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCN-SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC 7654
            P +  C W  +  PG ++ ++F  + +    +C   ++   DG       +G    CG      I +  + L I F+   N+    +F +   I  CGG + +  G I SPNYP +Y P   CIW+I+      + L+F   +++  +NC+   L V      ++A+I   C      DI +  + + I F ++    + GF   +F E   C
Sbjct:  270 PSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLG--RLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAI--CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDEC 478          

HSP 15 Score: 62.003 bits (149), Expect = 2.631e-8
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 2
Query: 7232 TIGNVLTILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            TIG  + +   +  D +  +   K  +CG  L    G  ++P YPL YP  + CIW+IS      I L F   DL ++  C    + +      + A++   C     + I +  S + I F++++    KGF   Y   + +CGG+      ++ S NYP        C WKI V
Sbjct:  225 TIGQRIRL---SQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY---EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV 394          

HSP 16 Score: 59.3066 bits (142), Expect = 1.632e-7
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGY 11089
            I+  P  +    F   +L +S  C YDYI+   G    +  +L ++CG  +P   +++ S++ + F +  +I   G+   Y         CGG+I  DSG I SP +  +Y  + EC W I +     +   F   ++  + +         D+++V  G   + AL  ++CGY
Sbjct:  279 ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGY-WRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY------EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA------YDYLEVRDGFSEDHALIGRFCGY 439          

HSP 17 Score: 58.151 bits (139), Expect = 3.831e-7
Identity = 69/330 (20.91%), Postives = 122/330 (36.97%), Query Frame = 2
Query: 10127 KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNN 11005
            +T+ +      +P YP   P     +   I+    + I +    + +  S  C  D   I+D   +    + + C     E + ISS  K+ I+++     + ++   + F   YE   C    K  SG+I +       + +   I  +T+   +        F+ F +ER   CAYDY++   G   E   ++ + CG   P    + S+++ + FV+D SIN  G+   +    D   +                                     CGG I   +G ITSPG+   Y  +  C W +   +   I  +F   +L  N
Sbjct:  251 ETLQDSGGNFSAPGYPLGYPSYTHCIWR-ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPI-ISSDSKLWIEFR-----SSSNILGKGFFAVYEA-ICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV---SEGFLVGLSFQAFEIERHDNCAYDYLEVRDGF-SEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN 568          

HSP 18 Score: 54.299 bits (129), Expect = 5.299e-6
Identity = 79/360 (21.94%), Postives = 140/360 (38.89%), Query Frame = 2
Query: 3698 FNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVFEEQS-------------VHVIFQNLASTKYRFRLY------YTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            F  T +    +  CG       G I SP +P   P N  C W++ +    RI ++                  IRSG   E+KL    C  + P  + +T++        K  N V S++  K++ F ++              V+     +   K  F L+          CE  + ++ G I S N   +Y     C+W ++   G ++ +    F++   Q+ +C Y  + + D  N    +L + CG++  N    S+N  + +  Y+D S         +G   +Y T+ C         +++  TK+ +   AQF   N     +C+W      G+ V+L F   E+E   +C 
Sbjct:  505 FELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKP--EVITSQGNTVRLEFKSDNTV-SKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIE--QHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN-SMFLRFYSDASVQ------RKGFQAKYSTE-CGGRL-----KAEIQTKD-IYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCG 845          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Xenopus
Match: ENSXETT00000007792.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 161.384 bits (407), Expect = 6.994e-39
Identity = 149/573 (26.00%), Postives = 227/573 (39.62%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGCF----RIRARGVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNISL------------------CQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIF-----------------NTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG 9034
            + K  ++   CG    D     ++  YP     +  C W+I+V   ++II+    + +  ++ C+     IR  G   ++ LL  +C   L    I + S + IE   S   +   + +   ++CG +I           YP++       I  + +S                   C Y+                    +  PED  + S      F+SD +    +   F +     + E       GC++R      +TLG     + +PG E+     + E     + CGG +T+  G I SPG+P++YP N +C W ++AP    I L  +   LE +  C YD L IR     +S    K CG  P   E ++   N +RL F SD +VSK GF +  NF +  D C                       NG I                  N EG+I SPN+P  YPS   C W I V  G++V L F    D E      C YD L + D       +L   CG+  P NP+ +S N M L F +D +   +GF A+Y + CGG
Sbjct:  239 QAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRD-GYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGS---INKAGFSANFFKEMDECSRPDNGGCSQR----CVNTLGSY-KCVCEPGFELTADKKQCE-----AACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCG--PEKPEVITSQGNTVRLEFKSDNTVSKRGFKV--NFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFT---DFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEP-NPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGG 789          

HSP 2 Score: 132.88 bits (333), Expect = 4.761e-30
Identity = 156/689 (22.64%), Postives = 263/689 (38.17%), Query Frame = 2
Query: 8591 NRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFK---RPY-----------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDF--VXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYG-----VIKSLDLDNNG--------------------------LYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE-LIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             R+RLS          G + +   +     C   + ++ G+  +P YP  YPS   C W I V  G K+ L F    DL ++ L  C YD + I D       LL  LCG+  P  PI SS +++ + F +  N   +GF A Y++ICGG      G+I S N       +  C + I   E  L  V +    F    HDN     LE ++G   ++    R CG  + +     S  + I + + +  +    F A +  + +              V     +K    P                         + +P +P  Y  N N  W   AP  Y  S+     ++E + D C YDF  +    +S +     FCG      P +I +    VR +    +  +  GF V F +         GG  +  V T+G           L  NG                           Y +   C W IA   GH VK++F +  I          C YDH+ +YDGP+    ++   CG  + + +   +N M+L F +D ++Q+ GF+  ++        +K       +    ++ +N+ Y ++   E +I A +   + +  +  +I    +C  D   + D       ++ ++C S   E ++ S+ D ++I++  
Sbjct:  228 QRIRLS---------QGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNF-TAMDLFKSRL--CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFL--VGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVS-DGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPE---KPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-----CAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST--ECGGRLKAEIQTKDIYSHAQFGDNN-YPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMY-SAGDSIMIRFHT 887          

HSP 3 Score: 119.013 bits (297), Expect = 8.843e-26
Identity = 136/649 (20.96%), Postives = 263/649 (40.52%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQT--------QGCMETF-------------YYDPHESDYSTK------NGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPI-LRAWENEIVDENYVFQACNRID----DGKSIIIQSSTHN------FYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCG-KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGG-LRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKV 5455
            CG     + G+ ++P YPL  P+ T+C W I  TPG++I++    +    + +++LC      ++    +K   +  +C +++ +  +  +  + + F++ ++   + F   Y   C   I   SG+I+S N        + C WK++   G  + +    F++    N   Y ++ + D     + L+ + CG +      ++SN  + I+  +D S +     A+    ++  +        Q C+ T                D  + + +        NG I S  +P     N +C W       + + L+F++ E+E +  C    + +R+  +     +  F    + +     G ++ ++  + N      F + FFS  D     NGG +                     +  ++     CE ++  +EG I SPN+P+ YP    C+W++ V     + L   DFE E+   C YD++E++   N     L   CG K  N +     +  N M ++F +D +V  +GF+AKY   CGG L+  +++        +          CEW +VA   E G  +   F  FE      +C  D  + + +G  + +      C   P   + S G  + +
Sbjct:  249 CGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAM---DLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA-YDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN-KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPV----IASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVA---EDGYGVELIFQTFE-IEEESDCGYD-YMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMI 883          

HSP 4 Score: 104.375 bits (259), Expect = 2.602e-21
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   L  + G I SP +P+KYP   +C W I       ++L      +E H +C YDHL +       S    + CG    NP+   T     N M L F+SD SV + GF  +Y     +  C G +   +  I++ +           YP    C W I   +GY V L F+  F++E  S   C YD + + D   +    L   CG+ PP   + S+ + + + F TD   N +GFH QY S
Sbjct:  670 KEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAST-----NSMFLRFYSDASVQRKGFQAKY-----STECGGRL---KAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQT-FEIEEES--DCGYDYMEVYDGYDSTAPRLGRYCGSGPPEE-MYSAGDSIMIRFHTDDTINKKGFHGQYTS 902          

HSP 5 Score: 103.219 bits (256), Expect = 5.830e-21
Identity = 164/746 (21.98%), Postives = 264/746 (35.39%), Query Frame = 2
Query: 4211 LQNGQCYSFVRISDRSNTLLKKS---------CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLE----YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQAC--NRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGD----------------------FYLD------------------DGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSG 6109
            +Q GQ Y+F+++       L ++           N      F  +  P RI+    R T    IR  +G + +    Y+   C ET              G   +  +P    +   C W     PG  + L F  +++  S  C        W + I + + Y  +A    R+  D     I SS    +++F S+++  G  + F   YE     C  ++    G IQSPNYP+ Y     C W + V E   + L    FE E    C YDY+E+    + D   +   CG           S +N++ IKF +D +++  GF A +F+                                            CGG    +  N  + SP +P  Y   +  C W +VA       RI   F  FE   N+  C  D  L I  G+ + S +    C       I S G+ +++  KS  T     FK  +      C  D                      F L                   +G  +SP +P+      +C + I  + G  + L   +F  E       +D +++ +GPN  S++LGRF    E      +    +S+++R  S          F AKY        +++     + +  QFG + Y   +   W + AE    ++  F  F +    D   C    + +YD  YD+       +CGSG
Sbjct:  168 IQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSV-RPTIGQRIRLSQGDIAQAKKLYKCPACGETL---------QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLC--------WYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILG--KGFFAVYEAI---CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEK---PEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQL--NGTITSPGWPKEYPT-NKNCVWQVVAPAQ---YRISLQFEVFELEGNDV-CKYD-FLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQH-QECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAS---TNSMFLRFYSDAS--VQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESD---CGYDYMEVYD-GYDSTAPRLGRYCGSG 869          

HSP 6 Score: 98.9821 bits (245), Expect = 1.281e-19
Identity = 139/635 (21.89%), Postives = 238/635 (37.48%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYG-------------------------VGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYN--------TEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV 6424
            +C   +  S G   +P YP  YP    C W + V     I L     +  +S LC YDY+EI          L  LCG   + +     S ++++ I+FR+   +  +GF A Y   CGG  +  +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ NC+ D  L + +G   + ++    C       I S  +  K+ +K  S  +I KA +                          +GS                   + CGG     +G  TSP +P     + +CV+ +       I L  E F  E       +DF++IR+G +  S L G+F          S+       +K +++V  R              +  GG   + +     Y          H N +         +  +  G ++SP +   Y    E TW +   +  +++  F  F + +   + +C   +L +YD  N  + +   FCGS   +  I +     +   S    +  GF  +++           +C   +KA  QT+ + S       NYP     +  C W I+ +    +++   +F++E   +C Y+   V
Sbjct:  248 ACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGG-DIKKDSGQ-IQSPNYPDDYR-PAKECIWKITVSE---GFLVGLSFQAFEIERHD-NCAYD-YLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN--KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ---HQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST----------ECGGRLKAEIQTKDIYSHAQFGDNNYP----VQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEV 851          

HSP 7 Score: 91.6633 bits (226), Expect = 1.859e-17
Identity = 85/298 (28.52%), Postives = 135/298 (45.30%), Query Frame = 2
Query: 2609 KGISTPEFQISA-----EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF---------------DCGGSFF-----LTNKLII----------GYPESHLNE----STYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTV--THKLVIRFVSDNSVSGEGFIMRFYT 3355
            K +  P F+++A     E ACG  +     +     S  +P+ Y  N +CV+Q  A  + +I++ F  F++  +  CK+DF++I SG S+   L  ++C   K E+IT   N     + + FKS++T +  GF  KV+ F               DC  +F        N  I+          G  +  +N     S+ +   +Y   K CTW+I       +  VF  F +E H  CAYD+LEL      K     RFCG+  +  P +  T+ + +RF SD SV  +GF  ++ T
Sbjct:  498 KCVCEPGFELTADKKQCEAACGGFITQLNGT---ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGN----TVRLEFKSDNTVSKRGF--KVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST 785          

HSP 8 Score: 87.0409 bits (214), Expect = 5.703e-16
Identity = 67/243 (27.57%), Postives = 107/243 (44.03%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDL-DNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW      G+   +     +IE+  + C YD +      +  S  +  FCG+    +P +  TN + +RF SD S      GF A  +        CGG + A + T  +       DNN   ++N  C+W I A  G+ V++IF+   I  E       C YD++ +YDG DS  P +   CG    + + +  + + + F TD  I K GF   +T+   Q+ L
Sbjct:  684 TISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDAS--VQRKGFQAKYSTE------CGGRLKAEIQTKDIYSHAQFGDNNYPVQSN--CEWVIVAEDGYGVELIFQTFEIEEESD-----CGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTKFQDAL 909          

HSP 9 Score: 83.9593 bits (206), Expect = 4.069e-15
Identity = 71/244 (29.10%), Postives = 107/244 (43.85%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F +  YP  Y   +HC+++       KI ++F   D+     C +D+I+I         L  R C     E I  + +    K+ I F+S+S   G GF A      CGG         I      +    Y ++  Y   K C W+IT      +   F  F +E H NCAYDYLE + D  ++      RFCG    +   + ++KL I+FVSD S++  GF   F+
Sbjct:  248 ACGETL---QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDS----KLWIEFRSSSNILGKGFFAVYEAI-CGGD--------IKKDSGQIQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLE-VRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFF 472          

HSP 10 Score: 78.9518 bits (193), Expect = 1.437e-13
Identity = 120/596 (20.13%), Postives = 220/596 (36.91%), Query Frame = 2
Query: 9413 TPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF------------------------------------TAVPSQNHLI--KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQI----------------------SYELYTC-------------NRTEKAYSGRIVNVENFKQK-----KYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLD---SGVITSPGFGTNYYE-SGECSWNI 10945
             P +P  Y    +  W  +   G    +N  ++D+ +S   C YD++         +  +   CG+     P +   + L + F+S  S      GF A           CGG +    G    I+S +  ++  Y     C W+I    G  V + F+   I      R   C YD++ + DG      +I   CG ++ + I + SN +++ F +D +I K+GF   F                                    TA   Q        +T  +  + SP +P   P +   + +++A  +   I++  +  ++  +  C  D F+   + L  E+K+  KFC     E V  S  + V ++++     + N+ + R F++                      ++  Y C             +  E     +++N E          KY     C   +   A + R +  F  F +E+   CAYD+++   G P  +  +L + CGS  P   + +++ + + F +D S+   G+   Y      S +CGG +  +     + +   FG N Y     C W I
Sbjct:  262 APGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRL-CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRS--SSNILGKGFFAVYEAI------CGGDIKKDSGQ---IQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIE-----RHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQY-RISLQFEVFELEGNDVCKYD-FLEIRSGLSSESKLHGKFCGPEKPE-VITSQGNTVRLEFK-----SDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGH-RVKLVFTDFEIEQHQECAYDHLELYDG-PNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKY------STECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI 821          

HSP 11 Score: 75.0998 bits (183), Expect = 2.385e-12
Identity = 52/230 (22.61%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKISGSNSGH--LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTKRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +        ++ + F DF+I    EC +D +++    +G   +  R+C   +   +  ++N     + + F S+++    GF+AK S  +CGG      +    Y  +   ++ Y  ++       C W I       +  +F  F +E   +C YDY+E+   +D+   R  G +  SGP     +    ++IRF +D++++ +GF  ++ + K
Sbjct:  687 SPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN----SMFLRFYSDASVQRKGFQAKYST-ECGGRLKAEIQTKDIYSHAQFGDNNYPVQSN------CEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRL-GRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTK 904          

HSP 12 Score: 73.9442 bits (180), Expect = 4.772e-12
Identity = 125/552 (22.64%), Postives = 201/552 (36.41%), Query Frame = 2
Query: 6728 ILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSS--WIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDDFSY------------------------FRL----KVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GGEYSD------------------------------------PERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCFRIRAR---GVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNI-SLCQYNIHNYP 8071
            ILN TA+DL    +  C   +++I      K      LCG  +P   +PII++ S  WI      N   +  ++ ++ +     ++  G+ +   Y D    D    +        EC W  T   G  + + F+   I R   C   +L   DG +     IG   FCG  K   I +  N L I                 FK MD+ S                         F L    K    +CGG + +  G I SP +P  YP   +C+WQ+   +   I L F   +L+ N  C    L +     SE+ +    C     ++ T + +TVR+ FK++   +++GFK+ +F +   C    GG   D                                     E  ++S N+P        CTW I V    R+ +     +++ +Q C         G   +S +L   C S   N  I + +SM   F S A++    + +   + CG  +           I+  +I S  Q+  +NYP
Sbjct:  288 ILNFTAMDLF--KSRLCWYDYIEIRDGYWRKAALLGRLCGDKLP---EPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPD----DYRPAK--------ECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIG--RFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAE--------IQTKDIYSHAQFGDNNYP 812          

HSP 13 Score: 67.3958 bits (163), Expect = 6.018e-10
Identity = 88/398 (22.11%), Postives = 148/398 (37.19%), Query Frame = 2
Query: 4088 ITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTH-------------------------------SNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFT-NYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFE-TEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            IT  +G I S      Y     C W++ +    +I +Q + F+L    N  C Y F+ I       + L  K CG +      TS    +R+E  +D +                                 S + +   G +L      C E       E       G I S  +P+   +  +C W+     G  VKL F   E+E    C+    L  ++        + + C   +    I   +ST++ +L+F+S  D +   + FQ  Y        + E+   +    +    N YP    C W +  ++   + L    FE  EES C YDY+E++   ++   +L   CG           S  + ++I+F TD T++ +GF  +Y  T
Sbjct:  522 ITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE--GNDVCKYDFLEIRSGLSSESKLHGKFCGPEK-PEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA----GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDH-LELYDGPNGKSAILGRFCGSKEPNPVI---ASTNSMFLRFYS--DASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGP---PEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 903          

HSP 14 Score: 62.003 bits (149), Expect = 2.185e-8
Identity = 53/213 (24.88%), Postives = 93/213 (43.66%), Query Frame = 2
Query: 7043 PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK---NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCN-SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC 7654
            P +  C W  +  PG ++ ++F  + +    +C   ++   DG       +G    CG      I +  + L I F+   N+    +F +   I  CGG + +  G I SPNYP +Y P   CIW+I+      + L+F   +++  +NC+   L V      ++A+I   C      DI +  + + I F ++    + GF   +F E   C
Sbjct:  270 PSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLG--RLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAI--CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDEC 478          

HSP 15 Score: 62.003 bits (149), Expect = 2.480e-8
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 2
Query: 7232 TIGNVLTILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            TIG  + +   +  D +  +   K  +CG  L    G  ++P YPL YP  + CIW+IS      I L F   DL ++  C    + +      + A++   C     + I +  S + I F++++    KGF   Y   + +CGG+      ++ S NYP        C WKI V
Sbjct:  225 TIGQRIRL---SQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY---EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV 394          

HSP 16 Score: 59.3066 bits (142), Expect = 1.605e-7
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGY 11089
            I+  P  +    F   +L +S  C YDYI+   G    +  +L ++CG  +P   +++ S++ + F +  +I   G+   Y         CGG+I  DSG I SP +  +Y  + EC W I +     +   F   ++  + +         D+++V  G   + AL  ++CGY
Sbjct:  279 ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGY-WRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY------EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA------YDYLEVRDGFSEDHALIGRFCGY 439          

HSP 17 Score: 57.7658 bits (138), Expect = 4.936e-7
Identity = 69/330 (20.91%), Postives = 122/330 (36.97%), Query Frame = 2
Query: 10127 KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNN 11005
            +T+ +      +P YP   P     +   I+    + I +    + +  S  C  D   I+D   +    + + C     E + ISS  K+ I+++     + ++   + F   YE   C    K  SG+I +       + +   I  +T+   +        F+ F +ER   CAYDY++   G   E   ++ + CG   P    + S+++ + FV+D SIN  G+   +    D   +                                     CGG I   +G ITSPG+   Y  +  C W +   +   I  +F   +L  N
Sbjct:  251 ETLQDSGGNFSAPGYPLGYPSYTHCIWR-ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPI-ISSDSKLWIEFR-----SSSNILGKGFFAVYEA-ICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV---SEGFLVGLSFQAFEIERHDNCAYDYLEVRDGF-SEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN 568          

HSP 18 Score: 53.9138 bits (128), Expect = 5.964e-6
Identity = 79/360 (21.94%), Postives = 140/360 (38.89%), Query Frame = 2
Query: 3698 FNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVFEEQS-------------VHVIFQNLASTKYRFRLY------YTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            F  T +    +  CG       G I SP +P   P N  C W++ +    RI ++                  IRSG   E+KL    C  + P  + +T++        K  N V S++  K++ F ++              V+     +   K  F L+          CE  + ++ G I S N   +Y     C+W ++   G ++ +    F++   Q+ +C Y  + + D  N    +L + CG++  N    S+N  + +  Y+D S         +G   +Y T+ C         +++  TK+ +   AQF   N     +C+W      G+ V+L F   E+E   +C 
Sbjct:  505 FELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKP--EVITSQGNTVRLEFKSDNTV-SKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIE--QHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN-SMFLRFYSDASVQ------RKGFQAKYSTE-CGGRL-----KAEIQTKD-IYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCG 845          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Xenopus
Match: ENSXETT00000007920.1 (tolloid like 2 [Source:NCBI gene;Acc:105947755])

HSP 1 Score: 161.384 bits (407), Expect = 7.194e-39
Identity = 149/573 (26.00%), Postives = 227/573 (39.62%), Query Frame = 2
Query: 7622 KLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGCF----RIRARGVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNISL------------------CQYNI-------------------HNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIF-----------------NTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGG 9034
            + K  ++   CG    D     ++  YP     +  C W+I+V   ++II+    + +  ++ C+     IR  G   ++ LL  +C   L    I + S + IE   S   +   + +   ++CG +I           YP++       I  + +S                   C Y+                    +  PED  + S      F+SD +    +   F +     + E       GC++R      +TLG     + +PG E+     + E     + CGG +T+  G I SPG+P++YP N +C W ++AP    I L  +   LE +  C YD L IR     +S    K CG  P   E ++   N +RL F SD +VSK GF +  NF +  D C                       NG I                  N EG+I SPN+P  YPS   C W I V  G++V L F    D E      C YD L + D       +L   CG+  P NP+ +S N M L F +D +   +GF A+Y + CGG
Sbjct:  277 QAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRD-GYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGS---INKAGFSANFFKEMDECSRPDNGGCSQR----CVNTLGSY-KCVCEPGFELTADKKQCE-----AACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCG--PEKPEVITSQGNTVRLEFKSDNTVSKRGFKV--NFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFT---DFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEP-NPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGG 827          

HSP 2 Score: 133.265 bits (334), Expect = 4.285e-30
Identity = 156/689 (22.64%), Postives = 263/689 (38.17%), Query Frame = 2
Query: 8591 NRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG---NYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDEN--------------VKVFSDFK---RPY-----------------------VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDF--VXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYG-----VIKSLDLDNNG--------------------------LYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE-LIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             R+RLS          G + +   +     C   + ++ G+  +P YP  YPS   C W I V  G K+ L F    DL ++ L  C YD + I D       LL  LCG+  P  PI SS +++ + F +  N   +GF A Y++ICGG      G+I S N       +  C + I   E  L  V +    F    HDN     LE ++G   ++    R CG  + +     S  + I + + +  +    F A +  + +              V     +K    P                         + +P +P  Y  N N  W   AP  Y  S+     ++E + D C YDF  +    +S +     FCG      P +I +    VR +    +  +  GF V F +         GG  +  V T+G           L  NG                           Y +   C W IA   GH VK++F +  I          C YDH+ +YDGP+    ++   CG  + + +   +N M+L F +D ++Q+ GF+  ++        +K       +    ++ +N+ Y ++   E +I A +   + +  +  +I    +C  D   + D       ++ ++C S   E ++ S+ D ++I++  
Sbjct:  266 QRIRLS---------QGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNF-TAMDLFKSRL--CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFL--VGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVS-DGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPE---KPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-----CAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST--ECGGRLKAEIQTKDIYSHAQFGDNN-YPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMY-SAGDSIMIRFHT 925          

HSP 3 Score: 119.013 bits (297), Expect = 8.798e-26
Identity = 136/649 (20.96%), Postives = 263/649 (40.52%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKE--INIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQT--------QGCMETF-------------YYDPHESDYSTK------NGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPI-LRAWENEIVDENYVFQACNRID----DGKSIIIQSSTHN------FYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCG-KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGG-LRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKV 5455
            CG     + G+ ++P YPL  P+ T+C W I  TPG++I++    +    + +++LC      ++    +K   +  +C +++ +  +  +  + + F++ ++   + F   Y   C   I   SG+I+S N        + C WK++   G  + +    F++    N   Y ++ + D     + L+ + CG +      ++SN  + I+  +D S +     A+    ++  +        Q C+ T                D  + + +        NG I S  +P     N +C W       + + L+F++ E+E +  C    + +R+  +     +  F    + +     G ++ ++  + N      F + FFS  D     NGG +                     +  ++     CE ++  +EG I SPN+P+ YP    C+W++ V     + L   DFE E+   C YD++E++   N     L   CG K  N +     +  N M ++F +D +V  +GF+AKY   CGG L+  +++        +          CEW +VA   E G  +   F  FE      +C  D  + + +G  + +      C   P   + S G  + +
Sbjct:  287 CGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAM---DLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA-YDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN-KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPV----IASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVA---EDGYGVELIFQTFE-IEEESDCGYD-YMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMI 921          

HSP 4 Score: 103.99 bits (258), Expect = 3.320e-21
Identity = 75/250 (30.00%), Postives = 110/250 (44.00%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   L  + G I SP +P+KYP   +C W I       ++L      +E H +C YDHL +       S    + CG    NP+   T     N M L F+SD SV + GF  +Y     +  C G +   +  I++ +           YP    C W I   +GY V L F+  F++E  S   C YD + + D   +    L   CG+ PP   + S+ + + + F TD   N +GFH QY S
Sbjct:  708 KEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAST-----NSMFLRFYSDASVQRKGFQAKY-----STECGGRL---KAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQT-FEIEEES--DCGYDYMEVYDGYDSTAPRLGRYCGSGPPEE-MYSAGDSIMIRFHTDDTINKKGFHGQYTS 940          

HSP 5 Score: 103.605 bits (257), Expect = 4.175e-21
Identity = 164/746 (21.98%), Postives = 264/746 (35.39%), Query Frame = 2
Query: 4211 LQNGQCYSFVRISDRSNTLLKKS---------CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLE----YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQAC--NRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAYGVGSSTCGGD----------------------FYLD------------------DGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSG 6109
            +Q GQ Y+F+++       L ++           N      F  +  P RI+    R T    IR  +G + +    Y+   C ET              G   +  +P    +   C W     PG  + L F  +++  S  C        W + I + + Y  +A    R+  D     I SS    +++F S+++  G  + F   YE     C  ++    G IQSPNYP+ Y     C W + V E   + L    FE E    C YDY+E+    + D   +   CG           S +N++ IKF +D +++  GF A +F+                                            CGG    +  N  + SP +P  Y   +  C W +VA       RI   F  FE   N+  C  D  L I  G+ + S +    C       I S G+ +++  KS  T     FK  +      C  D                      F L                   +G  +SP +P+      +C + I  + G  + L   +F  E       +D +++ +GPN  S++LGRF    E      +    +S+++R  S          F AKY        +++     + +  QFG + Y   +   W + AE    ++  F  F +    D   C    + +YD  YD+       +CGSG
Sbjct:  206 IQPGQEYNFLKMEPGEVNSLGETYDFDSIMHYARNTFSRGVFLDTILPRRIDTSV-RPTIGQRIRLSQGDIAQAKKLYKCPACGETL---------QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLC--------WYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILG--KGFFAVYEAI---CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEK---PEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQL--NGTITSPGWPKEYPT-NKNCVWQVVAPAQ---YRISLQFEVFELEGNDV-CKYD-FLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQH-QECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIAS---TNSMFLRFYSDAS--VQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESD---CGYDYMEVYD-GYDSTAPRLGRYCGSG 907          

HSP 6 Score: 98.9821 bits (245), Expect = 1.149e-19
Identity = 139/635 (21.89%), Postives = 238/635 (37.48%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYG-------------------------VGS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYN--------TEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV 6424
            +C   +  S G   +P YP  YP    C W + V     I L     +  +S LC YDY+EI          L  LCG   + +     S ++++ I+FR+   +  +GF A Y   CGG  +  +S Q + SPNYP  Y  P   C W +  +    G  +   F  FE   ++ NC+ D  L + +G   + ++    C       I S  +  K+ +K  S  +I KA +                          +GS                   + CGG     +G  TSP +P     + +CV+ +       I L  E F  E       +DF++IR+G +  S L G+F          S+       +K +++V  R              +  GG   + +     Y          H N +         +  +  G ++SP +   Y    E TW +   +  +++  F  F + +   + +C   +L +YD  N  + +   FCGS   +  I +     +   S    +  GF  +++           +C   +KA  QT+ + S       NYP     +  C W I+ +    +++   +F++E   +C Y+   V
Sbjct:  286 ACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCG---DKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGG-DIKKDSGQ-IQSPNYPDDYR-PAKECIWKITVSE---GFLVGLSFQAFEIERHD-NCAYD-YLEVRDGFSEDHALIGRFCGYEKPEDIKSTSN--KLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN-DVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQ---HQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST----------ECGGRLKAEIQTKDIYSHAQFGDNNYP----VQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEV 889          

HSP 7 Score: 92.0485 bits (227), Expect = 1.425e-17
Identity = 85/298 (28.52%), Postives = 135/298 (45.30%), Query Frame = 2
Query: 2609 KGISTPEFQISA-----EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF---------------DCGGSFF-----LTNKLII----------GYPESHLNE----STYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTV--THKLVIRFVSDNSVSGEGFIMRFYT 3355
            K +  P F+++A     E ACG  +     +     S  +P+ Y  N +CV+Q  A  + +I++ F  F++  +  CK+DF++I SG S+   L  ++C   K E+IT   N     + + FKS++T +  GF  KV+ F               DC  +F        N  I+          G  +  +N     S+ +   +Y   K CTW+I       +  VF  F +E H  CAYD+LEL      K     RFCG+  +  P +  T+ + +RF SD SV  +GF  ++ T
Sbjct:  536 KCVCEPGFELTADKKQCEAACGGFITQLNGT---ITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGN----TVRLEFKSDNTVSKRGF--KVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDASVQRKGFQAKYST 823          

HSP 8 Score: 87.0409 bits (214), Expect = 6.221e-16
Identity = 67/243 (27.57%), Postives = 107/243 (44.03%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDL-DNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW      G+   +     +IE+  + C YD +      +  S  +  FCG+    +P +  TN + +RF SD S      GF A  +        CGG + A + T  +       DNN   ++N  C+W I A  G+ V++IF+   I  E       C YD++ +YDG DS  P +   CG    + + +  + + + F TD  I K GF   +T+   Q+ L
Sbjct:  722 TISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQE-CAYDHLELYDGPNGKSAILGRFCGS-KEPNPVIASTNSMFLRFYSDAS--VQRKGFQAKYSTE------CGGRLKAEIQTKDIYSHAQFGDNNYPVQSN--CEWVIVAEDGYGVELIFQTFEIEEESD-----CGYDYMEVYDGYDSTAPRLGRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTKFQDAL 947          

HSP 9 Score: 84.3445 bits (207), Expect = 3.295e-15
Identity = 71/244 (29.10%), Postives = 107/244 (43.85%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S   F +  YP  Y   +HC+++       KI ++F   D+     C +D+I+I         L  R C     E I  + +    K+ I F+S+S   G GF A      CGG         I      +    Y ++  Y   K C W+IT      +   F  F +E H NCAYDYLE + D  ++      RFCG    +   + ++KL I+FVSD S++  GF   F+
Sbjct:  286 ACGETL---QDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDS----KLWIEFRSSSNILGKGFFAVYEAI-CGGD--------IKKDSGQIQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLE-VRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFF 510          

HSP 10 Score: 79.337 bits (194), Expect = 1.273e-13
Identity = 120/596 (20.13%), Postives = 220/596 (36.91%), Query Frame = 2
Query: 9413 TPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF------------------------------------TAVPSQNHLI--KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQI----------------------SYELYTC-------------NRTEKAYSGRIVNVENFKQK-----KYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLD---SGVITSPGFGTNYYE-SGECSWNI 10945
             P +P  Y    +  W  +   G    +N  ++D+ +S   C YD++         +  +   CG+     P +   + L + F+S  S      GF A           CGG +    G    I+S +  ++  Y     C W+I    G  V + F+   I      R   C YD++ + DG      +I   CG ++ + I + SN +++ F +D +I K+GF   F                                    TA   Q        +T  +  + SP +P   P +   + +++A  +   I++  +  ++  +  C  D F+   + L  E+K+  KFC     E V  S  + V ++++     + N+ + R F++                      ++  Y C             +  E     +++N E          KY     C   +   A + R +  F  F +E+   CAYD+++   G P  +  +L + CGS  P   + +++ + + F +D S+   G+   Y      S +CGG +  +     + +   FG N Y     C W I
Sbjct:  300 APGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRL-CWYDYIEIRDGYWRKAALLGRLCGDKLP-EPIISSDSKLWIEFRS--SSNILGKGFFAVYEAI------CGGDIKKDSGQ---IQSPNYPDD--YRPAKECIWKITVSEGFLVGLSFQAFEIE-----RHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQY-RISLQFEVFELEGNDVCKYD-FLEIRSGLSSESKLHGKFCGPEKPE-VITSQGNTVRLEFK-----SDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGH-RVKLVFTDFEIEQHQECAYDHLELYDG-PNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKY------STECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVI 859          

HSP 11 Score: 75.485 bits (184), Expect = 1.922e-12
Identity = 52/230 (22.61%), Postives = 103/230 (44.78%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKISGSNSGH--LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTKRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +        ++ + F DF+I    EC +D +++    +G   +  R+C   +   +  ++N     + + F S+++    GF+AK S  +CGG      +    Y  +   ++ Y  ++       C W I       +  +F  F +E   +C YDY+E+   +D+   R  G +  SGP     +    ++IRF +D++++ +GF  ++ + K
Sbjct:  725 SPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN----SMFLRFYSDASVQRKGFQAKYST-ECGGRLKAEIQTKDIYSHAQFGDNNYPVQSN------CEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRL-GRYCGSGPPEEMYSAGDSIMIRFHTDDTINKKGFHGQYTSTK 942          

HSP 12 Score: 73.9442 bits (180), Expect = 5.082e-12
Identity = 125/552 (22.64%), Postives = 201/552 (36.41%), Query Frame = 2
Query: 6728 ILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSS--WIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDDFSY------------------------FRL----KVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC----GGEYSD------------------------------------PERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCFRIRAR---GVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNI-SLCQYNIHNYP 8071
            ILN TA+DL    +  C   +++I      K      LCG  +P   +PII++ S  WI      N   +  ++ ++ +     ++  G+ +   Y D    D    +        EC W  T   G  + + F+   I R   C   +L   DG +     IG   FCG  K   I +  N L I                 FK MD+ S                         F L    K    +CGG + +  G I SP +P  YP   +C+WQ+   +   I L F   +L+ N  C    L +     SE+ +    C     ++ T + +TVR+ FK++   +++GFK+ +F +   C    GG   D                                     E  ++S N+P        CTW I V    R+ +     +++ +Q C         G   +S +L   C S   N  I + +SM   F S A++    + +   + CG  +           I+  +I S  Q+  +NYP
Sbjct:  326 ILNFTAMDLF--KSRLCWYDYIEIRDGYWRKAALLGRLCGDKLP---EPIISSDSKLWIEFRSSSNILGKGFFAVYEAICGGDIKKDSGQIQSPNYPD----DYRPAK--------ECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIG--RFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKPEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTNSMFLRFYSDASVQRKGFQAKYSTECGGRLKAE--------IQTKDIYSHAQFGDNNYP 850          

HSP 13 Score: 67.781 bits (164), Expect = 4.673e-10
Identity = 88/398 (22.11%), Postives = 148/398 (37.19%), Query Frame = 2
Query: 4088 ITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTH-------------------------------SNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEF-TNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFE-TEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            IT  +G I S      Y     C W++ +    +I +Q + F+L    N  C Y F+ I       + L  K CG +      TS    +R+E  +D +                                 S + +   G +L      C E       E       G I S  +P+   +  +C W+     G  VKL F   E+E    C+    L  ++        + + C   +    I   +ST++ +L+F+S  D +   + FQ  Y        + E+   +    +    N YP    C W +  ++   + L    FE  EES C YDY+E++   ++   +L   CG           S  + ++I+F TD T++ +GF  +Y  T
Sbjct:  560 ITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELE--GNDVCKYDFLEIRSGLSSESKLHGKFCGPEK-PEVITSQGNTVRLEFKSDNTVSKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEA----GCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIEQHQECAYDH-LELYDGPNGKSAILGRFCGSKEPNPVI---ASTNSMFLRFYS--DASVQRKGFQAKYSTECGGRLKAEIQTKDIYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCGYDYMEVYDGYDSTAPRLGRYCGSGP---PEEMYSAGDSIMIRFHTDDTINKKGFHGQYTST 941          

HSP 14 Score: 62.003 bits (149), Expect = 2.182e-8
Identity = 56/214 (26.17%), Postives = 95/214 (44.39%), Query Frame = 2
Query: 7043 PHFIECKWHFTSPPGTRMQIDFE--ELVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK---NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCN-SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC 7654
            P +  C W  +  PG ++ ++F   +L  SR+ C   ++   DG       +G    CG      I +  + L I F+   N+    +F +   I  CGG + +  G I SPNYP +Y P   CIW+I+      + L+F   +++  +NC+   L V      ++A+I   C      DI +  + + I F ++    + GF   +F E   C
Sbjct:  308 PSYTHCIWRISVTPGEKIILNFTAMDLFKSRL-CWYDYIEIRDGYWRKAALLG--RLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVYEAI--CGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCAYDYLEVRDGFSEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDEC 516          

HSP 15 Score: 62.003 bits (149), Expect = 2.627e-8
Identity = 48/176 (27.27%), Postives = 77/176 (43.75%), Query Frame = 2
Query: 7232 TIGNVLTILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            TIG  + +   +  D +  +   K  +CG  L    G  ++P YPL YP  + CIW+IS      I L F   DL ++  C    + +      + A++   C     + I +  S + I F++++    KGF   Y   + +CGG+      ++ S NYP        C WKI V
Sbjct:  263 TIGQRIRL---SQGDIAQAKKLYKCPACGETLQDSGGNFSAPGYPLGYPSYTHCIWRISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY---EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV 432          

HSP 16 Score: 59.3066 bits (142), Expect = 1.484e-7
Identity = 44/174 (25.29%), Postives = 79/174 (45.40%), Query Frame = 2
Query: 10583 ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG---NQAL--KYCGY 11089
            I+  P  +    F   +L +S  C YDYI+   G    +  +L ++CG  +P   +++ S++ + F +  +I   G+   Y         CGG+I  DSG I SP +  +Y  + EC W I +     +   F   ++  + +         D+++V  G   + AL  ++CGY
Sbjct:  317 ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGY-WRKAALLGRLCGDKLPEPIISSDSKLWIEFRSSSNILGKGFFAVY------EAICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITVSEGFLVGLSFQAFEIERHDNCA------YDYLEVRDGFSEDHALIGRFCGY 477          

HSP 17 Score: 57.7658 bits (138), Expect = 4.335e-7
Identity = 69/330 (20.91%), Postives = 122/330 (36.97%), Query Frame = 2
Query: 10127 KTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNN 11005
            +T+ +      +P YP   P     +   I+    + I +    + +  S  C  D   I+D   +    + + C     E + ISS  K+ I+++     + ++   + F   YE   C    K  SG+I +       + +   I  +T+   +        F+ F +ER   CAYDY++   G   E   ++ + CG   P    + S+++ + FV+D SIN  G+   +    D   +                                     CGG I   +G ITSPG+   Y  +  C W +   +   I  +F   +L  N
Sbjct:  289 ETLQDSGGNFSAPGYPLGYPSYTHCIWR-ISVTPGEKIILNFTAMDLFKSRLCWYDYIEIRDGYWRKAALLGRLCGDKLPEPI-ISSDSKLWIEFR-----SSSNILGKGFFAVYEA-ICGGDIKKDSGQIQSPNYPDDYRPAKECIWKITV---SEGFLVGLSFQAFEIERHDNCAYDYLEVRDGF-SEDHALIGRFCGYEKPEDIKSTSNKLWIKFVSDGSINKAGFSANFFKEMDECSRPDNGGCSQRCVNTLGSYKCVCEPGFELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGN 606          

HSP 18 Score: 54.299 bits (129), Expect = 5.596e-6
Identity = 79/360 (21.94%), Postives = 140/360 (38.89%), Query Frame = 2
Query: 3698 FNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPVLKFVTAK--------KEINIVCSEQITKMHVFEEQS-------------VHVIFQNLASTKYRFRLY------YTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP--NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCS 4606
            F  T +    +  CG       G I SP +P   P N  C W++ +    RI ++                  IRSG   E+KL    C  + P  + +T++        K  N V S++  K++ F ++              V+     +   K  F L+          CE  + ++ G I S N   +Y     C+W ++   G ++ +    F++   Q+ +C Y  + + D  N    +L + CG++  N    S+N  + +  Y+D S         +G   +Y T+ C         +++  TK+ +   AQF   N     +C+W      G+ V+L F   E+E   +C 
Sbjct:  543 FELTADKKQCEAACGGFITQLNGTITSPGWPKEYPTNKNCVWQVVAPAQYRISLQFEVFELEGNDVCKYDFLEIRSGLSSESKLHGKFCGPEKP--EVITSQGNTVRLEFKSDNTV-SKRGFKVNFFSDKDECSKDNGGCQHDCVNTFGSYICQCKNGFILHENGHDCKEAGCEQKLINAEGTISSPNWPDKYPSRKECTWDIAVTAGHRVKLVFTDFEIE--QHQECAYDHLELYDGPNGKSAILGRFCGSKEPNPVIASTN-SMFLRFYSDASVQ------RKGFQAKYSTE-CGGRL-----KAEIQTKD-IYSHAQFGDNNYPVQSNCEWVIVAEDGYGVELIFQTFEIEEESDCG 883          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Mouse
Match: Cubn (cubilin (intrinsic factor-cobalamin receptor) [Source:MGI Symbol;Acc:MGI:1931256])

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 972/3817 (25.47%), Postives = 1622/3817 (42.49%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPK-PFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA-NAYTC--GPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR-ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQI--IPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI-PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHL---------KVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIA-ISFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSV--FDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL---IHDNQTKRFCGNH-AKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIK-----INHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--FPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES---LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTS--GNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAK-----VFCGSGVIDSAIFTPPVTLILSAEGYRYP-GFLIRWNPPVDENFK----KIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHF-------IECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT---NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLN-YPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN--QGC---FRIRARGVGYRSVLLYIICAS-NLENFEIDTKSSMIEVFGSGATISF-----SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYN-IHNYPED---EGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLG--KVVNFIFQPGREVN-MSNYRVE-----IGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLN---PISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT---LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFF---------GCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIE-RSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT--NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPN-NSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCES-LSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPT---CYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            PR+ ++ GN++F T+S+++I F T + G+I+LND DL     +I++ +++I    DLK+    L  + L     ++  L       N K+  LE +   +++ +    C++NPCHNG  C++ ++SF CICP  +KG  C+EDVNEC+  +GT  GCQ+G+ C NT+GSFRC C+    G  C    N C   S   +C HG C       + +  F C+CD+GW+  P   +C  D DEC +   PCS H    C NT G   C  CP G++GNG+ C DINEC  N   C   P   C+N  G++ C  C  G       +C   ++C  +NGGC  +A CS+++       +CTC PGY+G+G G NGCV +S   +         R  C N G C ++++ + C+C  G+ G  C   I N+C+SNPCLNGG C     N + C C   ++G  C+     CGG  + +        F    P+ +   +  C W + +  ++ L I     +L+   +C  EY+Q+H+      A   +G+YC    STP +   + +  +        I++  GF  +        +  +C     G+        G   SP +P  Y    +C        G+   +     TL L +  ++CS  DYL+I    F    I    C        +       +HFHSD  S+ +   F   +    S   CG   T     ++  P   P      C + I Q    +++               +  +  E+ +     + FI     E L               + N  +I  +    +    F+   + ACG  +  + +     +S  YP  Y+G   C +      R++  ++F DF I   S C  D+I+I  S+      ++++C  N    IT   N     + +TF  +S+    GF A  S    +CG    LT    I     H N         Y     CTW I       I  VF  F+LE H NCA DYLE+   I      R+CG     S  + +H + + FVSD++++ EGF + +  +     C   +  + G +++P       +++ C Y I V   ++I ++ T    +   F   C+    ++                  P R  I + SN   + +       A  F+   + SS    CG    +  G + SPNYP+    ++ C W + ++ G   L++     + H  + S+D   + +  +      T  + IN +C +         +  V +  +  A  + R F + Y Q C+    +  +SG +ES N     +  + C+W + +  G+ +     +FD+    N     ++ + D     + + CG  +     T+ +  I + H TD      V    +G  + +   GC           + S   G   S  +PNS   N +C WN +  PG S++L     ++E   +C     L  +         + Q C+R      + I S+ +   ++F + +  NG  R F  ++      C      S G I SPNYPN Y  N  CSW ++V++   + L I DF+ E +   L  YD     +       ++  +CG+         +S  N + ++F++  +  SRGF+A++ + CG   +  +S+  + SP YP  Y  P+   C W + A      + + F     +  +   +C+ D  + I++G  +++ V+   C  S  HPIIS G+ L V   S S  G   F A Y   +S CGG FY  DG+F SP YP   + + +CV+ I +SPG+ + LS   F  EN+++    DF++IR G N T  L+GR+   S   NY+     N  +W+R  S G      + F A++ +I  N      +G +A+P +   Y  ++   WTV  +SS  +     +  +    +   C   +L IYD  +D        +CG+     +     +T   S++  +   GFL+ W      N        G C   +   +      SP +P        C W I    +  +++ +LS D+E+   C Y+   ++   S+      +     V CG            Y++    I + +D      GF  S++K+C   + +   G + + +YP+    N NC++ +L    L   ++          +  C  G   +L                N   CG   P  L    T+ + + +    + S+  +  GF+I Y  K   CGG    T Y    I D NS+    +P++        EC W   +P G  +Q+ FE+   +     C+ S+L   DG+ +    +     CG T   N + + G ++ + F       Y  F+ K  I SCGG +    G I S  YP   Y     C W I G     + + F D +L  +  C+K +   I    +   ++   C NS    + T  +   I F T+   T  GF+L++     +CGG+   P     S NYP        C W INV   ++II+    L+++  Q C     I   G+   S  L  +C+  N+ N    + ++M  +F +  +  +     SY S + ++CG  +          ++   N S   YN I +Y  +   E TLS    +N+ I    +    +        V +F  G  +   +  F +L   +V   I  P   ++ +SN RVE     + Y F+ CGG+ T   G I SP YP  Y   T C WL+ APE   I LT     +E+H  C  D + +R  +   SP   + CG +   PI + +     N++ ++F+++      GF   +N       C G + +  G+IKSP++P+ +P N RC+WT    E     ++F   F +  +S   C    +++ +    T   LL+  CGN+ PS PI +  N  + VF ++     +GF A + S CG  ++   G+IVS N       ++ C Y I      L V+  + +F           C Y    I   ++  N +  P   ICG    +   +    +   Y+  + ++ ++ F+  Y       ++S      VL +P+F    + N N+  +++  V     I LR  D E    + C++D++      S  + +I  FCG+     P +I +  N L + F++D S  +   G+      T GP  GCGGY+     ++    S D D++GLY+  L C W I AP    VK+ F  N+ +LE  S  G C +D++ I DG      +    CG  +     +  N + + F +D +IQ  GF  T+T V          T+  Q   SP+  N   P+       +I A     + ITV  L++ S  +CS     +QD+   + N++ +FC +  +T  VF SS    ++ ++   + N NS    R   +YE+  CNR      G + +      + Y++NL C++ L  P  N R   +F +F LE S  C  D+++   G       +L K C + +P    + S+ + + F +D S  + GY+I +  +      CGG +  + G++ +PGF  +Y  +  C W I   S   +   F  + + +    +      ++  D     +G     +CG   +   F   S+   + + +    V +GF I WS
Sbjct:   39 PRMTTEEGNLVFLTSSAQNIEFRTGSLGKIKLNDDDLGECLHQIQRNKDDII---DLKRNTTGLPQNILS----QVHQL-------NSKLVDLERDFQSLQQNVERKVCSSNPCHNGGTCVNLHDSFICICPSQWKGLFCSEDVNECVLYAGTPFGCQSGSTCVNTMGSFRCDCTPDTYGPQCASKYNDCEQGSQ-QLCKHGICEDLQRVYHGQLRFNCICDAGWTTLPNGISCTEDKDECSLQPSPCSEH--AQCFNTQGSFYCGACPKGWQGNGYQCQDINECEINNGGCSQAPLVPCLNTPGSFTCGNCPAGFSGDG-RVCTPLDICSIHNGGCHPDATCSSSSVLGSLLPVCTCPPGYTGNGYGSNGCVRLSNMCS---------RHPCVN-GQCIETVSSYFCKCDSGWFGQNCTENI-NECVSNPCLNGGTC-IDGVNGFTCDCTSSWTGYYCQTPQAACGGILSGTQ-----GTFAYQSPNDTYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGD--SSADFPLGRYC---GSTPPQGVHSSANSLYFHLYSEYIKRGRGFTAR-----WEAKLPECGGILTGNY-------GSITSPGYPGNYPPGRDCVWNLLVSPGS--LITFTFGTLSL-ESHNDCS-KDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSD--SETSDKGFHITYLTTPSDLYCGGNYTDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIV---------------INFTHVELESQRGCSHTFIEVGDHESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRADYQVACGGELRGEGV----IRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYN----VLYVTFVKSSSMENRGFMAMFSSEKLECGK--VLTESTGIIESPGHPN--------VYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYDTIAQTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALE-DYFGPKCVDFVEIRDGGFETSPLIGIYCGSVFPPR--IISHSNKLWLRFKSDTALTARGFSAYWDASSTG--CGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPS------TNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVENYVNCST-DYLELYDGPQR-IGRYCGENIPPPGATTGSKLIVVFH-TD-----GVDSGEKGFKMHWFIHGC---------GGEMSGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVEYHASCKYD-TLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNG--RGFNASWRAVPGGCGGIFQVSRGEIHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDLEATDSCLMTYDGSSSAN------TRVATVCGRQQP--PNSITSSGNSLFVRFQSGSSSQSRGFRAQFRQECGA-HIITDSSDSISSPLYPANY--PNNQNCTWIIEAQPPFNHIALSFTHFHLQSST---DCTRD-FVEILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSASTSACGGTFYTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLENSLN-CNKDFVEIREG-NATGHLMGRYCGNSLPGNYSSIEGHN--LWVRFVSDGSG--TGMGFQARFKNIFGNDNIVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTN---CFYDSLKIYDG-FDIHSRLIGTYCGTQRESFSSSRNSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAPDS-TVELNILSMDIEAQLSCSYDKLIIKDGDSR------LSQQLAVLCGRSVPGPIRSTGEYMY----IRFTSDGSVTGAGFNASFQKSC-GGYLHADRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTL---FTSDNEMFIQFISDNSNGGQ--GFKIRYEAKSLACGG----TIY----IHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVL--SKLCGHTLPRNWVSSRG-LMYLKFHTEGGSGYMGFKAKYSIVSCGGTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQSSPGCAK-DFVEIWENHTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVCGGDLHGPTGTFTSPNYPNPNPHPRICEWTINVHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGTL---------PSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLESHQDCTFDVLEFRVGNADGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYVEYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPTCTSDSVTVRNGDSPGSPIIGRYCGQSVPGPIQSGS-----NQLVVTFNTNNQGQSRGFYATWN--TNTLGCGGTLHSDNGTIKSPHWPQTFPENSRCSWTAVTHESKHWEISFDSNFRIP-SSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPS-PIVTLGNIFTAVFQSE-EMPAQGFSASFISRCGRTFNSSTGDIVSPNFPKHYDNNMNCNYYIDVAPQSL-VILTFVSFHLEDRSAVSGTCDYDGLHI---IKGHNLSSTPLVTICGSETLRPLTIDGPVMLNFYS--DAYITDFGFKISYRVANCGGIYSGTYG--VLNSPSFSYTNYPN-NVYCVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTL---PQVIKSTNNSLTLLFKTDSS--QTARGWKVSFRETIGPQQGCGGYLTEDSKSF---VSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTF--NAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPCGGTYNATSMPQNTSSPQLSNIRRPFST--CTWVIEAPPHQQVQITVWKLQLPSQ-DCSRSSLELQDSEQTNGNQVTQFCGANYTTLPVFYSSGSTAVVVFKSDFL-NRNS----RVHFTYEIADCNREYNQAFGNLKSPG--WPQGYANNLDCSIILRAPQ-NHRISLFFYWFQLEDSRQCMNDFLEVRNGSSSSSP-LLGKYCSNLLPNPIFSQSNELYLHFHSDDSDTHHGYEIIWASS---PTGCGGTLLGNEGILANPGFPDSYPNNTHCEWTIVAPSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFG----PFCGIDTVVAPFHASSNRVFIRFHAEYATVSSGFEIMWS 3622          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 147.902 bits (372), Expect = 1.946e-34
Identity = 126/392 (32.14%), Postives = 179/392 (45.66%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNP-KPFKCLCDSGW----------------------SLDPVT-------------KTCIADIDECRV---GKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            ++  DDC  + C NGA C+DG +++ C+CP+ +KG  C+ED++EC +  G    C+NG  C+NT GSF CVC   W G  C           N D C   TC P  +  +    F CLC  G                       S +P+T              TC  D+DEC++   G  PC      +C+NTPG   C  C  G+ G+     D NEC +   C P   C++   T+ C C  G++ R   +C++E N C +N   C   AAC   +  + G  C C PG++G    ++     ST               C NGG C+     F C+CLPGF G  C   + ++CLS+PC  G +C    P  + C C+P F+G  CE
Sbjct:  271 EMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDEC-EARGPPR-CRNGGTCQNTAGSFHCVCVSGWGGAGCE---------ENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHG--GSCINTPGSFNCL-CLPGYTGSRCE-ADHNECLS-QPCHPGSTCLDLLATFHCLCPPGLEGR---LCEVEVNECTSNP--CLNQAAC---HDLLNGFQCLCLPGFTGARCEKDMDECSSTP--------------CANGGRCRDQPGAFYCECLPGFEGPHCEKEV-DECLSDPCPVGASC-LDLPGAFFCLCRPGFTGQLCE 622          

HSP 2 Score: 133.65 bits (335), Expect = 3.959e-30
Identity = 121/386 (31.35%), Postives = 161/386 (41.71%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNI-----PINSCSNASNTDIC--GHGT-----CYPDHS----PTNP------------------KPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGE--NGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            D C+ NPC NG  C+  Y   +C CP  F+G  C  D+NEC    G    C  G  C NT+GS++C+C     G  C +     P  SC N     +   GH T     C P  +      NP                    + CLC   W        C  DIDEC   + P        C NT G   C  C  G+ G G    ++++CA A TC P   C++  G++ C C  G   R   +C LE++C +    C  NA CS N       +C C PGYSG    +  + C +     +            C +GG+C  +   F C CLPG+ G+RC    +N+CLS PC  G  C  L    + C C P   G  CE E
Sbjct:  155 DFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGP---CPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWK----GWDCSEDIDECEA-RGPPRCRNGGTCQNTAGSFHCV-CVSGWGGAGCE-ENLDDCA-AATCAPGSTCIDRVGSFSCLCPPG---RTGLLCHLEDMCLSQP--CHVNAQCSTNPL-TGSTLCICQPGYSGSTCHQDLDECQMAQQGPSP-----------CEHGGSCINTPGSFNCLCLPGYTGSRCE-ADHNECLSQPCHPGSTCLDLLAT-FHCLCPPGLEGRLCEVE 510          

HSP 3 Score: 98.2117 bits (243), Expect = 2.176e-19
Identity = 109/374 (29.14%), Postives = 156/374 (41.71%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLD----PVT--KTCIADIDE----CRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLD-INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGT--CQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLF--PNHYRCHCQPLFSGVNCENEHIVCG 1546
            +   D C +  C NG  C++   +F C+C   F+G HC E  N     S     C+N A C++T    RC+CS  ++G  C   I+ C+       C H        P+    F+CLC  GW+      P++  K  ++   E    C+ G           C++T     C  CP GF+G    C D +N C     C     CV     Y C+C  G +    N  ++ + C++    C  +  C++   R  G  C C PG+ G        +    +V       C+ R  C   GT  C      F CQCLPG  G RC  V  + C S PC NGG+CE     P  + CHC   F G  C ++ + CG
Sbjct:  762 QTAVDHCVSASCLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNP----SCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLIDLCARKP----CPHTARCLQSGPS----FQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGL---------CIDTGSSYFCR-CPPGFQGK--LCQDNVNPC-EPNPCHHGSTCVPQPSGYVCQCAPGYE--GQNCSKVLDACQSQP--CHNHGTCTS---RPGGFHCACPPGFVG--------LRCEGDVDE-----CLDRP-CHPSGTAACHSLANAFYCQCLPGHTGQRCE-VEMDLCQSQPCSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHKALSCG 1088          

HSP 4 Score: 97.8265 bits (242), Expect = 3.070e-19
Identity = 105/377 (27.85%), Postives = 154/377 (40.85%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEE----------------CVNGF-----GTYQCKCVQGMKRRANNMCQ---LENVCETNNGGCSTNAACSAN--NFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            +++C + PCH G+ C+D   +F C+CP   +G+ C  +VNEC     T + C N A C + +  F+C+C   ++G  C   ++ C   S+T     G C        P  F C C  G+        C  ++DEC     PC +    +C++ PG   C  C  GF G         +      C PN                  C +G          C C  G  +R+  +C        CET  GGC +         + +  G  CTC  GY G        +  S  VT            C NGG+C     G++C CLP   G  C+T +++ C+S  CLNGG C    P  + C C   F G++CE +
Sbjct:  473 HNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNEC-----TSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDEC---SSTPCANGGRCR-----DQPGAFYCECLPGFE----GPHCEKEVDECL--SDPCPVG--ASCLDLPGAFFCL-CRPGFTG---------QLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG--------LTCSEEVTA------CHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDH-CVSASCLNGGTC-VNKPGTFFCLCATGFQGLHCEEK 802          

HSP 5 Score: 95.9005 bits (237), Expect = 1.047e-18
Identity = 105/384 (27.34%), Postives = 153/384 (39.84%), Query Frame = 2
Query:  455 HQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGN----------------GFTCLDINECANAYTCGPNEECVNGFGTYQCK---CVQGMKRRANNMCQLEN----VCETNNGGC-STNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCEN 1528
            HQ  ++        +PC +G  CI+   SF C+C   + G  C  D NECL        C  G+ C + + +F C+C     G LC + +N C++    N   C        H   N   F+CLC  G++       C  D+DEC     PC+      C + PG   CE C  GFEG                 G +CLD+     A+ C     C  GF    C+   C   M +        E+    +C   + GC      C  ++   +  +C C+ G++G          +ST               C +GGTC    +G+ C C  G+ G  C   +   C S PCLNGG+C  + P  Y C C P  +G +C+ 
Sbjct:  427 HQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLS-----QPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAAC--------HDLLN--GFQCLCLPGFT----GARCEKDMDECS--STPCANG--GRCRDQPGAFYCE-CLPGFEGPHCEKEVDECLSDPCPVGASCLDL---PGAFFC----LCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTP--------------CAHGGTCHPQPSGYNCTCPAGYMGLTCSEEV-TACHSGPCLNGGSCS-IRPEGYSCTCLPSHTGRHCQT 763          

HSP 6 Score: 93.5893 bits (231), Expect = 5.476e-18
Identity = 99/377 (26.26%), Postives = 136/377 (36.07%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPI---------------------------NSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCEN 1528
             D+C++ PC NG +C D   +F C C   F+G HC ++V+ECL        C  GA C +  G+F C+C   ++G LC +P+                             C  A +   C HG C         +   C+CD GW+  P  +T +                    C++TP                        CA+  TC P          Y C C  G       +   E V   ++G C    +CS    R EG  CTC P ++G                  A   CV    C NGGTC      F C C  GF G  C    N  C  +PC N   C+   P   RC C P ++G +C+ 
Sbjct:  549 MDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDP-----CPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHC---------QRSLCVCDEGWT-GPECETELG------------------GCISTP------------------------CAHGGTCHPQPS------GYNCTCPAGYM----GLTCSEEVTACHSGPCLNGGSCS---IRPEGYSCTCLPSHTG-------------RHCQTAVDHCVSAS-CLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDT-PRGARCLCSPGYTGSSCQT 840          

HSP 7 Score: 63.5438 bits (153), Expect = 6.764e-9
Identity = 101/382 (26.44%), Postives = 131/382 (34.29%), Query Frame = 2
Query:  542 FKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCE-NTIGSFRCVCSGKWSGVLCNI----PINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----------------NGFTCLDINE---------CANAYT---------------CGPNEECVNGFGTYQCKCVQGMK----RRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGEN--GCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEF-LFPNHYRCHCQPLFSGVNCENE 1531
            F C CP  F G  C   + E    S     C NG  C     G  +C C   W+G  C +      N C+N         G C      T P+  +C C  G+       TC  DI+EC +   PC      +C NT G  +C  CP+G EG                NG TC  + E         C   +T               C     C++G  TY C C +  K        + C+        NGG   N   +A +F      C C  G+ G G  EN   C   +                C  G TC   +  F+C C PG  G  C   + + CLS PC     C          C CQP +SG  C  +
Sbjct:   98 FSCTCPSGFTGDRCQTHLEELCPPS----FCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANG--------GVCL----ATYPQ-IQCRCPPGFE----GHTCERDINECFLEPGPCPQG--TSCHNTLGSYQCL-CPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQN---TAGSFH-----CVCVSGWGGAGCEENLDDCAAAT----------------CAPGSTCIDRVGSFSCLCPPGRTGLLCH--LEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQD 429          

HSP 8 Score: 60.077 bits (144), Expect = 7.916e-8
Identity = 77/305 (25.25%), Postives = 112/305 (36.72%), Query Frame = 2
Query:  503 CHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTC---QKSLTGFTCQCLPGFGGARCRT 1408
            C NG  CID  +S+ C CP  F+GK C ++VN C       + C +G+ C      + C C+  + G  C+  +++C +    +   HGTC      + P  F C C  G+    V   C  D+DEC     PC      AC                          +  ANA+ C    +C+ G    +C+          ++CQ +         CS   +C        G  C C  G+ G          +S  + +           C NGG C    K  +   C CL GFGG  C T
Sbjct:  897 CQNGGLCIDTGSSYFCRCPPGFQGKLCQDNVNPC-----EPNPCHHGSTCVPQPSGYVCQCAPGYEGQNCSKVLDACQSQPCHN---HGTCT-----SRPGGFHCACPPGF----VGLRCEGDVDECL--DRPCHPSGTAAC--------------------------HSLANAFYC----QCLPGHTGQRCEVEM-------DLCQSQP--------CSNGGSCEITTGPPPGFTCHCPKGFEGPTCSHK---ALSCGIHH-----------CHNGGLCLPSPKPGSPPLCACLSGFGGPDCLT 1123          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Mouse
Match: Bmp1 (bone morphogenetic protein 1 [Source:MGI Symbol;Acc:MGI:88176])

HSP 1 Score: 143.665 bits (361), Expect = 2.065e-33
Identity = 147/601 (24.46%), Postives = 235/601 (39.10%), Query Frame = 2
Query: 7649 MCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNI-----------YPNNNESGVITIENVNIS-------------------------------------LCQYNIHNYPEDEGTLS-----MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFN-----------------TEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSN--AVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLIPGWENH 9136
             CG    D     +S  YP   S  + C W+I+V   ++II+    + + +   C+   +  R G   ++ L    C   L    + T S + +E   S   +   + +   ++CG ++           YP++     + I  + +S                                     + +Y  +  P+D  + S      F+SD +    +   F       + E       GC +R      +TLG        PG E+     R E     + CGG LT+  G I SPG+P++YP N +C W ++AP    I L       E +  C YD + +R     DS    K CG      E ++   N MR+ F SD +VSK GF  + +F +  D C                       +G + +                 T G+I SPN+P  YPS   C W I    G++V LTF +  D+E  S   C YD L + D       +L   CG+  P  P+ ++ N+M L F +D +   +GF A + + CGG    D++  ++ S A     NY G + CE++I   E +
Sbjct:  326 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGS---INKAGFAVNFFKEVDECSRPNRGGCEQR----CLNTLGSY-KCSCDPGYELAPDKRRCE-----AACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSE--KPEVITSQYNNMRVEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTF-VEMDIE--SQPECAYDHLEVFDGRDAKAPVLGRFCGSKKP-EPVLATGNRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGY 905          

HSP 2 Score: 127.487 bits (319), Expect = 1.581e-28
Identity = 154/663 (23.23%), Postives = 255/663 (38.46%), Query Frame = 2
Query: 8678 TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWEN-HLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQ---RICG----------KSREKITIMHSKSIKIVYTARNFHLK--------NYNFRARYLH---------DENVKVFSDFKRPYV------------LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDT--NVLIVRFQSD--------ISHY---------------------------ENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQ 10414
             C   + ++ G+  SP YP  Y +++ C W I V  G K+ L F    DL R+ L  C YD + + D       L    CG   P  PI S+ +++ + F +  N   +GF A Y++ICGG      G I S N       S  C + I   E  H+ + +     F    HD+     LE ++G+        R CG           SR  +  +   SI     A NF  +              R L+         D   ++  D +R               + +P +P  Y  N N  W   AP  Y  S+     + E + D C YDFV   +  +  S     FCG+     P +I +  N + V F+SD         +H+                           +  +GFV   N       GC   + +T GT   I S +  +   Y +   C W I++  GH VK+ F    I  +       C YDH+ ++DG D+  PV+   CG  + + +    N M+L F +D ++Q+ GF+ + +        ++       L    ++ +N+         +I A E   + +  +  ++    +C  D   + D       ++ ++C S   E V+ S+ D V++++ 
Sbjct:  326 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNF-TSMDLYRSRL--CWYDYVEVRDGFWRKAPLRGRFCGGKLP-EPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTF---QSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTADSKLHGKFCGSE---KPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGT---ITSPNWPDK--YPSKKECTWAISSTPGHRVKLTFVEMDIESQPE-----CAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHST--ECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVY-SAGDSVLVKFH 964          

HSP 3 Score: 109.383 bits (272), Expect = 7.049e-23
Identity = 144/674 (21.36%), Postives = 254/674 (37.69%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLC-NDKNPVLKFVTAKKEI-NIVCSEQITKMHVFEEQSVHVIFQNLAS-TKYRFRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQ----------------LLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIV--LEYQTQGCMETFYYDPHE-------SDYSTK-NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCS----------------EGPILRAWENEIVDENY-----VFQACNRIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK----FQGTYEFTNYS---------------CEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCG--KMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAY 5500
            CG     + G+ +SP YP    A+ +C W I  TPG++I++    +    +  ++LC  D   V      K  +    C  ++ +  V  +  + V F++ ++     F   Y   C   +   +G I+S N        + C W++    G  + +    F++    +   Y ++ + D    S+ L+ + CG +                + + +   + + +      D  +  N     +  +  L      C   +   P +         + TK NG I S  +P     N +C W       + + L+FD  E E +  C                  G    + + E++   Y      F++ N +          S   F   FFS  D     NGG ++      G+YE    S               CEH+++ + G I SPN+P+ YP    C+W +       + L  ++ + E +  C YD++E+F   +     L   CG  K    + TG     N M ++F +D++V  +GF+A +   CGG   A    + L S         P G+ CEW +VA   E G  +   F  FE      +C  D  + + +G  + +      C   P   + S G    V++K  S + I K  +
Sbjct:  327 CGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSM---DLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIE-RHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTV----------SKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATG-----NRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVA---EEGYGVELVFQTFE-VEEETDCGYD-YIELFDGYDSTAPRLGRYCGSGPPEEVYSAGD--SVLVKFHSDDTISKKGF 974          

HSP 4 Score: 103.605 bits (257), Expect = 3.250e-21
Identity = 70/247 (28.34%), Postives = 113/247 (45.75%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNY-------PKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS--NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            K + C   +T + G I SP +P+KYP   +C W I +     ++LT   + +E   +C YDHL +    +  +P   + CG      E +    NRM L F+SD SV + GF   +     +  C G +      +K+ +           YP  + C W I   EGY V L F+  F++E  +   C YD + + D   +    L   CG+ PP   + S+ + + + F +D   + +GFH +Y S
Sbjct:  748 KEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSK--KPEPVLATGNRMFLRFYSDNSVQRKGFQASH-----STECGGQV---RADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQT-FEVEEET--DCGYDYIELFDGYDSTAPRLGRYCGSGPPEE-VYSAGDSVLVKFHSDDTISKKGFHLRYTS 980          

HSP 5 Score: 98.9821 bits (245), Expect = 1.083e-19
Identity = 74/239 (30.96%), Postives = 107/239 (44.77%), Query Frame = 2
Query: 8306 YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY 9016
            YK   CG  L +S G   SP YP  Y  +  C W I       I L   ++ L     C YD++ +R      +P   + CG      E +    +R+ + F S  +    GF   Y  I     C G +    G I+SPNYP  Y  +  C W I V EG+ V LTF+  F++ER    +C YD L + D  S +  L+   CG   P + I S+ +++ L F +D + N  GF   +
Sbjct:  322 YKCPACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGK--LPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAI-----CGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQ-SFEIERHD--SCAYDYLEVRDGHSESSNLIGRYCGYEKPDD-IKSTSSRLWLKFVSDGSINKAGFAVNF 549          

HSP 6 Score: 98.2117 bits (243), Expect = 1.627e-19
Identity = 150/672 (22.32%), Postives = 244/672 (36.31%), Query Frame = 2
Query: 4403 YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEI-VDENYVFQAC--NRIDDGK-SIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQT-GFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKA----------------------AYGVGSSTCGGDFYLDD------------------GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF--YTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSG 6109
            Y+   C ET              G   S ++PN   A++ C W     PG  + L F  +++  S  C        W + + V + +  +A    R   GK    I S+    +++F S+++  G  + F   YE     C  ++    G IQSPNYP+ Y  +  C W ++V E   + L    FE E    C YDY+E    + +   +  +L G+   + +     S ++ + +KF +D +++  GF   +F+                                            CGG    +  N  + SP +P  Y  P+  C W LVA T     RI   F  FE   N+  C  D  + +  G+  +S +    C       I S  + ++V  KS  T     FKA                       +G     C   F L D                  G  TSP +P+      +C + I ++PG  + L+  E   E+      +D +++ +G +  + +LGRF      E    T N  F       LR    +      F A +      + R+D     + +  QFG + Y    +  W + AE    ++  F  F V    D   C    + ++D  YD+       +CGSG
Sbjct:  322 YKCPACGETL---------QDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLC--------WYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVG--KGFFAVYEAI---CGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLE----VRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKL--NGSITSPGWPKEYP-PNKNCIWQLVAPTQ---YRISLQFDFFETEGNDV-CKYD-FVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPE-CAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMF-------LRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETD---CGYDYIELFD-GYDSTAPRLGRYCGSG 947          

HSP 7 Score: 97.4413 bits (241), Expect = 3.044e-19
Identity = 69/244 (28.28%), Postives = 111/244 (45.49%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSG-PTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + ST  F S  YP  YS + HCV++       KI ++F   D+     C +D++++         L  R+C G   E I    +    ++ + F+S+S + G GF A      CGG     N         H+    Y ++  Y  +KVC W I       +   F  F +E H +CAYDYLE + D  ++      R+CG        + + +L ++FVSD S++  GF + F+
Sbjct:  326 ACGETL---QDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDS----RLWVEFRSSSNWVGKGFFAVYEAI-CGGDVKKDN--------GHIQSPNYPDD--YRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLE-VRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFF 550          

HSP 8 Score: 96.6709 bits (239), Expect = 4.727e-19
Identity = 149/703 (21.19%), Postives = 253/703 (35.99%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGV-------------------------GS-------------------STCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKYHINYNTEF------------------RSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV-----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYP-NFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKD 6622
            +C   +  S G   SP YPN Y  ++ C W + V     I L     +   S LC YDYVE+              CG     +     S ++ + ++FR+      +GF A Y   CGG     + N  + SPNYP  Y  P  +C W +  +    G  +   F  FE   ++ +C+ D  L + +G   +S++    C       I S     ++ LK  S  +I KA + V                         GS                   + CGG     +G  TSP +P     + +C++ +       I L  + F  E       +DF+++R+G    S L G+F          S+  N    +K +++V  +              +  GG   + +     Y     + F                   S  G + SP +   Y    E TW + +    +++ TF +  +  +    +C   +L ++D   DAK      FCGS   +  + T     +   S    +  GF    +           +C   ++A  +T+ L S       NYP   D     C W I+ +    +++   +F++E   +C Y+   + F G  +       Y     CGS    E  V+     +S+ + + +D+     GF L Y    ++D
Sbjct:  326 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRFCGGK---LPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGG--DVKKDNGHIQSPNYPDDYR-PSKVCIWRIQVSE---GFHVGLTFQSFEIERHD-SCAYD-YLEVRDGHSESSNLIGRYCGYEKPDDIKSTSS--RLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGN-DVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQP---ECAYDHLEVFDGR-DAKAPVLGRFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHST----------ECGGQVRADVKTKDLYSHAQFGDNNYPGGVD-----CEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIEL-FDGYDSTAPRLGRY-----CGSGPPEE--VYSA--GDSVLVKFHSDDTISKKGFHLRYTSTKFQD 985          

HSP 9 Score: 90.5077 bits (223), Expect = 3.919e-17
Identity = 121/564 (21.45%), Postives = 204/564 (36.17%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPT---------------------------PGPMLG---------CGGYM---NATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIF-----ENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKL----------------------TFTAVPSQ----------NHLIK------TVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKA--YSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNR 10837
            +++PN+P  Y  +    W      G+   +  +S +IER +D C YD++      S SS+ I  +CG           ++ L ++F SD S   N  GF V F                               PG  L          CGG++   N ++ + G  K         Y  N  C WQ+ AP  + + + F     E N +          C+YD + +  G  +   +    CG ++ + IT+Q N M + F +D  + K GFK                       TF +   Q           H  K       VT+ S  + SP +P+  P   +     I++     + +T  ++ I S   C+ D   + D        + +FC S   E V  + +   +  Y      + NS   + FQ S+    C    +A   +  + +   F    Y   + C   ++        +  F+ F +E  + C YDYI+   G        L + CGS  P    +    V + F +D +I+  G+ + Y   +
Sbjct:  451 IQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIER-HDSCAYDYLEVRDGHSESSNLIGRYCG-YEKPDDIKSTSSRLWLKFVSDGSI--NKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKE--------YPPNKNCIWQLVAPTQYRISLQFDFFETEGNDV----------CKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYP-SKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMFLRFY------SDNSVQRKGFQASHST-ECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEE-GYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPR-LGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTK 982          

HSP 10 Score: 88.9669 bits (219), Expect = 1.063e-16
Identity = 64/242 (26.45%), Postives = 105/242 (43.39%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHL 10123
             + +PN+P  Y      TW  ++  G+   +    +DIE S   C YD +         +  +  FCG+     P +   N + +RF SD S      GF A  +        CGG + A V T  +       +N  Y   + C+W I A  G+ V+++F+   +  E       C YD+I ++DG DS  P +   CG    + + +  + + + F +D  I K GF L +T+   Q+ L
Sbjct:  762 TITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIE-SQPECAYDHLEVFDGRDAKAPVLGRFCGS-KKPEPVLATGNRMFLRFYSDNS--VQRKGFQASHSTE------CGGQVRADVKTKDLYSHAQFGDNN-YPGGVDCEWVIVAEEGYGVELVFQTFEVEEET-----DCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTKFQDTL 987          

HSP 11 Score: 88.1965 bits (217), Expect = 1.874e-16
Identity = 144/691 (20.84%), Postives = 252/691 (36.47%), Query Frame = 2
Query: 5516 TCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFY--TLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIK--FLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGR---------RLDNGQCNRGNLII----YDSNYDAKV--------FCGSGVIDSAIFTPPVTLILSAEGYRYPG----------FLIRWNPPVDENFKKIGD---CEYIIKA--TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV------------EFTGSKNPIFSFIEYVAM-VKCGSLNNSEFNVFQTYLFNSIKI--------------TYKADEFDPFPGF-----KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMT---PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQ 7339
             CG       G F+SP YPN  +  + CV+ I  +PG  I L+        +     +D++++R+G    + L GRF    L E    T     +  +W+  RS     +N +   F A Y      + + D G + SP +   Y       W +       +  TF  F + R          + +G     NLI     Y+   D K         F   G I+ A F   V      +    P            L  +    D  ++   D   CE       T     +TSP +P      + C W ++      + +Q   F+ E +  CKY+   V            +F GS+ P     +Y  M V+  S N      F+ + F+                  T+ + E     GF     K   K+A  +       G++ +  +P+K    K CT+ + S    + + LT +++   +  +C    L++      K       CGS  P   +P++   + + +  + + S + +  GFQ  +S    ECGG+       D +  D+ S+        P  ++C+W   +  G  +++ F+   V     C   ++  FDG  +   ++G     G    +++ G+ + + F + D  S   F L+         LH R+
Sbjct:  326 ACGETLQDSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRS-RLCWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVST-----DSRLWVEFRSS----SNWVGKGFFAVYEAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFA--VNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAI-SSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKP---EPVLATGNRMFLRFYSDNSVQRK--GFQASHST---ECGGQVRA----DVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTKFQDTLHSRK 991          

HSP 12 Score: 84.3445 bits (207), Expect = 2.736e-15
Identity = 75/273 (27.47%), Postives = 121/273 (44.32%), Query Frame = 2
Query: 2645 EYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAK-------------------VSVF-----DCGGSFFLTNKLIIGYPESHLNESTYDEET--------QYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGF 3337
            E ACG  +     S     S  +P+ Y  N +C++Q  A T+ +I++ F  F+   +  CK+DF+++ SG +    L  ++C   K E+IT   N+    + + FKS++T +  GF+A                    V+ F      C   F L +           ++ T    T        +Y   K CTW I++     +   F +  +ES P CAYD+LE+      K     RFCG+  K  P +   +++ +RF SDNSV  +GF
Sbjct:  593 EAACGGFLTKLNGS---ITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNN----MRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGS-KKPEPVLATGNRMFLRFYSDNSVQRKGF 857          

HSP 13 Score: 81.2629 bits (199), Expect = 2.592e-14
Identity = 100/502 (19.92%), Postives = 188/502 (37.45%), Query Frame = 2
Query: 9812 YENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNN-SPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERV----------FISSHDKVIIQYQVGPMENINSAT-------DRRFQISYELYTCN------------RTEKAYSGRIVNVEN-----FKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIK-------------------------------------CGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-----KYCG 11086
            Y  ++ C W+I+   G   K+I    S+ L  RSR+  C YD++ + DG     P+    CG    + I +  + +++ F +  N    GF   + A+   +     V   +  ++SP YP++  P  +      I  +E  H+ +T +  +I    +C+ D   ++D   +  N I ++C     + +          F+S        + V   + ++  +       ++R   +   Y C+            R E A  G +  +          K+Y  N  C   L+ P    R    F +F  E +  C YD+++   G   + + +  K CGS  P    +  + + + F +D +++  G+   +  ++D   K                                     C  ++   SG ITSP +   Y    EC+W I       +K  F +M + +    +P C    D ++V  G  A      ++CG
Sbjct:  347 YSAHMHCVWRISVTPGE--KIILNFTSMDLY-RSRL--CWYDYVEVRDGFWRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVYEAICGGD-----VKKDNGHIQSPNYPDDYRPSKVCIW--RIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPT-QYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSK-LHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIES----QPEC--AYDHLEVFDGRDAKAPVLGRFCG 828          

HSP 14 Score: 80.4925 bits (197), Expect = 4.162e-14
Identity = 56/230 (24.35%), Postives = 104/230 (45.22%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI-SGSNS-GHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELI--HDNQTKRFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +   +    ++ ++F++ DI    EC +D +++  G ++   +  R+C   K E +    N    ++ + F S+++    GF+A  S  +CGG      K    Y  +   ++ Y           C W I       +  VF  F +E   +C YDY+EL   +D+   R  G +  SGP     +    ++++F SD+++S +GF +R+ + K
Sbjct:  765 SPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGN----RMFLRFYSDNSVQRKGFQASHST-ECGGQVRADVKTKDLYSHAQFGDNNYPGGVD------CEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRL-GRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTK 982          

HSP 15 Score: 80.4925 bits (197), Expect = 4.197e-14
Identity = 121/561 (21.57%), Postives = 202/561 (36.01%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN---------------HIRSGSVDETKL----CNDKNPV-LKFVTAKKEINIVCSEQITK----MHVFEE----------QSVHVIFQNLASTKYRFRLYY-----TQDCEFP----ITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAH-------------------------------EGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET 5152
            CG       GHI SPNYP     +  C W I+ + G  + +                   +R G  + + L    C  + P  +K  +++  +  V    I K    ++ F+E                   L S K      Y      + CE      +T  +G I S      Y     C W+L +    +I +Q D F+     N  C Y FV +       + L  K CG++      TS    +R+E  +D +      +AH                                G VL      C E       E   ++ +G I S  +P+   +  +C W   + PG  VKL F  +++ES   C+    L  ++        + + C      K   + ++ +  +L+F+S N      + FQ ++   +  C  ++          ++  F    YP  + C W +  +E   + L    FE EE   C YDY+E+F   ++   +L   CG           S  + +L+KF +D T+S +GF  +Y  T
Sbjct:  440 CGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETE--GNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPE-VITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGC----EHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAY-DHLEVFDGRDAKAPVLGRFCG---SKKPEPVLATGNRMFLRFYSDNSVQ--RKGFQASH---STECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGP---PEEVYSAGDSVLVKFHSDDTISKKGFHLRYTST 981          

HSP 16 Score: 75.485 bits (184), Expect = 1.275e-12
Identity = 117/539 (21.71%), Postives = 198/539 (36.73%), Query Frame = 2
Query: 6275 LTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVE--FTGSKNPIFSFIEY--------------VAMVKCGSLNNSEFNV----------------FQTYLFNSIKITYKADEFDPFPGFKLSYKK----ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITN---------------------------------SSWIIVNLFGNFSSESRYSGFQIMYSKKD-EECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMDDFSYFRLKVKIGS-CGGLLHR----RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            + SPNYP+     + C W I       + +   SF++E    C Y+   V    + S N I  +  Y              +  V  GS+N + F V                 +    N++  +YK       PG++L+  K    A    F   L GS+ +  +P +   NKNC + L +    Y ++L         N  C   F+++ +       ++   CGS  P  +     N                                      VN FG++  + R SGF +  +K D +E G  H++T    +     + N     P   EC W  +S PG R+++ F E+ I S+  C    L  FDG       +G   FCG  K   +   GN + + F + +       +    + CGG +      +  Y  +     NYP    C W I       + L F   +++E  +C    + +    +S    +   C S    ++Y+   +V + F ++   ++KGF L+Y
Sbjct:  451 IQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLG-SYKCS---CDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAP-TQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCR-SGFVLHDNKHDCKEAGCEHKVT---STSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLG--RFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHSTECGGQVRADVKTKDLYSHAQFGDNNYPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGPPEEVYSAGDSVLVKFHSDDTISKKGFHLRY 978          

HSP 17 Score: 69.707 bits (169), Expect = 9.084e-11
Identity = 87/402 (21.64%), Postives = 160/402 (39.80%), Query Frame = 2
Query: 6641 GSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-----AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHM-TPHFIE-------CKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTI----------------LFKNMDDFSY----------------FRLKVKIG------------SCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLT--FMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMC 7654
            G+  + EYPN    + +C + I  +     ILN T++DL    +  C   ++++         +    CG  +P   +PI++  S     L+  F S S + G +  ++  +  CGG             D+  +  H+ +P++ +       C W      G  + + F+   I R   C   +L   DG +  +  IG   +CG  K + I +  + L +                 FK +D+ S                 ++     G            +CGG L +  G I SP +P  YPP  +CIWQ+   +   I L   F + + ++ C    + V     +++ +    C S   ++ T +Y+ +R+ FK++   ++KGFK  +F +   C
Sbjct:  336 GNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLY--RSRLCWYDYVEVRDGFWRKAPLRGRFCGGKLP---EPIVSTDS----RLWVEFRSSSNWVG-KGFFAVYEAICGG-------------DVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIG--RYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGFLTKLNGSITSPGWPKEYPPNKNCIWQLVAPTQYRISLQFDFFETEGNDVCKYDFVEVRSGLTADSKLHGKFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDEC 712          

HSP 18 Score: 67.781 bits (164), Expect = 3.279e-10
Identity = 33/100 (33.00%), Postives = 51/100 (51.00%), Query Frame = 2
Query: 8381 YPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADT 8680
            YP   DCEW+I+A E   ++L  QT  +E   DC YD++ +    +  +P   + CG  P   E +    + + + FHSD ++SK GF + Y      DT
Sbjct:  889 YPGGVDCEWVIVAEEGYGVELVFQTFEVEEETDCGYDYIELFDGYDSTAPRLGRYCGSGP--PEEVYSAGDSVLVKFHSDDTISKKGFHLRYTSTKFQDT 986          

HSP 19 Score: 59.6918 bits (143), Expect = 8.056e-8
Identity = 123/595 (20.67%), Postives = 206/595 (34.62%), Query Frame = 2
Query: 6260 NQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-----AMNINKTLCGSNIPPDLQPIIT------------NSSWIIVNLFGNFSSESRYS---------------------GFQIMYSKK--DEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTR--MQIDFEELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFKNMDDFSYFRLKVKI-----------GSC-----------------GGLLHRRQ----------------GYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPER--------ELNSTNYPKTLSWFLRCTWKI 7744
            + T   +SP YPN       C W I     E + +   S DL  S  C Y+   V +    K P+           CG           + L+    + +++       GF   Y+  C  D +    G +Q+  YP+    +K C + ++     + + LT        +  C   +L++      + N+    CG   P D++   +            N +   VN F      SR +                     G+++   K+  +  CGG   LT+   S I      + +  P    C W   +P   R  +Q DF E      +C   F+    G T  ++  G   FCG  K   I +  N + + FK+ +  S    K              G C                 G +LH  +                G I SPN+P  YP    C W IS      ++LTF++ D++    C+  +L V   ++++  V+   C S   + +    + + + F ++    RKGF+  +  E   CGG+     +        +    NYP  +     C W I
Sbjct:  333 DSTGNFSSPEYPNGYSAHMHCVWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGFWRKAPLRGRF-------CGGKLPEPIVSTDSRLW----VEFRSSSNWVGKGFFAVYEAICGGDVKKD-NGHIQSPNYPDDYRPSKVCIWRIQVS-EGFHVGLTFQSFEIERHDSCAYDYLEVRDGHSESSNLIGRYCGYEKPDDIKSTSSRLWLKFVSDGSINKAGFAVNFFKEVDECSRPNRGGCEQRCLNTLGSYKCSCDPGYELAPDKRRCEAACGGF--LTKLNGS-ITSPGWPKEY--PPNKNCIWQLVAPTQYRISLQFDFFE-TEGNDVCKYDFVEVRSGLTADSKLHG--KFCGSEKPEVITSQYNNMRVEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQQDCVNTFGSYECQCRSGFVLHDNKHDCKEAGCEHKVTSTSGTITSPNWPDKYPSKKECTWAISSTPGHRVKLTFVEMDIESQPECAYDHLEVFDGRDAKAPVLGRFCGSKKPEPVLATGNRMFLRFYSDNSVQRKGFQASHSTE---CGGQVRADVKTKDLYSHAQFGDNNYPGGVD----CEWVI 899          

HSP 20 Score: 58.9214 bits (141), Expect = 1.517e-7
Identity = 64/278 (23.02%), Postives = 116/278 (41.73%), Query Frame = 2
Query: 10391 DKVIIQYQV-------GPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG-----NQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGFRI 11182
            D ++ +Y+V       G    ++     + +  Y+   C  T +  +G   + E      YS ++ C +  I+  P  +    F   +L RS  C YDY++   G    +  +  + CG  +P   V+  SR+ + F +  +    G+   Y         CGG++  D+G I SP +  +Y  S  C W I++    ++   F   ++  + S         D+++V  G     N   +YCGY   D+   I S+S  +  K ++ G    AGF +
Sbjct:  289 DTIVPKYEVNGVKPSIGQRTRLSKGDIAQARKLYKCPACGETLQDSTGNFSSPEY--PNGYSAHMHC-VWRISVTPGEKIILNFTSMDLYRSRLCWYDYVEVRDGF-WRKAPLRGRFCGGKLPEPIVSTDSRLWVEFRSSSNWVGKGFFAVY------EAICGGDVKKDNGHIQSPNYPDDYRPSKVCIWRIQVSEGFHVGLTFQSFEIERHDSCA------YDYLEVRDGHSESSNLIGRYCGYEKPDD---IKSTSSRLWLKFVSDGSINKAGFAV 547          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Mouse
Match: Notch4 (notch 4 [Source:MGI Symbol;Acc:MGI:107471])

HSP 1 Score: 142.124 bits (357), Expect = 6.374e-33
Identity = 126/392 (32.14%), Postives = 179/392 (45.66%), Query Frame = 2
Query:  470 KLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNP-KPFKCLCDSG----------------------WSLDPVT-------------KTCIADIDECRV---GKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLE-NVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCE 1525
            ++  DDC  + C NGA C+DG +++ C+CP+ +KG  C+ED++EC +  G    C+NG  C+NT GSF CVC   W G  C           N D C   TC P  +  +    F CLC  G                       S +P+T              TC  D+DEC++   G  PC      +C+NTPG   C  C  G+ G+     D NEC  +  C P   C++   T+ C C  G++ R   +C++E N C +N   C   AAC   +  + G  C C PG++G    ++     ST               C NGG C+     F C+CLPGF G  C   + ++CLS+PC  G +C    P  + C C+P F+G  CE
Sbjct:  275 EMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDEC-EARGPPR-CRNGGTCQNTAGSFHCVCVSGWGGAGCE---------ENLDDCAAATCAPGSTCIDRVGSFSCLCPPGRTGLLCHLEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQDLDECQMAQQGPSPCEHG--GSCINTPGSFNCL-CLPGYTGSRCE-ADHNECL-SQPCHPGSTCLDLLATFHCLCPPGLEGR---LCEVEVNECTSNP--CLNQAAC---HDLLNGFQCLCLPGFTGARCEKDMDECSSTP--------------CANGGRCRDQPGAFYCECLPGFEGPHCEKEV-DECLSDPCPVGASC-LDLPGAFFCLCRPGFTGQLCE 626          

HSP 2 Score: 127.872 bits (320), Expect = 1.255e-28
Identity = 122/388 (31.44%), Postives = 161/388 (41.49%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNI-----PINSCSNASNTDIC--GHGT-----CYPDHS----PTNP------------------KPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQ----LCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            D C+ NPC NG  C+  Y   +C CP  F+G  C  D+NEC    G    C  G  C NT+GS++C+C     G  C +     P  SC N     +   GH T     C P  +      NP                    + CLC   W        C  DIDEC   + P        C NT G   C  C  G+ G G    ++++CA A TC P   C++  G++ C C  G   R   +C LE++C +    C  NA CS N       +C C PGYSG             +  ++    C   Q     C +GG+C  +   F C CLPG+ G+RC    +N+CLS PC  G  C  L    + C C P   G  CE E
Sbjct:  159 DFCSANPCANGGVCLATYPQIQCRCPPGFEGHTCERDINECFLEPGP---CPQGTSCHNTLGSYQCLCPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWK----GWDCSEDIDECEA-RGPPRCRNGGTCQNTAGSFHCV-CVSGWGGAGCE-ENLDDCA-AATCAPGSTCIDRVGSFSCLCPPG---RTGLLCHLEDMCLSQP--CHVNAQCSTNPL-TGSTLCICQPGYSG-------------STCHQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCE-ADHNECLSQPCHPGSTCLDLLAT-FHCLCPPGLEGRLCEVE 514          

HSP 3 Score: 93.2041 bits (230), Expect = 5.452e-18
Identity = 105/377 (27.85%), Postives = 154/377 (40.85%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPN--------------EECVNGFGTY-------QCKCVQGMKRRANNMCQ---LENVCETNNGGCSTNAACSANNFRIE--GRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENE 1531
            +++C + PCH G+ C+D   +F C+CP   +G+ C  +VNEC     T + C N A C + +  F+C+C   ++G  C   ++ C   S+T     G C        P  F C C  G+        C  ++DEC     PC +    +C++ PG   C  C  GF G         +      C PN                C+   G+         C C  G  +R+  +C        CET  GGC +           +  G  CTC  GY G        +  S  VT            C NGG+C     G++C CLP   G  C+T +++ C+S  CLNGG C    P  + C C   F G++CE +
Sbjct:  477 HNECLSQPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNEC-----TSNPCLNQAACHDLLNGFQCLCLPGFTGARCEKDMDEC---SSTPCANGGRCR-----DQPGAFYCECLPGFE----GPHCEKEVDECL--SDPCPVG--ASCLDLPGAFFCL-CRPGFTG---------QLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTPCAHGGTCHPQPSGYNCTCPAGYMG--------LTCSEEVTA------CHSGPCLNGGSCSIRPEGYSCTCLPSHTGRHCQTAVDH-CVSASCLNGGTC-VNKPGTFFCLCATGFQGLHCEEK 806          

HSP 4 Score: 90.5077 bits (223), Expect = 3.819e-17
Identity = 107/390 (27.44%), Postives = 156/390 (40.00%), Query Frame = 2
Query:  455 HQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS--NTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGN----------------GFTCLDINECANAYTCGPNEECVNGFGTYQCK---CVQGMKRRANNMCQLEN----VCETNNGGC-STNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCEN--EHIV 1540
            HQ  ++        +PC +G  CI+   SF C+C   + G  C  D NECL        C  G+ C + + +F C+C     G LC + +N C++    N   C        H   N   F+CLC  G++       C  D+DEC     PC+      C + PG   CE C  GFEG                 G +CLD+     A+ C     C  GF    C+   C   M +        E+    +C   + GC      C  ++   +  +C C+ G++G          +ST               C +GGTC    +G+ C C  G+ G  C   +   C S PCLNGG+C  + P  Y C C P  +G +C+   +H V
Sbjct:  431 HQDLDECQMAQQGPSPCEHGGSCINTPGSFNCLCLPGYTGSRCEADHNECLS-----QPCHPGSTCLDLLATFHCLCPPGLEGRLCEVEVNECTSNPCLNQAAC--------HDLLN--GFQCLCLPGFT----GARCEKDMDECS--STPCANG--GRCRDQPGAFYCE-CLPGFEGPHCEKEVDECLSDPCPVGASCLDL---PGAFFC----LCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHCQRSLCVCDEGWTGPECETELGGCISTP--------------CAHGGTCHPQPSGYNCTCPAGYMGLTCSEEV-TACHSGPCLNGGSCS-IRPEGYSCTCLPSHTGRHCQTAVDHCV 773          

HSP 5 Score: 89.3521 bits (220), Expect = 8.318e-17
Identity = 99/377 (26.26%), Postives = 135/377 (35.81%), Query Frame = 2
Query:  479 YDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPI---------------------------NSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCEN 1528
             D+C++ PC NG +C D   +F C C   F+G HC ++V+ECL        C  GA C +  G+F C+C   ++G LC +P+                             C  A +   C HG C         +   C+CD GW+  P  +T                      C++TP                        CA+  TC P          Y C C  G      +    E V   ++G C    +CS    R EG  CTC P ++G                  A   CV    C NGGTC      F C C  GF G  C    N  C  +PC N   C+   P   RC C P ++G +C+ 
Sbjct:  553 MDECSSTPCANGGRCRDQPGAFYCECLPGFEGPHCEKEVDECLSDP-----CPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHGHC---------QRSLCVCDEGWT-GPECET------------------ELGGCISTP------------------------CAHGGTCHPQPS------GYNCTCPAGYMGLTCS----EEVTACHSGPCLNGGSCS---IRPEGYSCTCLPSHTG-------------RHCQTAVDHCVSAS-CLNGGTCVNKPGTFFCLCATGFQGLHCEEKTNPSCADSPCRNKATCQDT-PRGARCLCSPGYTGSSCQT 844          

HSP 6 Score: 61.6178 bits (148), Expect = 2.299e-8
Identity = 100/407 (24.57%), Postives = 148/407 (36.36%), Query Frame = 2
Query:  482 DDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHC------------------TEDVNECLQISGTIH--------GCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHG-TCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLD----------INECANAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSG-------DGVGENGCVIVSTNVTNRAYRRCVRRQ--------------------------LCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCH 1492
            D+C ++PC  GA C+D   +F C+C   F G+ C                   E    CL   G+           C +G  C+ ++    CVC   W+G  C   +  C +      C HG TC+P      P  + C C +G+    +  TC  ++  C  G           C+N         C I  EG   TCL           ++ C +A +C     CVN  GT+ C C  G +      C+ +      +  C   A C        G  C C+PGY+G       D      C   +  + +    +C+  Q                          LC+NGG C  + + + C+C PGF G  C+  + N C  NPC +G  C    P+ Y C 
Sbjct:  592 DECLSDPCPVGASCLDLPGAFFCLCRPGFTGQLCEVPLCTPNMCQPGQQCQGQEHRAPCLCPDGSPGCVPAEDNCPCHHG-HCQRSL----CVCDEGWTGPECETELGGCISTP----CAHGGTCHP-----QPSGYNCTCPAGY----MGLTCSEEVTACHSGP----------CLNG------GSCSIRPEGYSCTCLPSHTGRHCQTAVDHCVSA-SCLNGGTCVNKPGTFFCLCATGFQ---GLHCEEKTNPSCADSPCRNKATCQDTP---RGARCLCSPGYTGSSCQTLIDLCARKPCPHTARCLQSGPSFQCLCLQGWTGALCDFPLSCQKAAMSQGIEISGLCQNGGLCIDTGSSYFCRCPPGFQGKLCQDNV-NPCEPNPCHHGSTC-VPQPSGYVCQ 955          

HSP 7 Score: 58.151 bits (139), Expect = 2.486e-7
Identity = 101/380 (26.58%), Postives = 132/380 (34.74%), Query Frame = 2
Query:  542 FKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCE-NTIGSFRCVCSGKWSGVLCNI----PINSCSNASNTDICGHGTCYPDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEG----------------NGFTCLDINE---------CANAYT---------------CGPNEECVNGFGTYQCKCVQGMK----RRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEF-LFPNHYRCHCQPLFSGVNCENE 1531
            F C CP  F G  C   + E    S     C NG  C     G  +C C   W+G  C +      N C+N         G C      T P+  +C C  G+       TC  DI+EC +   PC      +C NT G  +C  CP+G EG                NG TC  + E         C   +T               C     C++G  TY C C +  K        + C+        NGG   N   +A +F      C C  G+ G G  E        N+ + A   C        G TC   +  F+C C PG  G  C   + + CLS PC     C          C CQP +SG  C  +
Sbjct:  102 FSCTCPSGFTGDRCQTHLEELCPPS----FCSNGGHCYVQASGRPQCSCEPGWTGEQCQLRDFCSANPCANG--------GVCL----ATYPQ-IQCRCPPGFE----GHTCERDINECFLEPGPCPQG--TSCHNTLGSYQCL-CPVGQEGPQCKLRKGACPPGSCLNGGTCQLVPEGHSTFHLCLCPPGFTGLDCEMNPDDCVRHQCQNGATCLDGLDTYTCLCPKTWKGWDCSEDIDECEARGPPRCRNGGTCQN---TAGSFH-----CVCVSGWGGAGCEE--------NLDDCAAATCAP------GSTCIDRVGSFSCLCPPGRTGLLCH--LEDMCLSQPCHVNAQCSTNPLTGSTLCICQPGYSGSTCHQD 433          

HSP 8 Score: 54.299 bits (129), Expect = 4.531e-6
Identity = 31/93 (33.33%), Postives = 48/93 (51.61%), Query Frame = 2
Query:  467 EKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNAS 745
            E+ T   CA++PC N A C D     +C+C   + G  C   ++ C +       C + ARC  +  SF+C+C   W+G LC+ P+ SC  A+
Sbjct:  804 EEKTNPSCADSPCRNKATCQDTPRGARCLCSPGYTGSSCQTLIDLCARKP-----CPHTARCLQSGPSFQCLCLQGWTGALCDFPL-SCQKAA 890          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. Ensembl Mouse
Match: Tll1 (tolloid-like [Source:MGI Symbol;Acc:MGI:106923])

HSP 1 Score: 141.739 bits (356), Expect = 8.709e-33
Identity = 147/594 (24.75%), Postives = 236/594 (39.73%), Query Frame = 2
Query: 7652 CGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQG--CFR--IRAR-GVGYRSVLLYIICASNLENFEIDTKSSM-IEVFGSGATISFSYNSDQPSLCGSNIYPNNNE-----------------SGVITIENVNISL------------CQYN-------------------IHNYPED----EGTLSM-FMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTC-----------------------NGIIFNT-----------------EGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVY--DLRQGEIVS-ANVALINY-GSITCEYLI 9118
            CG    +    L+S  +P     +  C W+++V   ++I++    + + +   C+   I  R G   +S LL   C   +      T S M IE   S   +   + +   ++CG  I  N  +                   ++  E  ++ L            C Y+                    ++ PED      TL M F+SD T    +   F +       E  +    GC +R      +TLG       +PG E+       E     + CGGLLT+  G I +PG+P++YP N +C W +IAP    I +  +   LE +  C YD++ I      +S    K CG +    E ++ H N MR+ F SD +VSK GF  + +F +  D C                       NG + +                   G I SPN+P  YPS   C W I    G++++L F    + E      C YD L I D  +    +L  LCG+  P +P+ ++ N+M + F +D +   +GF A + + CGG    + +  ++ S A     NY G + CE+L+
Sbjct:  349 CGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGT---VNKAGFAANFFKEEDECAKPDRGGCEQR----CLNTLGSY-QCACEPGYELGPDRRSCE-----AACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGAD--IPEVMTSHFNNMRIEFKSDNTVSKKGF--KAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFN---EFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIP-DPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLL 921          

HSP 2 Score: 118.627 bits (296), Expect = 1.097e-25
Identity = 82/239 (34.31%), Postives = 111/239 (46.44%), Query Frame = 2
Query: 8306 YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY 9016
            Y+   CG  L ES G + SPG+P  YP  T C W +       I L   T+ L     C YD++ +R      SP   + CG + ++   L+   +RM + F S  +    GF   Y  I     C G I   EG I+SPNYP  Y     C W I V EGY V LTF+  F++ER    +C YD L + D  S    L+   CG   P + I S+ N + + F +D   N  GF A +
Sbjct:  344 YRCPACGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCG-DKVAG-VLTSTDSRMWIEFRSSSNWVGKGFAAVYEAI-----CGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQA-FEIERHD--SCAYDHLEVRDGASENSPLIGRFCGYDKPED-IRSTSNTLWMKFVSDGTVNKAGFAANF 571          

HSP 3 Score: 112.079 bits (279), Expect = 9.989e-24
Identity = 142/660 (21.52%), Postives = 238/660 (36.06%), Query Frame = 2
Query: 3737 CGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-----------DKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD-----------------------RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTK--------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACN--------------RIDDGKSIIIQSSTHNFYLKFFSANDP----NGGMRK-------------------FQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSP------NYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNG 5440
            CG     + G+++SP +P   P+ T+C W +  TPG++I++    +    + ++ LC             K+P+L      K   ++ S   ++M +    S + + +  A+        Y   C   I  + G+I+S N       ++ C WK+    G  + +    F++    +   Y  + + D                        SNTL  K   +  +N+   ++N+  + E    +       +     +  YQ   C   +   P                NG I +  +P     N +C W       + + +KF+  E+E +  C     +  W     +     + C               RI+      +  S   F   FFS  D     NGG +                     +  ++     CE ++    G+I SPN+P+ YP    C+W +       I L   +FE E+   C YD++EIF         L  LCG     I     +  NEM I+F +D +V  +GF+A +   CGG   A    + L S       NYP         CEW LV   SE G R+   F  FE      +C  D  + + +G+ + +      C   P   I S G
Sbjct:  349 CGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTM---DLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTD-SRMWIEFRSSSNWVGKGFAAV-------YEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIE-RHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANF-FKEEDECAKPDRGGCEQRCLNTLGSYQC-ACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKY-DYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTV--SKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSK---IPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLD-----CEWLLV---SERGSRLELSFQTFE-VEEEADCGYD-YVEVFDGLSSKAVGLGRFCGSGPPEEIYSIG 978          

HSP 4 Score: 109.768 bits (273), Expect = 4.554e-23
Identity = 154/682 (22.58%), Postives = 251/682 (36.80%), Query Frame = 2
Query: 4403 YQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRID----DGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------------------------------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKS--TSGNAIFKAAY--------------------GVGSSTCG--GDFYLDD------------------GLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSD---YGVLASPQFG-HVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI 6151
            Y+   C ET             +G + S  FPN   +   C W     PG  + L F  +++  S  C        W + I   +  ++    +     D  + ++ S+    +++F S+++  G  + F   YE     C  E+  +EG IQSPNYP+ Y     C W + V E   + L    FE E    C YD++E+    + +   +   CG           S +N + +KF +D TV+  GF A +F+                                            CGGL   +  N  + +P +P  Y  P+  C W ++A  S+  + + F F   EG   N  C  D  + I  G+ + S +    C       + S+ + +++  KS  T     FKA +                     +GS TC     F L +                  GL TSP +P+      +C +VI   PG  I L+  EF  E       +D ++I +G  E S +LGR    S+I +        + ++IR  S          F A +        +++     + +  QFG + Y    +  W + +E   +L+ +F  F V    D   C    + ++D      V    FCGSG  +       V LI
Sbjct:  344 YRCPACGETL---------QESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLC--------WYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVG--KGFAAVYEAI---CGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDK---PEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKL--NGTITTPGWPKEYP-PNKNCVWQVIA-PSQYRISVKFEFFELEG---NEVCKYD-YVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQH-QECAYDHLEIFDGETEKSPILGRL-CGSKIPDPL--MATGNEMFIRFISDAS--VQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEAD---CGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALI 983          

HSP 5 Score: 108.997 bits (271), Expect = 8.525e-23
Identity = 141/636 (22.17%), Postives = 235/636 (36.95%), Query Frame = 2
Query: 4805 SCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFET----EESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKA----------------------------------AYGVG------SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRF-------YTLSEIRNYTYNYKFNDSVWIR-------------LRSQGGDFTNHIKFLAKY----------HINYN--------TEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSP------NYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV 6424
            +C   +  S G + SP +PN YP    C W + V     I   +L+F T    + SLC YDY+E+          L   CG     + T   S ++ M I+FR+      +GF A Y   CGG     E    + SPNYP  Y  P   C W ++ +    G  +   F  FE   ++ +C+ D+ L + +G   NS +    C       I   SN  ++K +   T   A F A                                   Y +G       + CGG     +G  T+P +P     + +CV+ +       I +  E F  E       +D+++I +G +  S L G+F          S   N    +K +++V  +              +  GG     +  +  Y          H N +         +  S  G++ SP +   Y    E TW + A    ++   F++F V +   + +C   +L I+D   +        CGS + D  + T     I  +S    +  GF                +C   +KA ++ + L S       NYP     +  C W ++++R   L++   +F++E   +C Y+   V
Sbjct:  348 ACGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKI---VLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLT---STDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQ--IQSPNYPDDYR-PMKECVWKIMVSE---GYHVGLTFQAFEIERHD-SCAYDH-LEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGN-EVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQ---HQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGF----------QATHSTECGGRLKAESKPRDLYSHAQFGDNNYPG----QLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEV 951          

HSP 6 Score: 107.842 bits (268), Expect = 2.129e-22
Identity = 132/563 (23.45%), Postives = 219/563 (38.90%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVA--------FINP--------------------TPGPMLG---------CGGYM---NATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPS---------QNHLIKTVTNF-----------------------------SQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRR--FQISYELYTCNRTEKAYSGR-IVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMI-FVTDQSINYDGYDITYVVNRDP 10843
            +++PN+P  Y       W      GY   +  ++ +IER +D C YD +     +S +S  I  FCG           +N L ++F SD +   N  GF A           P                     PG  LG         CGG +   N T+ T G  K         Y  N  C WQ+ AP  + + V FE     LEG      C+YD++ I+ G  S   +    CG D  + +T+  N M + F +D  + K GFK  F +            Q+  + T+ ++                             S L+ SP +P+  P   +    +I+A     IT+   + ++     C+ D   I D   +    + + C S   + + +++ +++ I++       I+ A+ +R  FQ ++      R +     R + +   F    Y   L C   L++   + R +  F+ F +E  + C YDY++   G    +   L + CGS  PP  + +   V++I F TD +IN  G+ I Y   R P
Sbjct:  473 IQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIER-HDSCAYDHLEVRDGASENSPLIGRFCG-YDKPEDIRSTSNTLWMKFVSDGT--VNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKE--------YPPNKNCVWQVIAPSQYRISVKFE--FFELEGNEV---CKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYP-SRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPL-MATGNEMFIRF-------ISDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGS-RLELSFQTFEVEEEADCGYDYVEVFDG-LSSKAVGLGRFCGSG-PPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYP 1006          

HSP 7 Score: 102.064 bits (253), Expect = 1.150e-20
Identity = 76/253 (30.04%), Postives = 116/253 (45.85%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKP-----------YPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLV-FSTDFNHNLEGFHAQYKSI 9025
            K + C   +    G I SP +P+KYP   +C W+I A     I L      +E H +C YDHL I   E   SP   +LCG + I +  ++   N M + F SD SV + GF   +     +  C        G +K+ + P+            YP  L C W +    G ++ L+F+  F++E  +   C YD + + D  S+    L   CG+ PP      S+  ++L+ F TD   N +GF+ +YKSI
Sbjct:  770 KEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCG-SKIPDPLMATG-NEMFIRFISDASVQRKGFQATH-----STECG-------GRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQT-FEVEEEA--DCGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIY--SIGDVALIHFHTDDTINKKGFYIRYKSI 1003          

HSP 8 Score: 98.9821 bits (245), Expect = 9.623e-20
Identity = 128/612 (20.92%), Postives = 235/612 (38.40%), Query Frame = 2
Query: 9407 LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNV-LIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF------TAVPSQNHLIKT--------------------------------VTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIE-KFCESLSTERVFISSHDKVIIQYQ--------------------------------VGPMENINSATDRRFQISYELYTCNRTE---KAYS-GRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDS---GVITSPGFGTNYYESG-ECSWNIKLVSNSYIKWRFTDMQL 10996
            L +P FP+ Y    +  W  +   G    +N  ++D+ +S   C YD++         S  +  FCG+   ++  +  T+  + + F+S  S      GF A           CGG +    G    I+S +  ++  Y     C W+I    G+ V + F+   I      R   C YDH+ + DG     P+I   CG D+ + I + SN +++ F +D  + K+GF   F       A P +    +                                 +T  +  + +P +P   P +   + ++IA ++   I++  +  ++  +  C  D   I  + L  E+K+  KFC +   E V  S  + + I+++                                V  M +        F +    + C   E   K +S   ++   N+  K Y     C   + +  P  R    F  F +E+   CAYD+++   GE  E+  +L ++CGS IP   +   + + + F++D S+   G+  T+      S +CGG +  +S    + +   FG N Y    +C W +     S ++  F   ++
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKSPLLGRFCGD--KVAGVLTSTDSRMWIEFRS--SSNWVGKGFAAVYEAI------CGGEIRKNEGQ---IQSPNYPDD--YRPMKECVWKIMVSEGYHVGLTFQAFEIE-----RHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQY-RISVKFEFFELEGNEVCKYDYVEIW-SGLSSESKLHGKFCGADIPE-VMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDK-YPSRKECTWVI-SAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGET-EKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATH------STECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEV 938          

HSP 9 Score: 98.2117 bits (243), Expect = 1.862e-19
Identity = 154/728 (21.15%), Postives = 258/728 (35.44%), Query Frame = 2
Query: 5432 SNGHYLKVILKSTSGNAIFKAAYGVGSST------------------CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIK--FLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFT-------------FDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV--------FCGSGVIDSAIFTPP--------------------VTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFK---LSYKKACYKD------------------FRNPL---------------------EGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMT---PHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMD 7273
            S G +L  IL S   N I  A   +G  T                  CG       G  +SP +PN       C++ +  +PG  I L+        + S   +D+I++R+G    S LLGRF         T     +  +WI  RS     +N +   F A Y      E R + G + SP +   Y    E  W +       +  T             +D   V           G    YD   D +         F   G ++ A F                       +  + S +    PG+ +  +    E       C  ++   N T  +T+P +P      + C W ++      + ++   F+LE +  CKY+            I+S +   + +  G    ++     T  FN+++I +K+D      GFK    S K  C KD                   RN                        G + +  +P+K    K CT+++ S    + + L   +     + +C    L+I      K+     LCGS IP    P++   + + +    + S + +  GFQ  +S    ECGGR +     +S+  D+ S+        P  ++C+W   S  G+R+++ F+   V     C   ++  FDG +  ++ +G   FCG      I++IG+V  I F   D
Sbjct:  305 SRGMFLDTILPSRDDNGIRPA---IGQRTRLSKGDIAQARKLYRCPACGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKS-SLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTST---DSRMWIEFRSS----SNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCE-----AACGGLLTKLNGT--ITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKYDYVE---------IWSGLSSESKLH-GKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVI-SAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIP---DPLMATGNEMFIRFISDASVQRK--GFQATHST---ECGGRLKA----ESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLS--SKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDD 989          

HSP 10 Score: 84.3445 bits (207), Expect = 2.865e-15
Identity = 68/244 (27.87%), Postives = 113/244 (46.31%), Query Frame = 2
Query: 2651 ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGS--NSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCG-NHAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFY 3352
            ACG ++   + S+    S  +P  Y   +HC+++       KI ++F   D+   S C +D+I++         L  R+C G+K   + L S D   ++ I F+S+S + G GF A      CGG         I   E  +    Y ++  Y   K C W+I       +   F  F +E H +CAYD+LE + D  ++      RFCG +  +   + ++ L ++FVSD +V+  GF   F+
Sbjct:  348 ACGETL---QESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFC-GDKVAGV-LTSTD--SRMWIEFRSSSNWVGKGFAAVYEAI-CGGE--------IRKNEGQIQSPNYPDD--YRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLE-VRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFF 572          

HSP 11 Score: 82.8037 bits (203), Expect = 9.276e-15
Identity = 72/275 (26.18%), Postives = 128/275 (46.55%), Query Frame = 2
Query: 2639 SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETR-KIAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRA----------------KVSVFDCGGSFFLT--NKLIIGYPESHLNESTYDEET--------------QYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK------RFCGNHAKSGPTVT-HKLVIRFVSDNSVSGEGF 3337
            S E ACG  +     +     +  +P+ Y  N +CV+Q  A ++ +I++ F  F++  +  CK+D+++I SG S+   L  ++C  +  E++T + N+    + I FKS++T +  GF+A                +    +  GS+     N  ++   +    E+  +++               +Y   K CTW I+      I   F++F +E H  CAYD+LE I D +T+      R CG+        T +++ IRF+SD SV  +GF
Sbjct:  613 SCEAACGGLLTKLNGT---ITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNN----MRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLE-IFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGF 879          

HSP 12 Score: 78.5666 bits (192), Expect = 1.741e-13
Identity = 82/374 (21.93%), Postives = 145/374 (38.77%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVX--XXXXXXXXXDAIFCGNLTNISPFMIDT-NVLIVRFQSD--ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTY------------------------------GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGE-LIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQV 10417
             + TP +P  Y  N N  W   AP  Y  S+     ++E + + C YD+V      +S +     FCG   +I   M    N + + F+SD  +S       F +  +       GC      T+G+Y                              G+I S +  +   Y +   C W I+A  GH + + F  N   +E       C YDH+ I+DG     P++  LCG    D +    N M++ F +D ++Q+ GF+ T +        +K  +    L    ++ +N+ Y  +   E L+ +     + ++ +  ++    +C  D   + D        + +FC S   E ++ S  D  +I +  
Sbjct:  628 TITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGN-EVCKYDYVEIWSGLSSESKLHGKFCG--ADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDK--YPSRKECTWVISAIPGHRITLAF--NEFEVEQHQE---CAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHST--ECGGRLKAESKPRDLYSHAQFGDNN-YPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIY-SIGDVALIHFHT 987          

HSP 13 Score: 74.7146 bits (182), Expect = 2.367e-12
Identity = 79/333 (23.72%), Postives = 135/333 (40.54%), Query Frame = 2
Query: 4169 SKILIQIDKFDLPPLQNGQCYSFVRISDRS-NTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQAC-NRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF----YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY 5143
            SK+  +    D+P +     ++ +RI  +S NT+ KK       +     S      +H    +  S   +   G VL      C E       E    + +G+I S  +P+   +  +C W    IPG  + L F+  E+E    C+    L  ++ E      + + C ++I D     + ++ +  +++F S  D +   + FQ T+   +  C   +          ++  F    YP  L C W L  +    + L    FE EE   C YDYVE+F  +++  V L   CG           S+ +  LI F TD T++ +GF  +Y
Sbjct:  686 SKLHGKFCGADIPEVMTSH-FNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEA----ECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDH-LEIFDGETEKSPILGRLCGSKIPD----PLMATGNEMFIRFIS--DASVQRKGFQATH---STECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGP---PEEIYSIGDVALIHFHTDDTINKKGFYIRY 1000          

HSP 14 Score: 72.7886 bits (177), Expect = 9.066e-12
Identity = 55/236 (23.31%), Postives = 99/236 (41.95%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAV 10105
            ++ +PN+P  Y      TW+ +A  G+  ++     ++E+  + C YD +      +  S  +   CG+     P M   N + +RF SD S      GF A  +        CGG + A      +       +N  Y   L C+W + +  G  +++ F+   +  E       C YD++ ++DG  S    +   CG    + I +  +V  + F TD  I K GF + + ++
Sbjct:  784 LITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQE-CAYDHLEIFDGETEKSPILGRLCGSKIP-DPLMATGNEMFIRFISDAS--VQRKGFQATHSTE------CGGRLKAESKPRDLYSHAQFGDNN-YPGQLDCEWLLVSERGSRLELSFQTFEVEEEAD-----CGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSI 1003          

HSP 15 Score: 72.4034 bits (176), Expect = 1.188e-11
Identity = 53/233 (22.75%), Postives = 103/233 (44.21%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHAKSGP-----TVTHKLVIRFVSDNSVSGEGFIMRFYTVK 3361
            S N+P  Y     C +   A    +I ++F +F++    EC +D ++I    +    +  R C     + +    N+    + I F S+++    GF+A  S  +CGG     +K    Y  +   ++ Y  +        C W + +   + +   F  F +E   +C YDY+E+     +K     RFCG    SGP     ++    +I F +D++++ +GF +R+ +++
Sbjct:  787 SPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNE----MFIRFISDASVQRKGFQATHST-ECGGRLKAESKPRDLYSHAQFGDNNYPGQLD------CEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCG----SGPPEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIR 1004          

HSP 16 Score: 67.0106 bits (162), Expect = 5.173e-10
Identity = 66/304 (21.71%), Postives = 120/304 (39.47%), Query Frame = 2
Query: 7310 SCGGLLHRRQGYIASPNYPLNYPPISSCIWQI---SGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYT-EYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCG--------------GEYS--------------------------DPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGCFRIRAR---GVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYP 8071
            +CGGLL +  G I +P +P  YPP  +C+WQ+   S Y  S ++  F + + +E C    + +     SE+ +    C +   ++ T  ++ +RI FK++   ++KGFK  +F +   C               G Y+                           P   + S N+P        CTW I+     RI +   + ++  +Q C         G   +S +L  +C S + +  + T + M   F S A++    + +   + CG  +   +    +        S  Q+  +NYP
Sbjct:  617 ACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRIS-VKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTECGGRLKAESKPRDL-------YSHAQFGDNNYP 912          

HSP 17 Score: 66.6254 bits (161), Expect = 6.335e-10
Identity = 52/220 (23.64%), Postives = 102/220 (46.36%), Query Frame = 2
Query: 7043 PHFIECKWHFTSPPGTRMQIDFEELVISRI-ICNESFLAFFDGSTTFTQKIGGQNFCG-KTNSIFT-IGNVLTILFKNMDDF-SYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCN-SSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPER 7681
            P +  C W  +  PG ++ ++F  + + +  +C   ++   DG    +  +G   FCG K   + T   + + I F++  ++       V    CGG + + +G I SPNYP +Y P+  C+W+I      ++ LTF   +++  ++C+  +L V       + +I   C      DI +  +T+ + F ++    + GF   +F E+  C    + P+R
Sbjct:  370 PSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLG--RFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDEC----AKPDR 583          

HSP 18 Score: 66.2402 bits (160), Expect = 9.993e-10
Identity = 119/609 (19.54%), Postives = 220/609 (36.12%), Query Frame = 2
Query: 6275 LTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-AMNINKTL----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEEC-----GGRHE-----LTRYQ-----------DSRIVDMNSNRLHM-------TPHFIE-------CKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCG------------------KTNSIFTIGNVLTILFKNMDDFSY-----------------------FRL-----KVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPER--------ELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQ 7801
            L+SP +PN   +   C W +     E + +   + DL  S  C Y+   V +    K+P+     +      G L +++  ++         I +++       GF   Y+  C  + R   EG +Q+  YP+     K C + I+ S   +  L   A ++    +  C    L++    + N  L    CG + P D++   +N+ W+     G  +     +GF   + K+++EC     GG  +     L  YQ           D R  +     L         TP + +       C W   +P   R+ + FE   +    +C   ++  + G ++ ++  G   FCG                  K+++  +        F + D+ S                        F L       K   C   +H   G I SPN+P  YP    C W IS      I L F + +++++  C+  +L +   +  ++ ++   C S   D +    + + I F ++    RKGF+  +  E   CGG      +        +    NYP  L     C W +  +   R+ +  +  ++ +
Sbjct:  360 LSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLG--RFCGDKVAGVLTSTDSRMW---------IEFRSSSNWVGKGFAAVYEAICGGEIRKN-EGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIE--RHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRST-SNTLWMKFVSDGTVNK----AGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACEPGYELGPDRRSCEAACGGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAPSQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHG--KFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCRNGFVLHENKHDCKEAECEQKIHSPSGLITSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILGRLCGSKIPDPLMATGNEMFIRFISDASVQRKGFQATHSTE---CGGRLKAESKPRDLYSHAQFGDNNYPGQLD----CEWLLVSERGSRLELSFQTFEVEE 940          

HSP 19 Score: 63.929 bits (154), Expect = 4.643e-9
Identity = 45/162 (27.78%), Postives = 71/162 (43.83%), Query Frame = 2
Query: 7274 DFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEY-STVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV 7750
            D +  R   +  +CG  L    G ++SP +P  YP  + CIW++S      I L F   DL ++  C    + V      ++ ++   C      + T   S + I F++++    KGF   Y   + +CGGE    E ++ S NYP        C WKI V
Sbjct:  336 DIAQARKLYRCPACGETLQESSGNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDLYKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVY---EAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMV 494          

HSP 20 Score: 63.1586 bits (152), Expect = 8.968e-9
Identity = 143/674 (21.22%), Postives = 238/674 (35.31%), Query Frame = 2
Query: 5903 GVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNP--IFSFIEY--------------VAMVKCGSLNNSEF--NVF--------------QTYLFNSIKITYKADEFDPFPGFKL-----SYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILA-----MNINKTLCGSNIPPDLQPIITN---------------------------------SSWIIVNLFGNFSSESRYSGFQIMYSK---KDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISR-IICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKVKIG---SCGGLLHR----RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKY 7633
            G L+SP F + Y   T   W V     EK+   F    +     +  C    + + D  +        FCG  V      T     I   S+  +   GF   +        +K           N+ QI  SPNYP+     + C W I+      + +   +F++E    C Y++  V    S+N   I  F  Y              +  V  G++N + F  N F              +    N++     A E    PG++L     S + AC       L G++    +P +   NKNC + + +    Y +++         N  C   +++I +       ++   CG++IP  +     N                                      VN  G+++ + R +GF +  +K   K+ EC    E   +  S ++  + N     P   EC W  ++ PG R+ + F E  + +   C    L  FDG T  +  +G    CG    + +   GN + I F  + D S  R   +      CGG L      R  Y  +     NYP    C W +     S + L+F   +++E  +C    + V     S+   +   C S    +IY+      I F T+    +KGF ++Y
Sbjct:  358 GNLSSPGFPNGYPSYTHCIWRVSVTPGEKIVLNFTTMDL---YKSSLCWYDYIEVRDGYWRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVYEAICGGEIRK-----------NEGQI-QSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSCAYDHLEVRDGASENSPLIGRFCGYDKPEDIRSTSNTLWMKFVSDGTVNKAGFAANFFKEEDECAKPDRGGCEQRCLNTLGSYQCACE----PGYELGPDRRSCEAAC-GGLLTKLNGTITTPGWPKEYPPNKNCVWQVIAP-SQYRISVKFEFFELEGNEVCKYDYVEIWSGLSSESKLHGKFCGADIPEVMTSHFNNMRIEFKSDNTVSKKGFKAHFFSDKDECSKDNGGCQHECVNTMGSYTCQCR-NGFVLHENKHDCKEAEC----EQKIHSPSGLI-TSPNWPDKYPSRKECTWVISAIPGHRITLAFNEFEVEQHQECAYDHLEIFDGETEKSPILG--RLCGSKIPDPLMATGNEMFIRF--ISDASVQRKGFQATHSTECGGRLKAESKPRDLYSHAQFGDNNYPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGPPEEIYSIGDVALIHFHTDDTINKKGFYIRY 1000          

HSP 21 Score: 58.151 bits (139), Expect = 2.734e-7
Identity = 63/272 (23.16%), Postives = 108/272 (39.71%), Query Frame = 2
Query: 10373 VFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL--KYCGYILLDEEFQIPSSSFTVEYKSLTGGV--GAGF 11176
              + S D   I+  +G    ++     + +  Y    C  T +  SG + +   F     S+        +TP   +     F   +L +SS C YDYI+   G    +  +L + CG  +     +  SR+ + F +  +    G+   Y         CGGEI  + G I SP +  +Y    EC W I +    ++   F   ++  + S     Y + +    +  N  L  ++CGY   D+   I S+S T+  K ++ G    AGF
Sbjct:  312 TILPSRDDNGIRPAIGQRTRLSKGDIAQARKLYRCPACGETLQESSGNLSS-PGFPNGYPSYTHCIWRVSVTPGEKI--VLNFTTMDLYKSSLCWYDYIEVRDGY-WRKSPLLGRFCGDKVAGVLTSTDSRMWIEFRSSSNWVGKGFAAVY------EAICGGEIRKNEGQIQSPNYPDDYRPMKECVWKIMVSEGYHVGLTFQAFEIERHDSC---AYDHLEVRDGASENSPLIGRFCGY---DKPEDIRSTSNTLWMKFVSDGTVNKAGF 567          

HSP 22 Score: 58.151 bits (139), Expect = 3.000e-7
Identity = 29/100 (29.00%), Postives = 49/100 (49.00%), Query Frame = 2
Query: 8381 YPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADT 8680
            YP   DCEWL+++     ++L+ QT  +E   DC YD++ +       +    + CG  P   E +    +   + FH+D +++K GF I Y  I   +T
Sbjct:  911 YPGQLDCEWLLVSERGSRLELSFQTFEVEEEADCGYDYVEVFDGLSSKAVGLGRFCGSGP--PEEIYSIGDVALIHFHTDDTINKKGFYIRYKSIRYPET 1008          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. UniProt/SwissProt
Match: sp|O70244|CUBN_RAT (Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2)

HSP 1 Score: 952.584 bits (2461), Expect = 0.000e+0
Identity = 959/3749 (25.58%), Postives = 1593/3749 (42.49%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA-NAYTC--GPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR---ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIP--INLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESP-AIPADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHL---------KVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIAI-SFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSV--FDCGGSFFLTNKLI--IGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKRFCGNHAKSG--PTVT---HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEK-LSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIK-----INHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--FPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMA---NFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKV--ILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAK-----VFCGSGVIDSAIFTPPVTLILSAEG-YRYPGFLIRW--------NPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPP-----TNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDD----FSYFRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQ--GC---FRIRARGVGYRSVLLYIICAS-NLENFEIDTKSSMIEVFGSGATISF-----SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYN-IHNYPED---EGTLSMFMSDNTGIPCSNVYFVSKIGNGLRE---PVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM---SNYRVE-----IGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLN---PISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAV---TLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYL---------PGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPN-NSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCES-LSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRF 10981
            PR+ ++ GN++F T+S+++I F T + G+I+LND DL     +I++ +++I    DL+K    L  + L     ++  L       N K+  LE +   +++ +    C++NPC NG  C++ ++SF CICP  +KG  C+EDVNEC+  SGT  GCQ+G+ C NT+GSFRC C+    G  C    N C   S   +C HG C       + +P F C+CD+GW+  P   +C  D DEC +   PCS H    C NT G   C  CP G++GNG+ C DINEC  N   C   P   C+N  G++ C  C  G       +C   ++C  +NGGC   A CS++   + G    +CTC PGY+G+G G NGCV +S N+ +R    CV        G C ++++ + C+C  G+ G  C   IN+ C SNPCLNGG C     N + C C   ++G  C+     CGG  + +        F    P+ +   +  C W + +  ++ L +     +L+   +C  EY+Q+H+      A   +G+YC    S P +   + +  +        I+   GF  +               C    T+      G   SP +P  Y    +C   +Q        +     TL L +  ++CS  DYL+I    F    +    C        K       +HFHSDS  + +   F   +    S   CG   T     ++  P + P      C + I Q    +++               +  +  E+ +     + +I     + L               V N+ +I  +    +    F+   + ACG  +  +      F+S  YP  Y G   C +      R++ + +F DF I   + C  D+I+I  S+      ++++C+ N    IT   N     + +TF  +S+    GF AK S    +CG     +  +I   G+P              Y R   CTW +       I   F  F+LE H NC  DYLE I+D   + F G +      P++T   + + + FVSD++++ EGF + +  +     C   +  + G++++P       +++ C Y I V   ++I ++ T    +   F   C+    ++                  P    I + SN   + +       A  F+   + SS    CG    +  G + SPNYP+    ++ C W + ++ G    ++     + H  S S+D   + +         T  + I+ +C +         +  V +  +  A  + R F + + Q C+    +  +SG +ES N    Y     C+W + +  G+ +      FD+    N     +V + D     + + CGN +     T+ +  + +  +TD      +    +G  +++ T GC           + S   G   S  +PNS   N +C WN +  PG S++L     ++E   +C+    L  +     +   + Q C++      + + S+ +   ++F + +  NG  R F  ++      C   +  S G I SPNYPN Y  N  CSW ++V+    + L I DF+ E        ++  S  N    ++  +CG+     + I +G     N + ++FR+  +  +RGF+A++ E CGG R+  +S+  + SP YPH Y L +  C W + A      + + F     +   N+ +C+ D  + I++G   ++ V+   C  S  HPIIS G+ L V  +  ST     F+A Y   +S+CGG FY  DG+F SP YP   + + +CV+ I +SPG+ + LS   F+ EN+++    DF++IR G N T  L+GR+   S   NY+       S+W+R  S G      + F A++ +I  N      +G +ASP +   Y  ++   W V  ++   +     +  +    +   C   +L IYD  +D        +CG+     +     +T   S++      GFL+ W         PP        G C   +   +    + SP +P        C W I    +  +++ +LS D+E    C Y+   V+   S       +     V CG            Y++    I + +D      GF  S+ K+C   + +   G + + +YP+    N NC++    H L       A+    P      +  C  G   +L                N   CG   P  L    T+ + + V    + S+  +  GF+I Y  K   CGG   +    DS     + N     P   EC W   +PPG  +Q+ FE+   +     C+ S+L   DG+ +  + +     CG T     + +   I  K   D    +  F+ K  I SCGG +    G I S  YP L Y     C W I G     + L+F D +L  +  C+K +   I    +   V+   C NS+   + T  +   + F T+   T  GF+L++     +CGG+   P     S NYP        C W I V   +RI++    L+++    C     I   G+   S LL  +C+  N+ N    + ++M  VF +  +  +     SY S + ++CG  +          ++   N S   YN I +Y  +   E TLS    +N+ I   ++YF+       ++    V +F  G  +   +  F +L      +  P  +V +   SN RVE     I Y F+ CGG+ T   G I SP YP  Y   T C WL+ APE   I LT     LE H  C  D + +R  +   SP   + CG +   PI + +     N++ ++F+++      GF   +     A  C G   +  G+IKSP++P+ +P N RC+WT+   E     ++F   F +  +S   C    +++ +   +   TLL+  CG++ PS PI +S N  + VF ++     +GF A + S CG  ++   G+I+S N       ++ C YLI      L ++     F      D        D +G ++         P   ICG    +   +    +   Y+  + +  ++ F+  Y       ++++     +L++P++  S Y +N    +  +     +  I     D+  S + C +DF+      S  + ++  FCG+ T         + L + F++D S  +   G+  F   T GP  GCGGY+     ++    S D D+NG Y+  L C W I AP    VK+ F  N  +LEG S  G C YD++ I DG      +    CG        +  N +   F +D  ++  GF  T+T V          T+  Q   SP   N   PY       +IAA     + ITV DL++ S  +CS     +QD+     N++ +FC +  +T  VF SS    ++ ++ G + N NS    + Q SY++  CNR      G + +      + Y +NL C + L  P  N     +F +F LE S  C  D+++   G       +L K C + +P    + S+ + + F +D S+  +GY+I +  +   +  CGG +  D G+ T+PGF  +Y  +  C W I   S   +   F
Sbjct:   39 PRMTTEEGNLVFLTSSTQNIEFRTGSLGKIKLNDEDLGECLHQIQRNKDDII---DLRKNTTGLPQNILS----QVHQL-------NSKLVDLERDFQNLQQNVERKVCSSNPCLNGGTCVNLHDSFVCICPSQWKGLFCSEDVNECVVYSGTPFGCQSGSTCVNTVGSFRCDCTPDTYGPQCASKYNDCEQGSK-QLCKHGICEDLQRVHHGQPNFHCICDAGWTTPPNGISCTEDKDECSLQPSPCSEH--AQCFNTQGSFYCGACPKGWQGNGYECQDINECEINNGGCSQAPLVPCLNTPGSFSCGNCPAGFSGDGR-VCTPVDICSIHNGGCHPEATCSSS--PVLGSFLPVCTCPPGYTGNGYGSNGCVRLS-NICSR--HPCVN-------GQCIETVSSYFCKCDSGWSGQNCTENIND-CSSNPCLNGGTCIDGI-NGFTCDCTSSWTGYYCQTPQAACGGILSGTQ-----GTFAYHSPNDTYIHNVNCFWIVRTDEEKVLHVTFTFFDLESASNCPREYLQIHDGD--SSADFPLGRYC---GSRPPQGIHSSANALYFHLYSEYIRSGRGFTARW--------EAKLPECGGILTD----NYGSITSPGYPGNYPPGRDCV--WQVLVNPNSLITFTFGTLSL-ESHNDCS-KDYLEIRDGPFHQDPVLGKFCTSLSTPPLKTTGPAARIHFHSDS--ETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLSGPFSHSRQCVYLITQAQGEQIV---------------INFTHVELESQMGCSHTYIEVGDHDSLLRKICGNETLFPIRSVSNKVWIRLRIDALVQKASFRADYQVACGGMLRGEGF----FRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQIGSSASCDTDYIEIGPSSVLGSPGNEKFCSSNIPSFITSVYN----ILYVTFVKSSSMENRGFTAKFSSDKLECGEVLTASTGIIESPGHPNV------------YPRGVNCTWHVVVQRGQLIRLEFSSFYLEFHYNCTNDYLE-IYDTAAQTFLGRYCGKSIPPSLTSNSNSIKLIFVSDSALAHEGFSINYEAIDASSVCLYDYTDNFGMLSSPNFPNNYPSNWECIYRITVGLNQQIALHFTDFTLE-DYFGSQCVDFVEIRDGGYETSPLVGIYCGSVLP--PTIISHSNKLWLKFKSDAALTAKGFSAYWDGSSTG--CGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLEHHPSCSLDYLAVFDGP------TTNSRLIDKLCGDTTPAPIRSNKDVVLLKLRTDAGQQGRGFEINFRQRCDNVVIVNKTSGILESINYPNPYDKNQRCNWTIQATTGNTVNYTFLGFDVESYMNCST-DYVELYDGPQ-WMGRYCGNNMPPPGATTGSQ-LHVLFHTD-----GINSGEKGFKMQWFTHGC---------GGEMSGTAGSFSSPGYPNSYPHNKECIWNIRVAPGSSIQLTIHDFDVEYHTSCNYDS-LEIYAGLDFNSPRIAQLCSQSPSANPMQVSSTGNELAIRFKTDSTLNG--RGFNASWRAVPGGCGGIIQLSRGEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEAPDSCLRLMDGSSSTN---ARVASVCGRQQPPNSIIASG-----NSLFVRFRSGSSSQNRGFRAEFREECGG-RIMTDSSDTIFSPLYPHNY-LHNQNCSWIIEAQPPFNHITLSFTHFQLQ---NSTDCTRD-FVEILDGNDYDAPVQGRYCGFSLPHPIISFGNALTVRFVTDSTRSFEGFRAIYSASTSSCGGSFYTLDGIFNSPDYPADYHPNAECVWNIASSPGNRLQLSFLSFNLENSLN-CNKDFVEIREG-NATGHLIGRYCGNSLPGNYSS--AEGHSLWVRFVSDGSG--TGMGFQARFKNIFGNNNIVGTHGKIASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDIEPTTN---CFYDSLKIYD-GFDTHSRLIGTYCGTQTESFSSSRNSLTFQFSSDSSVSGRGFLLEWFAVDVSDSTPPT----IAPGACGGFMVTGDTPVHIFSPGWPREYANGADCIWIIYAPDS-TVELNILSLDIEPQQSCNYDKLIVKDGDSD------LSPELAVLCGVSPPGPIRSTGEYMY----IRFTSDTSVAGTGFNASFHKSC-GGYLHADRGVITSPKYPDTYLPNLNCSW----HVLVQTGLTIAVHFEQPFQIQNRDSFCSQGDYLVLRNGPDNHSPPLGPSGRNGRFCGMYAPSTL---FTSGNEMFVQFISDSSNGGQ--GFKIRYEAKSLACGGTVYI-HDADSDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGANSNARLV--SKLCGHTLPHSWVSSRERIYLKFHTDGGSSYMGFKAKYSIASCGGTVSGDSGVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFEDFNLQSSPGCTK-DFVEIWENHTSGRVLGRYCGNSTPSSVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQVCGGDLHGPTGTFTSPNYPNPNPHARICEWTITVQEGRRIVLTFTNLRLSTQPSCNSEHLIVFNGIRSNSPLLQKLCSRVNVTNEFKSSGNTMKVVFFTDGSRPYGGFTASYTSTEDAVCGGFL---------PSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSI---SIYFLELSIESHQDCTFDVLEFRVGDADGPLIEKFCSLSAPTAPLVIPYPQVWIHFVSNERVEYTGFYIEYSFTDCGGIRTGDNGVISSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLEAHPTCTSDSVTVRNGDSPGSPVIGRYCGQSVPRPIQSGS-----NQLIVTFNTNNQGQTRGFYATWT--TNALGCGGTFHSANGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIP-SSDSQCQNSFVKVWEGRLMINKTLLATSCGDVAPS-PIVTSGNIFTAVFQSE-EMAAQGFSASFISRCGRTFNTSPGDIISPNFPKQYDNNMNCTYLIDADPQSLVIL----TFVSFHLEDRSAITGTCDHDGLHIIKGRNLSSTPLVTICGSETLRPLTVDGPVLLNFYS--DAYTTDFGFKISYRAITCGGIYNESSG--ILRSPSYSYSNYPNNLYCVYSLHVRSSRVIIIRFNDFDVAPS-NLCAHDFLEVFDGPSIGNRSLGKFCGS-TRPQTVKSTNSSLTLLFKTDSS--QTARGWKIFFRETIGPQQGCGGYLTEDNQSF---VSPDSDSNGRYDKGLSCIWYIVAPENKLVKLTF--NVFTLEGPSSAGSCVYDYVQIADGASINSYLGGKFCGSRMPAPFISSGNFLTFQFVSDVTVEMRGFNATYTFVDMPCGGTYNATSTPQNASSPHLSNIGRPYST--CTWVIAAPPQQQVQITVWDLQLPSQ-DCSQSYLELQDSVQTGGNRVTQFCGANYTTLPVFYSSMSTAVVVFKSGVL-NRNS----QVQFSYQIADCNREYNQTFGNLKSPG--WPQNYDNNLDCTIILRAPQ-NHSISLFFYWFQLEDSRQCMNDFLEVRNGGSSTSP-LLDKYCSNLLPNPVFSQSNELYLHFHSDHSVTNNGYEIIWTSS---AAGCGGTLLGDEGIFTNPGFPDSYPNNTHCEWTIVAPSGRPVSVGF 3553          

HSP 2 Score: 408.297 bits (1048), Expect = 2.615e-112
Identity = 667/2927 (22.79%), Postives = 1137/2927 (38.85%), Query Frame = 2
Query: 2702 SDNYPQNYSGNSHCVYQFYAETRK-IAISFLDFDINDDSECKFDFIKISGSNSGHLDQ---RYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFR----AKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL-IHDNQTKRFCGNHAK-SGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINITVSE--SDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYM-VPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYY-----TQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEM--SGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSS-RGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNL-VANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYH---PIISNGHYLKVILK--STSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYI-LHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYG-VLASPQFGHVYNQDTEITWTVFAESS-EKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSN-YDAKV---FCGSGVIDSAI-FTPPVTLILSAEGYR-YPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSL-----NNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILN-LTALDLPPPTNGKCVNGFLKIL-AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSG--FQIMYSKKD-----------EECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVIS-RIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILFKNMDDFSYFRLKVKI-GSCGGLLHRRQGYIASPNYPLNYPPISSCIWQI---SGYSYS-NIRLTFMDRDLDENCSKSNLTVI---------PVKES-ENAVIWSNCNSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEY----SDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKK---LKMNQGC----FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSL--CGSNIYPNNNESGVI------TIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGS-IKSPNYP--KPYPSNLRCNWTIHVP--EGYKVSLTFKLPFDLERTSLHTCHYDSL--RIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK-SICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQ----RICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRS-VDIERSYDGCNYDFVXXXXXXXXXXDAIF---CGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVA-FINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRV-GGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYP-NNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYE-----LYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSS---TCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGV--ITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALKYCG 11086
            S  YP NY     CV+Q        I  +F    +   ++C  D+++I      H D    ++C      L T           I F S+S  +  GF        S  DCGG++  T+  ++  P S            +  ++ C + IT      I   F    LES   C++ Y+E+  HD+  ++ CGN       +V++K+ IR   D  V    F   +      Q          G   +P          TC ++I  PQ + +L+N T  +  S  SC         +  +          +N+         I +  N   +T++     +N G   +T  +SS   ECG +  ++ G I SP +P   P    C W +    G+ I ++ +      ++    C +    +    A+  +   C + I         S+ +IF + ++  +  F + Y     +  C +  T + G + S N    Y     C ++++     +I +    F L      QC  FV I D    ++ L+   CG+ +L  T  S +  + ++  +D +  +    A+     +  + GC           + +T  GV+ S  +P     + +C W  +   G   +L+F    +E   +CS    L  ++    +   + + C    D     I+S+     LK  +     G  R F+  +      C++ +  + + GI++S NYPN Y  N RC+W ++     +++   L F+ E  + C  DYVE++    +    +   CG   N +    ++  +++ + F TD   S  +GFK ++F    G  M+  +  F  SP YP+ Y   +  C WN+ VA  S I L I  + + +     + +C+ D SL I  G+  NS   A LC++SP      + S G+ L +  K  ST     F A++      CGG   L  G   SP YPN+   + +C ++I+      + L+I +F  E   S + L D     N     +S+ GR    + I          +S+++R RS  G  + +  F A++         +D    + SP + H Y  +   +W + A+     +  +F  F +    D   C R  + I D N YDA V   +CG  +    I F   +T+    +  R + GF   ++     +    G   Y +       I  SP+YP        C W I +     L +  LSF+LE+S  C  +               F+E       G L      NS    + +   +S+ + + +D      GF+  +K     +      G + +  +P K   N N  +++     + I   +  +D+ P TN  C    LKI    + +  L G+      +   ++ +    +L   FSS+S  SG  F + +   D             CGG        D+ +   +        +  +C W   +P  T ++++   L I  +  CN   L   DG +  + ++           I + G  + I F +    +          SCGG LH  +G I SP YP  Y P  +C W +   +G + + +    F  ++ D  CS+ +  V+         P+  S  N         ST  ++T  + + + F +++    +GFK++Y  +   CGG      +D +  L S NYP        C W +     + I ++ +    ++    C      +R  G    + L+  +C   L +  + ++  +   F +    S+     + S+  CG  +   + +SGVI      T+   N   CQ+ I   P    TLS    +    P     FV    N     V   G  C       S  T   V +  F     V  S +R++       CGG L    G   SP YP   P    CEW I   E   I LT   L L     CN +HL +      +SP  +KLC    ++NE  S   N M++ F +D S    GF   Y     A  C G + +  G    SP Y   + Y  NL C WT+  P  E   +S+ F    +L   S   C +D L  R+ D++   L+ + C    P+ P+     Q+ + F ++      GF+ +Y  + CGG+     G I S N   +      C +L+   E H  +   + +F     H       +  +NG+  PG     R CG+S  +     S  + + +   N   +   F A +  +      +       +K+P++P  +  N+  +W         + I+  S   I  S   C   FV         +  +    CG++   SP +   N+    FQS+    +   GF A FI+        CG   N + G    I S +      Y+NN+ C + I A     V + F   S  LE RS + G C +D + I  G + +   + T+CG + +  +T    V+ L F +D      GFK+++ A+       ++    S +L SP Y  +N P +L  +  L     +  I I   D  +  S  C+ D   + D        + KFC S   + V  ++    ++       +  +S T R ++I +         C       +   V+ ++    +Y   L C   ++ P  N   +  F  F LE  S   +C YDY+Q   G      Y+  K CGS +P  F+++ + ++  FV+D ++   G++ TY     P   CGG     S     +SP           C+W I       ++    D+QL +    + +     D V+   GN+  ++CG
Sbjct:  603 SPGYPGNYPPGRDCVWQVLVNPNSLITFTFGTLSLESHNDCSKDYLEIR-DGPFHQDPVLGKFCT----SLSTPPLKTTGPAARIHFHSDSETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLS----------GPFSHSRQCVYLITQAQGEQIVINFTHVELESQMGCSHTYIEVGDHDSLLRKICGNETLFPIRSVSNKVWIRLRIDALVQKASFRADY------QVACGGMLRGEGFFRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQIGSSASCDTDYIEIGPSSVLGSPGNEKFCSSNI------PSFITSVYNILYVTFVKSSSMENRG---FTAKFSSDKLECGEVLTASTGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFY---LEFHYNCTNDYLEIYDTAAQTFLGRYCGKSIPPSLTSNSNSIKLIFVSDSALAHEGFSINYEAIDASSVCLYDYTDNFGMLSSPNFPNNYPSNWECIYRITVGLNQQIALHFTDFTLEDYFGSQCVDFVEIRDGGYETSPLVGIYCGS-VLPPTIISHSNKLWLKFKSDAALTAKGFSAY----WDGSSTGC---------GGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLEHHPSCSLD-YLAVFDGPTTNSRLIDKLCG---DTTPAPIRSNKDVVLLKLRTDAGQQG--RGFEINFR---QRCDNVVIVNKTSGILESINYPNPYDKNQRCNWTIQATTGNTVNYTFLGFDVESYMNCSTDYVELY----DGPQWMGRYCG---NNMPPPGATTGSQLHVLFHTDGINSGEKGFKMQWFTHGCGGEMSGTAGSFS-SPGYPNSYPH-NKECIWNIRVAPGSSIQLTIHDFDVEY-----HTSCNYD-SLEIYAGLDFNSPRIAQLCSQSPSANPMQVSSTGNELAIRFKTDSTLNGRGFNASWRAVPGGCGGIIQLSRGEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEAPDSCLRLMDGSSSTNA--RVASVCGRQQPPNSI------IASGNSLFVRFRS--GSSSQNRGFRAEFREECGGRIMTDSSDTIFSPLYPHNYLHNQNCSWIIEAQPPFNHITLSFTHFQLQNSTD---CTRDFVEILDGNDYDAPVQGRYCGFSLPHPIISFGNALTVRFVTDSTRSFEGFRAIYS----ASTSSCGGSFYTLDG-----IFNSPDYPADYHPNAECVWNIASSPGNRLQLSFLSFNLENSLNCNKD---------------FVEIREGNATGHLIGRYCGNSLPGNYSSAEGHSLWVRFVSDGSGTGMGFQARFKNIFGNNNIVGTHGKIASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDIEPTTN--CFYDSLKIYDGFDTHSRLIGTYCGTQTESFSSSRN----SLTFQFSSDSSVSGRGFLLEWFAVDVSDSTPPTIAPGACGG---FMVTGDTPVHIFSPGWPREYANGADCIWIIYAPDST-VELNILSLDIEPQQSCNYDKLIVKDGDSDLSPELAVLCGVSPPGPIRSTGEYMYIRFTSDTSVAGTGFNASFHKSCGGYLHADRGVITSPKYPDTYLPNLNCSWHVLVQTGLTIAVHFEQPFQIQNRDSFCSQGDYLVLRNGPDNHSPPLGPSGRNGRFCGMYAPST--LFTSGNEMFVQFISDSSNGGQGFKIRYEAKSLACGGTVYIHDADSDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELR-DGANSNARLVSKLCGHTLPHSWVSSRERIYLKFHTDGGSSYMGFKAKYSIASCGGTV---SGDSGVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFEDFNLQSSPGCTKDFVEIWENHTSGRV--LGRYCGNSTPS-SVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQVCGGDLHGPTGTFTSPNYPNPNPHARICEWTITVQEGRRIVLTFTNLRLSTQPSCNSEHLIVFNGIRSNSPLLQKLCSRVNVTNEFKS-SGNTMKVVFFTDGSRPYGGFTASYTSTEDA-VCGGFLPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIYF---LELSIESHQDCTFDVLEFRVGDADG-PLIEKFCSLSAPTAPLVIPYPQVWIHFVSNERVEYTGFYIEYSFTDCGGIRTGDNGVISSPNYPNLYSAWTHCSWLLKAPEGH-TITLTFSDFL-LEAHPTCTSDSVTVRNGDS-PGSPVIGRYCGQSVPRPIQSGSNQLIVTFNTNN-QGQTRGFYATWTTNALGCGGTFHSANGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEGRLMINKTLLATSCGDVAP-SPIVTSGNIFTAVFQSEEMAAQ---GFSASFIS-------RCGRTFNTSPGD---IISPNFPKQ--YDNNMNCTYLIDADPQSLVILTFV--SFHLEDRSAITGTCDHDGLHIIKGRNLSSTPLVTICGSETLRPLTVDGPVL-LNFYSDAYTTDFGFKISYRAITCGGIYNES----SGILRSPSYSYSNYPNNLYCVYSL-HVRSSRVIIIRFNDFDVAPSNLCAHDFLEVFDGPSIGNRSLGKFCGSTRPQTVKSTNSSLTLL------FKTDSSQTARGWKIFFRETIGPQQGCGGYLTEDNQSFVSPDSDSNGRYDKGLSCIWYIVAPE-NKLVKLTFNVFTLEGPSSAGSCVYDYVQIADGA-SINSYLGGKFCGSRMPAPFISSGNFLTFQFVSDVTVEMRGFNATYTFVDMP---CGGTYNATSTPQNASSPHLSNIGRPYSTCTWVIAAPPQQQVQITVWDLQLPSQDCSQ-SYLELQDSVQTG-GNRVTQFCG 3355          

HSP 3 Score: 335.88 bits (860), Expect = 2.408e-90
Identity = 582/2500 (23.28%), Postives = 987/2500 (39.48%), Query Frame = 2
Query: 1634 CIWTI--ISSNDQFLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNC---SDSDYLQINFVDREIKITACNQNMYFNKKFIV---NRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEA--FCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAET--RKIAISFLDFDINDDSECKFDFIKISGSNS--GHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRA--KVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK----RFCGNHAKSGPTVT--HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKI---LINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNV-CPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLD-----------EECGSIHLS--TMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTA--KKEINIVCSEQITKMHVFEEQSVHVIFQNLASTK-YRFRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQ---------NGQCYSFVRISDRSNTLLKKS------CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFP-NSIANIDCQWNFQTIPGFSVKLKF-DIIEMESSINCSEGPI-LRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNF-YPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY---FETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTK-SPYHPIISNGHYLKVILKSTSGNAI--FKAAY-GVGSSTCGGDF-YLDDGLFTSPFYPNSVN---MDLDCVYVIRNS--PGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSE-IRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRS-DYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGV---IDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLS-FDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEF----NVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNY-ILNLTALDLP--PPTNGKCVNGFLKIL-AMNINKT----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL-VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSYFRLKV----KIG---SCGGLLHRRQGYIASPNYPLN--YPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSN-----CNSSTWDIYTEYST-VRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSW---------FLRCTWKINVDVSKRIIVKVKKLKM-NQGC------FRIRARGVGYRSVLLYIICASNLENFEI--DTKSSMIEVFGSG-----ATISFSYN------------SDQPSLCGSNIYPNNNESGVI--TIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYN 8659
            C WTI   + N      +  +++   +CS +YV+L++          +G+YC   N+ P    TTGS L +            GFK++              H   G  EM+  T G F SP +P  Y  N  C    +   G+   ++L I   D+ +  ++C   S   Y  ++F    I    C+Q+   N   +    N   + F +DS   +N   F   W+       CG  I ++    I SP  P +  A   C+W I+     R++     F+      C ++L     +T+ R+ +    C  R+    + +   N  ++ F+         F+      CG  +  D   T    S  YP NY  N +C +   A+     I +SF  F + + ++C  DF++I   N     +  RYC  +    I    N     + + F ++ST +  GFRA    S   CGGSF+  + +           ++ D    Y  N  C W I +     +   F  F+LE+  NC  D++E+   N T     R+CGN      +    H L +RFVSD S +G    M F    ++ +   +   + G I +P    K   +    + + V  +  I   ++ + + E   +CF        +LKI DG    + +    C T  Q E   +S N+  +T+      +     + + + ++D             CG   ++  T  HI SP +P        C W I + P   + +   +I S  ++  + CN    ++K   +    E+ ++C            + +++ F +  S     F   + + C   + +  G I S      Y     CSW +    G  I +  ++    P Q          G         D  +  L  S      CG    +  FTS N  + ++  +D S      +    I  E ++  C  T Y   H++D    +G + S  +P N   + +C W  +  PG S++L+F D   +E + NCS   + LR   N   +   V + C        +   SS    YLKF +    +GG        +++  SC   +SG  G+I+S  YP   Y +N+ C W ++      + L   DF  + S  C  D+VEI+    +  V L   CG   N   +   + +N   +KF TD +V++ GF+ ++    + CGG  +   +  F  SPNYP+       ICEW +   T + G RI   F      S  P+C+S++ L +  GI +NS +   LC++ +  +   S+G+ +KV+  +        F A+Y     + CGG    +  G F+SP Y N +     +LDC + + N     SSI +   E S E+       D ++ R G +    L+ +F +LS         Y     VWI   S   +   +  F  +Y        R+ D GV++SP + ++Y+  T  +W + A     +  TF  F +     +  C   ++ + + +         +CG  V   I S      VT   + +G +  GF   W          +G C     + N T  + SP++P        C+WT++T  ++  +I   S F + SS      +F   + G         + +    CG +  S      N+F T +F S ++  +        GF  S+   C + F N   G + +  +P +   N NCT+++ +   +  IL   +  L       G C +  L I+   N++ T    +CGS     L+P+  +   ++     NF S++  + F    S +   CGG +     + S I+   S      P+ + C +         + I F +  V    +C   FL  FDG +   + +G   FCG T   ++ +  + LT+LFK     +    K+     IG    CGG L        SP+   N  Y    SCIW I       ++LTF    L+   S  +     V+ ++ A I S      C S     +      +   F ++     +GF   Y F D  CGG Y       N+T+ P+  S          +  CTW I     +++ + V  L++ +Q C       +   +  G R   +   C +N     +   + S+ + VF SG     + + FSY              +  S      Y NN +  +I    +N +ISL  Y      +    ++ F+    G   ++        N L  PV       ++ N +Y            F     V  + Y +      + CGG L    G   +PG+P+ YP+NT CEW I+AP    + +    L ++    C+ ++L +    + +SPPF  LCG+N           NR+ + FH++++   +GF I ++
Sbjct: 1306 CNWTIQATTGNTVNYTFLGFDVESYMNCSTDYVELYD------GPQWMGRYC--GNNMPPPGATTGSQLHVLFHTDGINSGEKGFKMQWF-----------THGCGG--EMSG-TAGSFSSPGYPNSYPHNKECIWNIRVAPGSS--IQLTIHDFDV-EYHTSCNYDSLEIYAGLDFNSPRIA-QLCSQSPSANPMQVSSTGNELAIRFKTDST--LNGRGFNASWRAVPGG--CGGIIQLS-RGEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEAPDSC-LRLMDGSSSTNARVAS---VCG-RQQPPNSIIASGNSLFVRFRSGSSSQNRGFRAEFREECGGRIMTDSSDT--IFSPLYPHNYLHNQNCSWIIEAQPPFNHITLSFTHFQLQNSTDCTRDFVEILDGNDYDAPVQGRYCGFSLPHPIISFGN----ALTVRFVTDSTRSFEGFRAIYSASTSSCGGSFYTLDGIF----------NSPDYPADYHPNAECVWNIASSPGNRLQLSFLSFNLENSLNCNKDFVEIREGNATGHLIGRYCGNSLPGNYSSAEGHSLWVRFVSDGSGTG----MGFQARFKNIFGNNNIVGTHGKIASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDI-EPTTNCF------YDSLKIYDGFDTHSRLIGTYCGT--QTESFSSSRNS--LTFQFSSDSSVSGRGFLLEWFAVDVSDSTPPTIAPGACGGFMVTGDTPVHIFSPGWPREYANGADCIWIIYA-PDSTVEL---NILSLDIEPQQSCNYDKLIVKDGDSDLSPELAVLCGVSPPGPIRSTGEYMYIRFTSDTSVAGTGFNASFHKSCGGYLHADRGVITSPKYPDTYLPNLNCSWHVLVQTGLTIAVHFEQ----PFQIQNRDSFCSQGDYLVLRNGPDNHSPPLGPSGRNGRFCGMYAPSTLFTSGN-EMFVQFISDSSNGGQGFK----IRYEAKSLACGGTVYI--HDAD---SDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGANS--NARLVSKLCGHTLPHSWV---SSRERIYLKFHT----DGGSSYMGFKAKYSIASCGGTVSGDSGVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFEDFNLQSSPGCTKDFVEIWENHTSGRV-LGRYCG---NSTPSSVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQVCGG-DLHGPTGTFT-SPNYPNPNPHAR-ICEWTI---TVQEGRRIVLTFTNLRL-STQPSCNSEH-LIVFNGIRSNSPLLQKLCSRVNVTNEFKSSGNTMKVVFFTDGSRPYGGFTASYTSTEDAVCGGFLPSVSGGNFSSPGY-NGIRDYARNLDCEWTLSNPNRENSSISIYFLELSIESHQDCTF-DVLEFRVG-DADGPLIEKFCSLSAPTAPLVIPYP---QVWIHFVSN--ERVEYTGFYIEYSFTDCGGIRTGDNGVISSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLEA---HPTCTSDSVTVRNGDSPGSPVIGRYCGQSVPRPIQSGSNQLIVTFNTNNQG-QTRGFYATWTT------NALG-CGGTFHSANGT--IKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEGR----LMINKTLLATSCGDVAPSPIVTSGNIF-TAVFQSEEMAAQ--------GFSASFISRCGRTF-NTSPGDIISPNFPKQYDNNMNCTYLIDADPQSLVILTFVSFHLEDRSAITGTCDHDGLHIIKGRNLSSTPLVTICGSET---LRPLTVDGPVLL-----NFYSDAYTTDFGFKISYRAITCGGIYN----ESSGILRSPSYSYSNYPNNLYCVYSLHVRSSRVIIIRFNDFDVAPSNLCAHDFLEVFDGPSIGNRSLG--KFCGSTRPQTVKSTNSSLTLLFKTDSSQTARGWKIFFRETIGPQQGCGGYLTEDNQSFVSPDSDSNGRYDKGLSCIWYIVAPENKLVKLTFNVFTLEGPSSAGSCVYDYVQIADGASINSYLGGKFCGSRMPAPFISSGNFLTFQFVSDVTVEMRGFNATYTFVDMPCGGTY-------NATSTPQNASSPHLSNIGRPYSTCTWVIAAPPQQQVQITVWDLQLPSQDCSQSYLELQDSVQTGGNR---VTQFCGANYTTLPVFYSSMSTAVVVFKSGVLNRNSQVQFSYQIADCNREYNQTFGNLKSPGWPQNYDNNLDCTIILRAPQNHSISLFFYWFQ-LEDSRQCMNDFLEVRNGGSSTSPLLDKYCSNLLPNPV------FSQSNELY----------LHFHSDHSVTNNGYEIIWTSSAAGCGGTLLGDEGIFTNPGFPDSYPNNTHCEWTIVAPSGRPVSVGFPFLSIDSSGGCDQNYLIVFNGPDANSPPFGPLCGIN-TGIAPFYASSNRVFIRFHAEYTTRLSGFEIMWS 3622          

HSP 4 Score: 309.686 bits (792), Expect = 2.064e-82
Identity = 355/1438 (24.69%), Postives = 583/1438 (40.54%), Query Frame = 2
Query: 7046 HFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVL-----TILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNS-STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFF--EDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK--KLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSS--MIEVFGSGATISFSYNSDQPSLCG----------SNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNER---NRMYSF-STLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFI--RYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY---KSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYH-----DNQIQIDLEDQNGNYLPGQRICG-------KSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNV-LIVRFQSD-ISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDS---ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDH-ITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQA----LKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFR 11179
            H + C W   +     + + F    + S   C   +L   DG ++    +G   +CG      I +  N L     +   ++   F+  R + K+  CGG+L    G I SP YP NYPP   C+WQ+     S I  TF    L+   +CSK  L +      ++ V+   C S ST  + T     RI F +++ T+ KGF + Y     D  CGG Y+D + EL         S   +C + I     ++I++     +L+   GC       VG    LL  IC  N   F I + S+   I +         S+ +D    CG          S  YPN                C++ I   P+ +  L  F     G   S      +IG     P    G+  NE+   + + SF +++  ++   F     +    +  +       CG +LT S G I+SPG+P  YP   +C W ++     +I+L   + +LE H +C  D+L I    A+ F      + CG +     +L+ + N ++L F SD +++  GF I Y  I+ +  C     +  G + SPN+P  YPSN  C + I V    +++L F   F LE      C  D + I D    T  L+   CG++ P   I+ S N++ L F +D     +GF A +    + CGG      G + S N  +  Y S  C + +    +H     +    F   +H     D     D    N   +   ++CG       +S + + ++  ++       R F +   NFR R    +NV + +  K   +L++ N+P+PY  N    W   A  G   +      D+E SY  C+ D+V             +CGN  N+ P    T   L V F +D I+  E       F +       GCGG M+ T G++    S    N+  Y +N  C W I    G ++++   +  +          C YD + IY G D   P I  LC      +   +++  N + + F TD  +   GF  ++ AVP     I  ++     + SP YPNN  Y        I   E  H + + + D  + +  +C      + D S     ++   C         I+S + + ++++ G     +S+ +R F+  +      R     S  I +        Y HN  C+  +    P       F +F L+ S+ C  D+++ + G   +   V  + CG S+P   ++  + +++ FVTD + +++G+   Y  +   +  CGG  Y   G+  SP +  +Y+ + EC WNI     + ++  F    L N+ +       N DFV++  GN       +YCG  L          S  V + S   G G GF+
Sbjct:  496 HNVNCFWIVRTDEEKVLHVTFTFFDLESASNCPREYLQIHDGDSSADFPLG--RYCGSRPPQGIHSSANALYFHLYSEYIRSGRGFTA-RWEAKLPECGGILTDNYGSITSPGYPGNYPPGRDCVWQVLVNPNSLITFTFGTLSLESHNDCSKDYLEIRDGPFHQDPVLGKFCTSLSTPPLKTTGPAARIHFHSDSETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLSGPFSHSRQCVYLITQAQGEQIVINFTHVELESQMGCSHTYIE-VGDHDSLLRKICG-NETLFPIRSVSNKVWIRLRIDALVQKASFRADYQVACGGMLRGEGFFRSPFYPN---------AYPGRRTCRWTISQ-PQRQVVLLNFTDFQIGSSASCDTDYIEIG-----PSSVLGSPGNEKFCSSNIPSFITSVYNILYVTFVKSSSMENRGFTAKFSSDKLECGEVLTASTGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYLEFHYNCTNDYLEIYDTAAQTF----LGRYCGKS--IPPSLTSNSNSIKLIFVSDSALAHEGFSINYEAIDASSVCLYDYTDNFGMLSSPNFPNNYPSNWECIYRITVGLNQQIALHFT-DFTLEDYFGSQC-VDFVEIRDGGYETSPLVGIYCGSVLPPTIISHS-NKLWLKFKSDAALTAKGFSAYWDGSSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEA--SHGSPFELEFQDFHLEHHPSCSLDYLAVFDGPTTNSRLI--DKLCGDTTPAPIRSNKDVVLLKLRT-DAGQQGRGFEI---NFRQRC---DNVVIVN--KTSGILESINYPNPYDKNQRCNWTIQATTGNTVNYTFLGFDVE-SYMNCSTDYVELYDGPQWM--GRYCGN--NMPPPGATTGSQLHVLFHTDGINSGEKGFKMQWFTH-------GCGGEMSGTAGSF---SSPGYPNS--YPHNKECIWNIRVAPGSSIQLTIHDFDVEYHTS-----CNYDSLEIYAGLDFNSPRIAQLCSQSPSANPMQVSSTGNELAIRFKTDSTLNGRGFNASWRAVPGGCGGIIQLSRGE--IHSPNYPNN--YRANTECSWIIQVERHHRVLLNITDFDLEAPDSC----LRLMDGSSSTNARVASVCGRQQPPNSIIASGNSLFVRFRSG-----SSSQNRGFRAEFREECGGRIMTDSSDTIFSP--LYPHNYLHNQNCSWIIEAQPPFNHITLSFTHFQLQNSTDCTRDFVEILDGNDYDAP-VQGRYCGFSLPHPIISFGNALTVRFVTDSTRSFEGFRAIYSAS---TSSCGGSFYTLDGIFNSPDYPADYHPNAECVWNIASSPGNRLQLSFLSFNLENSLNC------NKDFVEIREGNATGHLIGRYCGNSLPGNYSSAEGHSLWVRFVSDGSGTGMGFQ 1844          

HSP 5 Score: 275.018 bits (702), Expect = 5.805e-72
Identity = 506/2150 (23.53%), Postives = 823/2150 (38.28%), Query Frame = 2
Query: 5096 FRTDHTVSSRGFKAKYFET-CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKST---SGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYT-LSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLA-KYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEF---NV--FQTYLFNSIKITYKADEFDPFPGF--KLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF--------ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKI---LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEE--CGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRIICNE--SFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKN-----MDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYF--FEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINV-------------DVSKRIIVKVKKLKMNQG-------CFR-IRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCG-SNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLRE-----PVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFR--KLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNG-IIFNTEGSIKSPNYPKPYPSNLRCNWTIHV-PEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNA--VTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK---SICGGVYDLRQGEIVSANVALINYGSITCEYLI---PGWENHLQVVYI---YPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSRE---KITIMHSKSIKIVYTARNFHLKNYNFRARY--LHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF------VAFINPTPGPML--GCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF-TAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVK-----DLKIRSSVNCSLDQFIIQDASLKHENKI------EKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYEL--YTCNRT---EKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGE-CSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKV----SYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGG--VGAGFRI 11182
            F  D T S  G+  +  +  CGG+    +      SPN  +++ +    C W +V    E  L + F F   E  SN P       L I +G  +        C   P   I S+ + L   L S    SG   F A +      CGG    + G  TSP YP +     DCV+ +  +P S I  +    S E+  +    D+++IR+GP     +LG+F T LS     T        +     S+  D   HI +L  +  ++    +    G L  P     ++   +  + +     E++   F    +  ++    C+   + + D +   +  CG    +  +F  P+  + +    R     +        +++    C  +++         SP YPN    RR C WTI   + + + +    F + SS  C  +               +IE       GS  N +F   N+  F T ++N + +T+         GF  K S  K    +      G +++  +PN      NCT+        ++R  F ++ L           +  C N +L+I    A       CG +IPP L     +   I V+      S   + GF I Y   D    C     L  Y D+  +  + N  +  P   EC +  T     ++ + F +  +     ++   F+   DG    +  +G   +CG     +I +  N L + FK+        FS +      G CGG L    G + SPNYP+ Y   S C W++     S   L F D  L+ +  CS   L V     + + +I   C  +T   I +    V +  +T+     +GF++ +    ++ +   + S     L S NYP       RC W I               DV   +      +++  G       C   +   G    S L  +     + + E   K   ++ F  G     S  +   S  G  N YP+N E  +  I     S  Q  IH++  +  T   +  D+  I     +   +I     +     P++   TG     R  + STL          GR  N S   V  G     CGG++  S G I SP YP  Y  NT+C W+I    +  + L I    LE    C      +R  +   S   R   +CG     N  ++   N + + F S  S    GF  E+      + C G I+ ++  +I SP YP  Y  N  C+W I   P    ++L+F   F L+ ++   C  D + I+D N     +    CG   P +PI S  N +++ F TD   + EGF A Y    S CGG +    G   S +     + +  C + I   PG  N LQ+ ++     N   C    N+  +++ + N       R CG S          HS  ++ V       +    F+AR+  +   N  V +  K    + +P +P  Y +N+N  W+ N    +I    +  +DIE + + C YD +         S  I  +CG  T    F    N L  +F SD S   +  GF      V   + TP  +    CGG+M  T  T   I S        Y N   C W I AP         E N +SL+   +   C YD + + DG     P +  LCG      I +    MY+ F++D ++  +GF  +F  +     H  + V      + SP+YP+    +L     ++       +TI V       ++ R S     D  ++++    H   +       +FC   +   +F S  +++ +Q+      + +S   + F+I YE     C  T     A S   +   N+      H     +    P  +++ QF  + FN+E +  C+  Y++   G     + V  K+CG ++P S+V++  R+ + F TD   +Y G+   Y +       CGG +  DSGVI S G+ T  Y +   C W I+ +   Y+   F D  L ++    P C    DFV++    + G    +YCG         + +SS     K +T G    +GFR+
Sbjct:  454 FTCDCTSSWTGYYCQTPQAACGGILSGTQGTFAYHSPNDTYIHNVN---CFW-IVRTDEEKVLHVTFTFFDLESASNCPR----EYLQIHDGDSSADFPLGRYCGSRPPQGIHSSANALYFHLYSEYIRSGRG-FTARWEAKLPECGGILTDNYGSITSPGYPGNYPPGRDCVWQVLVNPNSLITFTFGTLSLESH-NDCSKDYLEIRDGPFHQDPVLGKFCTSLSTPPLKTTGPAAR--IHFHSDSETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLSGPFSHSRQCVYLITQAQGEQIVINFTHVELESQMG---CSHTYIEVGDHDSLLRKICG----NETLF--PIRSVSNKVWIRLRIDALVQKASFRADYQVA--CGGMLRGEG---FFRSPFYPNAYPGRRTCRWTISQPQRQVVLLNFTDFQIGSSASCDTD---------------YIEIGPSSVLGSPGNEKFCSSNIPSFITSVYNILYVTFVKSSSMENRGFTAKFSSDKLECGEVLTASTGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYLEF---------HYNCTNDYLEIYDTAAQTFLGRYCGKSIPPSLTSNSNSIKLIFVS-----DSALAHEGFSINYEAIDASSVC-----LYDYTDNFGMLSSPNFPNNYPSNWECIYRITVGLNQQIALHFTDFTLEDYFGSQCVDFVEIRDGGYETSPLVG--IYCGSVLPPTIISHSNKLWLKFKSDAALTAKGFSAYWDGSSTG-CGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASHGSPFELEFQDFHLEHHPSCSLDYLAVFDGPTTNSRLIDKLCGDTTPAPIRSNKDVVLLKLRTDAGQQGRGFEINFRQRCDNVVIVNKTSG---ILESINYPNPYDKNQRCNWTIQATTGNTVNYTFLGFDVESYMNCSTDYVELYDGPQWMGRYCGNNMPPPGATTGSQLHVLFHTDGINSGE---KGFKMQWFTHGCGGEMSGTAGSFSSPGYPNSYPHNKEC-IWNIRVAPGSSIQLTIHDFDVEYHTSCNY--DSLEIYAGLDFNSPRIAQLCSQSPSANPMQVSSTGNELAIRFKTDSTLN---------GRGFNASWRAVPGG-----CGGIIQLSRGEIHSPNYPNNYRANTECSWIIQVERHHRVLLNITDFDLEAPDSC------LRLMDGSSSTNARVASVCGRQQPPNSIIA-SGNSLFVRFRSGSSSQNRGFRAEFR-----EECGGRIMTDSSDTIFSPLYPHNYLHNQNCSWIIEAQPPFNHITLSFTH-FQLQNST--DCTRDFVEILDGNDYDAPVQGRYCGFSLP-HPIISFGNALTVRFVTDSTRSFEGFRAIYSASTSSCGGSFYTLDGIFNSPDYPADYHPNAECVWNIASSPG--NRLQLSFLSFNLENSLNC----NKDFVEIREGNATGHLIGRYCGNSLPGNYSSAEGHSLWVRFVSDGSGTGM---GFQARFKNIFGNNNIVGTHGK----IASPFWPGKYPYNSNYKWVVNVDAYHIIHGRILEMDIEPTTN-CFYDSLKIYDGFDTHSRLIGTYCG--TQTESFSSSRNSLTFQFSSDSS--VSGRGFLLEWFAVDVSDSTPPTIAPGACGGFM-VTGDTPVHIFSPGWPRE--YANGADCIWIIYAP-----DSTVELNILSLDIEPQQ-SCNYDKLIVKDGDSDLSPELAVLCGVSPPGPIRSTGEYMYIRFTSDTSVAGTGFNASFHKSCGGYLHADRGV------ITSPKYPDTYLPNLNCSWHVLVQTG---LTIAVHFEQPFQIQNRDSFCSQGDYLVLRNGPDNHSPPLGPSGRNGRFCGMYAPSTLFTSG-NEMFVQFI-----SDSSNGGQGFKIRYEAKSLACGGTVYIHDADSDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQ-FNIEDTPNCSVSYLELRDGANSNARLV-SKLCGHTLPHSWVSSRERIYLKFHTDGGSSYMGFKAKYSI-----ASCGGTVSGDSGVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFEDFNLQSS----PGC--TKDFVEIWENHTSGRVLGRYCGN---STPSSVDTSSNVASVKFVTDGSVTASGFRL 2443          

HSP 6 Score: 250.751 bits (639), Expect = 1.382e-64
Identity = 383/1637 (23.40%), Postives = 653/1637 (39.89%), Query Frame = 2
Query: 4472 GVIQSAQFPNS-IANIDCQWNFQTIPGFSVKLKFDI---IEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGK------SIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEM----SGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILD-FETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFE--GGSNNPNCSSDNSLTIIEGIGNNSSVKAV--LCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGD-----FTNHIKFLAKYHINYNTEFRS---------DYGVLASPQFGHV--YNQDTEITWTVFAESSE--KLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV---FCGSGVIDSAIFTP-PVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSK-NPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKK---ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSH-FLNYILNLTALDLPPPTNGKCVNGFLKILA--MNINKTL----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHF-------IECKWHFTSPPGTRMQIDF-----EELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG-KTNSIFTI-GNVLTILFKNM--DDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPL-NYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFM-----CGG-------EYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRI-----IVKVKKLKMNQGC---FRIRARGVGYRSVLLYIICASNLENFEIDTKSSM---------IEVFGSGATISFSYNSDQPSLCG----SNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGT------GCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRII---DSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            GVI S ++P++ + N++C W+     G ++ + F+    I+   S  CS+G  L    N   + +       R  +G+         + +S +  +++F S  D + G + F+  YE  + +C   +    + S+G + SPNYP  YP +  C W L+     SI L+  D F  E++  C   Y+E+    N++   +  LCG     +   + S    + +KF TD   S  GFKAKY   +CGG       +  + S  YP +    +  C+W +       GL   +  + FE     ++P C+ D     +E   N++S + +   C  S    +   SN   +K +   +   + F+  +      CGGD +   G FTSP YPN       C + I    G  I L+          S      I + NG    S LL +  +   + N               +S G       FT+  +    +  +Y +   +           G  +SP +  +  Y ++ +  WT+   + E   +   F + S+    D   C    L     + D  +   FC      + +  P P   I  +S E   Y GF I ++           DC  I   T    +++SPNYPN       C+W +       + +    F LE+   C  ++ TV    S  +P+     Y        + +           N + +T+  +      GF  ++      C   F +   G++++  +P    EN  C++ + +H   ++ ++  +    P ++ +C N F+K+    + INKTL    CG   P    PI+T+ + I   +F   S E    GF   +  +   CG           R  + +   + ++P+F       + C +   + P + + + F     E+       C+   L    G    +  +     CG +T    T+ G VL   + +    DF  F++  +  +CGG+ +   G + SP+Y   NYP    C++ +   S   I + F D D+  +  C+   L V       N  +   C S+    + +  S++ ++FKT++  T +G+K+  FF + +     CGG        +  P+ + N   Y K LS    C W I    +K +     +  ++       C   +   A G    S L    C S +    I + + +         +E+ G  AT +F    D P  CG    +   P N  S  ++      S C + I   P+ +  ++++        CS  Y        L++ V+  G       G N       +S++   V  +F+ G  V   N +V+  Y+ + C     ++FG +KSPG+P+ Y +N DC  ++ AP+N  I L      LE    C  D L +R      SP   K C  N + N   S   N + L FHSD SV+ NG+ I +   + A  C G +   EG   +P +P  YP+N  C WTI  P G  VS+ F  PF L   S   C  + L +    D+N+      LCG      P  +S N++ + F  ++   L GF   + S
Sbjct: 2101 GVITSPKYPDTYLPNLNCSWHVLVQTGLTIAVHFEQPFQIQNRDSF-CSQGDYL-VLRNGPDNHSPPLGPSGR--NGRFCGMYAPSTLFTSGNEMFVQFIS--DSSNGGQGFKIRYEAKSLACGGTVYIHDADSDGYLTSPNYPANYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGANSNARLVSKLCGHT---LPHSWVSSRERIYLKFHTDGGSSYMGFKAKYSIASCGG--TVSGDSGVIESIGYPTLPYANNVFCQWFIR------GLPGHYLTLSFEDFNLQSSPGCTKD----FVEIWENHTSGRVLGRYCGNSTPSSVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQVCGGDLHGPTGTFTSPNYPNPNPHARICEWTITVQEGRRIVLTFTNLRLSTQPSCNSEHLI-VFNGIRSNSPLLQKLCSRVNVTN-------------EFKSSGNTMKVVFFTDGSRPYGGFTASYTSTEDAVCGGFLPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIYFLELSIESHQD---CTFDVLEFRVGDADGPLIEKFCSLSAPTAPLVIPYPQVWIHFVSNERVEYTGFYIEYS---------FTDCGGI--RTGDNGVISSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLEAHPTCTSDSVTVRNGDSPGSPVIG--RYCGQSVPRPIQSGS---------NQLIVTFNTNNQGQTRGFYATWTTNALGCGGTFHS-ANGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEGRLMINKTLLATSCGDVAP---SPIVTSGN-IFTAVFQ--SEEMAAQGFSASFISR---CG-----------RTFNTSPGDI-ISPNFPKQYDNNMNCTYLIDADPQSLVILTFVSFHLEDRSAITGTCDHDGLHIIKGRNLSSTPL--VTICGSETLRPLTVDGPVLLNFYSDAYTTDFG-FKISYRAITCGGIYNESSGILRSPSYSYSNYPNNLYCVYSLHVRSSRVIIIRFNDFDVAPSNLCAHDFLEVFDGPSIGNRSLGKFCGSTRPQTVKSTNSSLTLLFKTDSSQTARGWKI--FFRETIGPQQGCGGYLTEDNQSFVSPDSDSNG-RYDKGLS----CIWYIVAPENKLVKLTFNVFTLEGPSSAGSCVYDYVQIADGASINSYLGGKFCGSRMPAPFISSGNFLTFQFVSDVTVEMRGFNATYTFV---DMP--CGGTYNATSTPQNASSPHLSNIGRPYSTCTWVIAAPPQQQVQITVWDLQLPSQDCSQSYLE------LQDSVQTGGNRVTQFCGANYTTLPVFYSSMSTAV-VVFKSG--VLNRNSQVQFSYQIADCNREYNQTFGNLKSPGWPQNYDNNLDCTIILRAPQNHSISLFFYWFQLEDSRQCMNDFLEVRNGGSSTSPLLDKYCS-NLLPNPVFS-QSNELYLHFHSDHSVTNNGYEIIWT--SSAAGCGGTLLGDEGIFTNPGFPDSYPNNTHCEWTIVAPSGRPVSVGF--PF-LSIDSSGGCDQNYLIVFNGPDANSPP-FGPLCGINTGIAPFYASSNRVFIRFHAEYTTRLSGFEIMWSS 3623          

HSP 7 Score: 218.394 bits (555), Expect = 7.900e-55
Identity = 238/978 (24.34%), Postives = 406/978 (41.51%), Query Frame = 2
Query: 8309 KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLR-QGEIVSANVALINYGSITCEYLIPGWENHLQVVYI-YPNF-FGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHD--ENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMI-DTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINY--DGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYG-----NQALKYCGYILLDEEFQIPSSS--FTVEYKSLTGGVGAGFRISWSPV 11197
            K   CGG+LT+++G I SPGYP  YP   DC W ++   N +I  T  TL LE H DC+ D+L IR       P   K C    +S   L       R+ FHSD   S  GF I Y        C G   +T+G +  P    P+  + +C + I   +G ++ + F     +E  S   C +  + + D ++  LL ++CGN     PI S  N++ +    D       F A Y+  CGG+  LR +G   S        G  TC + I   +   QVV + + +F  G     +   I++   +    PG      S     I    +I  V   ++  ++N  F A++  D  E  +V +      ++++P  P+ Y    N TW      G +  +   S  +E  Y+ C  D++     ++ +    +CG   +I P +  ++N + + F SD +    H GF           +    Y +     +G++ S +  NN  Y +N  C ++I       + + F + ++        G    D + I DG     P++   CG     +I + SN ++L F +D  +   GF   +    S       +T  + +L SP YP    +       L A++ +    +  +D  +    +CSLD   + D    +   I+K C   +T     S+ D V+++ +    +       R F+I++     N      +  I+   N+    Y  N  CN T+     N    + F  F++E    C+ DY++   G     +Y     CG+++PP   T  S++ ++F TD  IN    G+ + +  +      CGGE+   +G  +SPG+  +Y  + EC WNI++   S I+    D  +  +TS       N D +++  G      +  + C         Q+ S+     + +K+ +   G GF  SW  V
Sbjct:  586 KLPECGGILTDNYGSITSPGYPGNYPPGRDCVWQVLVNPNSLITFTFGTLSLESHNDCSKDYLEIRDGPFHQDPVLGKFC--TSLSTPPLKTTGPAARIHFHSDSETSDKGFHITYLTTQSDLDCGGNYTDTDGELLLPPLSGPFSHSRQCVYLITQAQGEQIVINFT---HVELESQMGCSHTYIEVGDHDS--LLRKICGN-ETLFPIRSVSNKVWIRLRIDALVQKASFRADYQVACGGM--LRGEGFFRSPFYPNAYPGRRTCRWTIS--QPQRQVVLLNFTDFQIGSSASCDTDYIEIGPSSVLGSPGNEKFCSSNIPSFITSVYNILYVTFVKSSSMENRGFTAKFSSDKLECGEVLT--ASTGIIESPGHPNVYPRGVNCTWHVVVQRGQLIRLEFSSFYLEFHYN-CTNDYLEIYDTAAQTFLGRYCGK--SIPPSLTSNSNSIKLIFVSDSA--LAHEGFSINYEAIDASSVCLYDYTD----NFGMLSSPNFPNN--YPSNWECIYRITVGLNQQIALHFTDFTL----EDYFGSQCVDFVEIRDGGYETSPLVGIYCGSVLPPTIISHSNKLWLKFKSDAALTAKGFSAYWDG--SSTGCGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASHGSP-FELEFQDFHLEHHPSCSLDYLAVFDGPTTNSRLIDKLCGD-TTPAPIRSNKDVVLLKLRTDAGQQ-----GRGFEINFRQRCDNVVIVNKTSGILESINYP-NPYDKNQRCNWTIQATTGNT-VNYTFLGFDVESYMNCSTDYVELYDGPQWMGRY-----CGNNMPPPGATTGSQLHVLFHTD-GINSGEKGFKMQWFTH-----GCGGEMSGTAGSFSSPGYPNSYPHNKECIWNIRVAPGSSIQLTIHDFDVEYHTSC------NYDSLEIYAGLDFNSPRIAQLCSQSPSANPMQVSSTGNELAIRFKTDSTLNGRGFNASWRAV 1506          

HSP 8 Score: 142.895 bits (359), Expect = 4.990e-32
Identity = 297/1474 (20.15%), Postives = 558/1474 (37.86%), Query Frame = 2
Query: 1523 ENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQII---PINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNH-GFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFP-LKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPAD--VEAFCTWKIKQTNSSRLIRLKGTFENW---------------FDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRK---IAISFLDFDINDDSECKFDFIKIS-GSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-----RFCGNHA-KSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILI----NITVSESDGSC---FAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN--HIRSGSVDETKLCNDKNPVLKF--VTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYRFRLYYTQ-DCEFPITSSSGRIESKNEMLR------YCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDR---SNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN------IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSC--EHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSE-IGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPII--SNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLG 5740
            E + + CGGT  + +   +  L +   P+ +   H  CIW + +   + +Q+      N++   +CS  Y++L + +       L+ K C   ++ P  + ++   + +K    T+   ++ GFK K            C    +G +       G+ +S  +P L Y  N+ C    +   G    +  +    D     S     D+++I  N     +    C  +   +     N   V F +D     +  R QF+  + +    CG  +   P     SP  P        C W I      R++    TF N                F+G  S    + ++ +   + N F +       S N +KV   F+    +  G  T  +  + +  CG  +       +     N  ++Y+ N  C +      R+   I+I FL+  I    +C FD ++   G   G L +++C+ +      +       ++ I F SN     TGF  + S  DCGG     N +I          S+ +    Y     C+W +       I   F  F LE+HP C  D + + + +        R+CG    +   + +++L++ F ++N     GF   + T      C  +F S++G I +P   +    +  C +++   + K   I    N  +  SD  C   F     G+  +     A       +V P+      I TS N  T  +   +    G F+     +S    CG    ++ G I SPN+P     N  C + I + P   +++     H+   S       +D   ++K   +++   + I  SE +  + V +   +   + +  +T + F++ Y    C      SSG + S +          YC + L       I+I+ + FD+ P  N   + F+ + D     N  L K CG+    +T  S+N  + +   TD S  +   +      +  Q QGC            Y T++   QS   P+S +N      + C W         VKL F++  +E     S G  +  +  +I D   +         G  +     +   +L F   +D    MR F  TY F +  C   +  + +     SP+  N       C+W +       + + + D +     C   Y+E+   +     ++   CG     +   +SS++  +++ F++   V +R  + ++ ++     R   ++   L SP +P  Y   D   +  ++    +   + +FFY+   E   ++  C +D  L +  G  + S +    C+    +P+   SN  YL      +  N  ++  +   ++ CGG    D+G+FT+P +P+S   +  C + I    G  + +     S +++      +++ + NGP+  S   G
Sbjct: 2211 EAKSLACGGTVYIHDADSDGYLTSPNYPA-NYPQHAECIWILEAPPGRSIQLQFEDQFNIEDTPNCSVSYLELRDGA--NSNARLVSKLC--GHTLPHSWVSSRERIYLK--FHTDGGSSYMGFKAKY-------SIASCGGTVSGDS-------GVIESIGYPTLPYANNVFCQWFIRGLPGHYLTLSFE----DFNLQSSPGCTKDFVEIWENHTSGRVLGRYCGNSTPSSVDTSSNVASVKFVTDGSVTASGFRLQFKSSRQV----CGGDL-HGPTGTFTSPNYPNPNPHARICEWTITVQEGRRIVL---TFTNLRLSTQPSCNSEHLIVFNGIRSNSPLLQKLCSRVNVTNEFKS-------SGNTMKVV--FFTDGSRPYGGFTASYTSTEDAVCGGFLPSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIYFLELSIESHQDCTFDVLEFRVGDADGPLIEKFCSLSAPTAPLV---IPYPQVWIHFVSNERVEYTGFYIEYSFTDCGGIRTGDNGVI----------SSPNYPNLYSAWTHCSWLLKAPEGHTITLTFSDFLLEAHPTCTSDSVTVRNGDSPGSPVIGRYCGQSVPRPIQSGSNQLIVTFNTNNQGQTRGFYATWTTNALG--CGGTFHSANGTIKSPHWPQTFPENSRCSWTVITHESKHWEISFDSNFRIPSSDSQCQNSFVKVWEGRLMINKTLLATSCG---DVAPS-----PIVTSGNIFTAVFQSEEMAAQG-FS-----ASFISRCGRTFNTSPGDIISPNFPKQYDNNMNCTYLIDADPQSLVILTFVSFHLEDRSAITGTCDHDGLHIIKGRNLSSTPLVTICGSETLRPLTV-DGPVLLNFYSDAYTTDFGFKISYRAITCGGIYNESSGILRSPSYSYSNYPNNLYCVYSLHVRSSRVIIIRFNDFDVAP-SNLCAHDFLEVFDGPSIGNRSLGKFCGST-RPQTVKSTNSSLTLLFKTDSSQTARGWKIFFRETIGPQ-QGC----------GGYLTEDN--QSFVSPDSDSNGRYDKGLSCIWYIVAPENKLVKLTFNVFTLEGP--SSAGSCVYDYV-QIADGASINSYLGGKFCGSRMPAPFISSGNFLTFQFVSDVTVEMRGFNATYTFVDMPCGGTYNATSTPQNASSPHLSNIGRPYSTCTWVIAAPPQQQVQITVWDLQLPSQDCSQSYLELQDSVQTGGNRVTQFCGANYTTLPVFYSSMSTAVVV-FKSG--VLNRNSQVQFSYQIADCNREYNQTFGNLKSPGWPQNY---DNNLDCTIILRAPQNHSISLFFYWFQLE---DSRQCMND-FLEVRNGGSSTSPLLDKYCSNLLPNPVFSQSNELYLHFHSDHSVTNNGYEIIWTSSAAGCGGTLLGDEGIFTNPGFPDSYPNNTHCEWTIVAPSGRPVSVGFPFLSIDSS-GGCDQNYLIVFNGPDANSPPFG 3583          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. UniProt/SwissProt
Match: sp|Q9TU53|CUBN_CANLF (Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1)

HSP 1 Score: 897.116 bits (2317), Expect = 0.000e+0
Identity = 930/3723 (24.98%), Postives = 1580/3723 (42.44%), Query Frame = 2
Query:  140 QPNSID-DSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA-NAYTCG--PNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIPINLQL--LGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITACNQNMYFNKKFIVNRFM-VHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESP-AIPADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLK-VENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIAI-SFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKRFCGNH-AKSGP----TVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEKLSNS-FTCFYSIKVPQFKKILI---NITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFV-------TAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--FPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQG-GDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQ-CNRGNLIIYDS----NYDAKVFCGSGVIDSAIFTPPVTLILSAEG-YRYPGFLIRW------NPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYSTVRII-FKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGCFRIRA---RGVGYRSVLLYIICASNLENFEIDTKSSMIEV--FGSGAT----ISFSYNSDQPSLCGSNI--YPNNN--ESGVITIENVNISL-CQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM---SNYRVE-IG----YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL-NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRI---IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYH--------DNQIQIDLEDQNGNYLPGQRICGKS-REKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTN-VLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNI 10945
            Q  SID   PR+ ++ GN++F   S+++I F T + G+I+LN+ DL     +I+K + +I    DLK+     +N    I S +I  L       N K+  LE +   +++ +    C++NPC NG  C++ ++SF CICP  +KG  C+ DVNEC   SGT  GCQNGA CENT GS+ C+CS +  G  C    + C   S   +C HG C         +P + C+CD+GW+    +  C+ DIDEC +   PCS  P V C NT G   C  CP G++GNG++C DI+EC  N   C   P   CVN  G+Y C+      +    +C + ++C  NNGGC   A+CS+    +   +CTC PGY+G+G G NGC  +S    +           C NG  C ++++G+ C+C  G+ G  C   IN +CLSNPC NGG C     N + C C   ++G  C+    VCGG+ +  +       F+ + P         C W I + + + L+I     QL  + +C  E++Q+H+      A   +G++C   +  P    ++ + L        + +   GF I+        +  +C     G       T G  +SP +P  Y    +C   +Q        +     TL L +   +CS  DYL+I    + ++  +      +          F  VHFHSD++  +N   F   +  + S   CG   T +P  ++ S  + P      C + IKQ    + I++  T     +G  S   S  E+     +       +T       H+K + N  +I  K    +    F+   + ACG  +  + +     +S  YP  Y G   C +  +    ++ I +F  F I   + C  D+I+I  S+      +++YC  +    IT   N     + + F  +S+    GF AK S  D      LT    I     H N         Y     CTW I       I  +F +FHLE H NC  DYLE ++D  +  + G +  KS P    + T+ L + FV+D+ ++ EGF++ +        C E +  +SG  T+P       + + C Y I V   ++I +   N  + E+ G      C+         G   S  +   C + P    I + SN   + +    +  +G   ++  +      CG    +  G   SP+YP+    ++ C W ++++ G    ++         ++  L +  N  L ++       T+   ++ +C  +   +      S+ + F+     +   F   Y Q C     +  + G +ES +    Y     C+W + +  G+ +      F+L    N     ++ + D    +  + CG  +   T +++   +++  YTD   H       +G  +++   GC           + S   G   S  +PN+   N +C W   T PG S++L     ++E    C+   +L  +         + Q C++      + + S+ +   ++F + +  NG  R F  +++     C        G I SPNYP+ Y  N  CSW ++V+ +  I L   DF+ E    +   +  +  +++   +L  +CG+    +    +S  N + ++F++  +   RGF+A++ + CGG  +   S   + SP +P  Y  P+   C W + A      + + F   G E  +    C+ D  L I++G  +++ ++   C  S  HPI   S+   L+ +  S   +  F A Y   SS CGG F++ +G+F SP YP     +++CV+ I +SPG+ + LS   F  E++      DF+++R G N T  L+GR+     +    Y+      +WIR  S G G  T       K  I  N      +G +ASP +   Y  ++   W V   +++ +     +  +    +  Q C    L +YD     +     +CG+     +     +T   S++      GFL+ W        P+       G C   ++  +    L SP +P        CTW I    +  +++ +LS D+E+   C Y+   +   G  N     +     V CG            Y+F    I + +D      GF  S+ K+C   + +   G + + +YP     N NC++ +L    L   ++       P  +  C  G   +L                N   CGS     L    T+ + + V    + S+  +  GF+I Y  K   CGG   +     +  V  +    +  P   +C W   +PPG  +++ FE+   +     C  ++L   DG  +    +     CG++  +S  + G V+ + F++ +  +   F++K  I  CGG +  + G I S  YP L Y   S C W + G S   + + F D  L     C K  + +     S N ++   C ++  D     S V ++ F T+   T  GF+L++      CGGE   P     S NYP        C W+I V   +RI +    L++  +  C+        G+   S  L  +C S   + EI +  + ++V  F  G+      S +Y S + ++CG ++  +P  N    G   + N + +L C++ + N  +   ++ +   D          F  +     +  V +F  G  +   M+      K +  +  P  EV +   +N  VE +G    Y F+ CGG+     G I SP YP  Y   T C WL+ AP+   I LT     +E H  C +D + +R      SP   + CG  NP    T+    N++ + F+SD SV   GF   +N       C GI+ +  G+I+SP++P+ +P N RC+WT+   E  ++ ++F   F +       C    +++    +  A +LL+  CGN+ P + I +  N    VF +      +GF A + S CGG +    G I+S N       ++ C Y+I    + L VV +    F             ++ + I +   N +  P   +CG      +TI+    +       N H  +  F+  Y       VF+      V+K+P +  S Y +N    +        +  +     D+  S   C+ D+++    S+ S   +  FCG  +N+ P +  +N  +++ F++D   ++   G+      T GP  GCGGY+  +  T+    S D D+NG Y+ NL C W I AP    +K+ F  N+ +LE +S +  C YD++ +YDG      +  T CG        +  N + + F +D  +++ GF  T+T V          T   Q + S    +N    L      + A     + ITV  L++ S  +C  +    +D+   + +   + C  + S    F SS    I+ ++    E +N   + R   +Y++  CNR      G + +        Y +NL C + L  P  N     +F  F +E SS C +D+++   G       +    CG+ +P    + ++++ + F TD + +  GY+I +     PS  CGG +Y DSG  TSPG+   Y  + +C W I
Sbjct:   30 QKRSIDFQQPRMATERGNLVFLVGSAQNIEFRTGSLGKIKLNEEDLGECLHQIQKNKEDIT---DLKR---SAVNVPQNI-SSQIHQL-------NSKLVDLERKFQSLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPSQWKGPLCSVDVNECQIYSGTPLGCQNGATCENTAGSYSCLCSPETHGPQCASKYDDCEGGSKA-LCVHGICEDLVRVKADEPKYNCICDAGWTSPLNSSACVLDIDECNLQHAPCS--PLVQCFNTQGSFYCGACPTGWQGNGYSCQDIDECKINNGGCSVVPPVMCVNTLGSYHCQACPPGYQGDGRVCTVIDICSVNNGGCHPEASCSSVLGSLP--LCTCLPGYTGNGYGPNGCAQLSDTCLSHP---------CLNG-QCIETVSGYLCKCESGWAGINCTENIN-ECLSNPCFNGGTCVDGV-NAFSCECTRFWTGFLCQIPQQVCGGSLSGMD-----GSFSYMSPDVGYVHDVNCFWVIRTEDRKVLRITFTFFQLESVNNCPHEFLQIHDGD--SSAALQLGRFC--GSVLPHELLSSNNALYFHL-YSEHFRSGRGFTIR-----WETQQPECGGILMG-------TYGSIKSPGYPGNYPPGRDCV--WQVVTSPDLLITFTFGTLSL-EHHDDCS-KDYLEIRDGPLYQDPSLGKFCTTLSVPPLQTTGPFARVHFHSDNQ--INDQGFHITYLTSPSDLHCGGNYT-DPEGLLSSDLSGPFTHNRQCIYIIKQPLGEQ-IQVNFTHVE-LEGQSSCSQSHIEVRDDKILLGKVCDNETLP-----HIKSIRNHIWIRLKIDASLVRASFRAVYQVACGGELTGEGV----IRSPFYPNVYPGERICRWTIHQPQSQVVILNFTAFGIESSAHCDTDYIEIGSSSILGSPENKKYCGTDIPLFITSVYN----FLYVIFVKSSSTENHGFMAKFSAADLACGEILTESTGIIQSPGHPN--------IYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYNCTNDYLE-VYDTGSNTYLGRYCGKSIPPSLTSSTNSLKLIFVADSDLAYEGFLINYEATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQQIALHFTNFALEEAIGG----QCVADFVEIRDGGYETSPPLGTYCGSIPP-PRIISHSNKLWLQF-TSDFLGSGP-GFSAYWDGSLTGCGGNITTPTGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEF--------EDFHLEHHPNCTLDYLAVYDGPSTSSHLLSQLCGNEKPPVIRSTGDSMFLKFRTDEDQQGGGFLAKYQQTCRNVVIVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFLAFELENHINCST-DYLELYDGPRRM-GRYCGADM-PPTGSTTGSKLQVLFYTDGVGHQ-----EKGFQMQWFIHGC---------GGELSGTTGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVEYHARCNFD-VLEVYGGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSING--RGFNASWQAVPGGCGGIFQAPNGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEP---QDSCITAYDGLSSTTTRLASVCGRQQ--LTNPITSSGNSLFLRFQSGPSRQGRGFRAQFNQVCGG-HILTNSFDTISSPLFPAKY--PNNQNCSWVIQAQPPFNHITLSFDHFGLESSTT---CTQD-FLEILDGDYDDAPLRGRYCGHSMPHPITSFSSALTLRFVSDSRVNSDGFHATYAASSSACGGTFHMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQD-CSRDFVEVREG-NATGHLVGRY--CGNVLPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTK--IFGNDNIVGTHGKIASPLWPGRYPHNSNYQWIVNVNATQVIHGRILEIDI----EGAQSCYYDKLRVYDGLGIHSRLIGTYCGTQTTSFSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPT--IATGACGGFLRTGDAPVFLFSPGWPESYSNSADCTWLIQAPDS-TVELNILSLDIEAQRTCDYDKLVIR-DGDSN-----LAPQLAVLCGREIPGPIRSTGEYMF----IRFTSDFSITGAGFNASFHKSC-GGYLHADRGIITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSRPSSTL---FTSDNQMFVQFISDGSNGGQ--GFKIKYEAKSLACGGNIYIHDVNSAGYV-TSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNIEETPNCVSNYLELRDGVDSNAPLLA--KLCGRSLPSSQLSSGEVMYLRFRSDNSSTQVGFKIKYAIAQCGGRVTGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCEKDFVEIWENHTSGN-LLGRYCGNTIPDSIDTSSNVALVRFVTDGSVTASGFRLRFESSMEACGGELQGPTGTFTSPNYPNPNPHGRVCEWRIMVQEGRRITLTFNNLRLEAHPSCYSEHVTIFNGIRNNSPQLEKLCGSVNASSEIKSSGNTMKVVFFTDGSRPFGGFSATYTSSEDAVCGGSLTHFPEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFED----------FYLESHQDCQFDVLEFRVGNADGPLMWRLCGPSKPIVPLVIPYPEVWIHFVTNEHVEHVGFHAEYSFTDCGGIQLGESGVIASPNYPASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHATCAWDSVSVRNGGSPGSPIIGQYCGTSNP---RTIQSGSNQLVVIFNSDHSVQNGGFYATWN--TQTLGCGGILHSDNGTIRSPHWPQNFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQ-CQNSFVKVWAGTEEVAESLLATGCGNVAPGS-ILTPRNVFIAVFQSQ-ETPAQGFSASFVSRCGGNFTNPSGYILSPNYPRQYDNNMNCTYIIEA--DPLSVVLLTFESFHLEARSAITGSCANDGVHI-IRGSNLSSTPFATVCGNEILSPVTILGPVLLNFY---SNAHTTDLGFKFNYKITSCGGVFN--VSTGVIKSPAYSYSDYPNNIYCLYTIVGRDDRVVQLKFSDFDVVPS-TFCSQDYLAIYDGSNISDPLLGKFCG--SNLPPNIKSSNHSMLLVFKTD--SFQTARGWKITFQQTLGPQQGCGGYLTGSDNTF---ASPDSDSNGRYDKNLNCVWFIIAPVNKLIKLTF--NTFALEAQSAMQRCIYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFVSDVTLEREGFNATYTTVDMPCGGTYNATWTPQSISS-PNSSNPEVPLSMCMWFLEAPPHQQVKITVWALELHSQ-DCDQNYLEFRDSPESNGSPGPQICGRNASATPTFYSSRSTAIVIFK---SEVLNR--NSRVGFTYQIAGCNREYNKAFGNLKSPG--WPDNYDNNLDCTVILTAPQ-NHTISLFFHSFGIEDSSECTHDFLEVRNGSDSSSP-LFGTYCGTLLPDPIFSRNNKLYLRFKTDSATSNRGYEIVWT--SSPS-GCGGTLYGDSGSFTSPGYPGTYPNNTDCEWAI 3538          

HSP 2 Score: 469.544 bits (1207), Expect = 5.928e-131
Identity = 693/2971 (23.33%), Postives = 1143/2971 (38.47%), Query Frame = 2
Query: 1634 CIWTIISSNDQ--FLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITA-CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVEAF-CTWKIKQTNSSRLIRLKGT---FENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHD-NQTKRFCG-NHAKSGPTVTHKLVIRFVSDNSVSGE-GFIMRFYTVKRDQYCYESFESSSGLITNPTLEKL--SNSFTCFYSIKVPQFKKILINITVSESDGSCFA------IPCLGQATLKXXXXXXXXXXXXNVCPTCPQRE-----EIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCS-EQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPI------TSSSGRIESKNEMLRYCSWKLSSLRG-SKILIQIDKFDLPPLQNGQC-YSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSST---HNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE--------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVG-SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEE-FSRENAISYILH-DFIDIRNGPNETSSLLGRFYTLSEI---RNYTYNYKFNDSVWIRLRSQG--GDFTNHIKFLAKYHINYNTEFRSDY---GVLASPQFGHVYNQDTEITWTVFAESSEKLQFTF-DQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDI-TRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIK-----------ITYKADEFDPFPGFKLSYK---KACYKDFRNPLEGSLQNVEYPNKIFENKNCTF---ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNIN-KTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESR-YSGFQIMY-SKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSP--PGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIG---NVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVK---KLKMNQG-C----FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENV-----NISLCQYNIHNYPEDEGTL---SMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKV-VNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYP-EKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEY-NFINPADTCNGIIFNTEGSIKSPNYPK--PYPSNLRCNWTIHVPEGYKVSLTFKLPFDLE-RTSLHTCHYDSLRIIDSNA--VTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI---CGGVYDLR---QGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQI-DLEDQNGNYLPGQRICGKSREKI-TIMHSKSIKIVYTARNFHLKN----YNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXD--AIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCG-DDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTF 10096
            C WTI     Q   L      ++    C  +Y+++   S      N   KYC      P    +  + L +   +K++  +NHGF  K    ++A        C    TE T    G+ QSP  P  Y   INC      + G    + L  +   L +   NC++ DYL++        +   C +++  +     N   + F +DS  D+    F   ++   +   C    T N                + C ++I    +S+ I L  T    E    G C       EI   G   +  +      +     +   N+ ++ F      S P F      +   CG ++      T  F S +YP  Y  +S C +   A       + F DF +     C  D++ +    S S HL  + C GN+   +  ++ D    + + F+++    G GF AK             N +I+      L    Y     Y  N+ C W I       + Y F  F LE+H NC+ DYLEL     +  R+CG +   +G T   KL + F +D     E GF M+++       C      ++G  ++P        N    +Y    P      I +T+ + D    A      +   G                  +   C QR      ++ ++ N   I +      N   FN   ++ ++   CG I  +  G I SPNYP     NT C W IR     RIL+          D      D        +    +  VC  +Q+T        S+ + FQ+  S + R FR  + Q C   I      T SS    +K    + CSW + +    + I +  D F L    +  C   F+ I D       L  + CG+  +    TS +  + +   +D   +S+   A         +  C  TF+            G+  S  +P    +N++C WN  + PG  ++L F   ++E S +CS   +      E+ + N       R   G  + +  S+   H  +++F S  D +G    FQ T  FT       + G+ G I SP +P  YPHN    W + V  +  IH +IL+ + E +  C YD + ++  +      +   CG       T FSS  N +  +F +D +++ +GF  ++F                CGG     ++  FL SP +P  Y+     C W + A  S + L I    +          C  D  L I +G  N +   AVLC +    PI S G Y+   ++ TS  +I  A +      +CGG  + D G+ TSP YP + + +L+C + +    G +I +  E+ F   +  S     D++ ++NGP+  S  LG +         R  +  +  ++ ++++  S G  G     IK+ AK        +  D    G + SP   + Y Q  +  W + A   + ++  F DQF++    +   C    L + D  + +A +    CG  +  S + +  V  +   S       GF I++          I  C    + T Q+ I+ S  YP        FC W +       L I    F L++S  C+ +               F+E          N++  N+   Y  N+I            + +  D      GF+L ++   +AC  + + P  G+  +  YPN     + C +   +     +    N   L+  P    + V  F  I   +   + LCGS    +    I +S   +  +F  F+  SR + GF   Y S +D  CGG   LT + +        N +      + C+W  ++P    + + I FE+  + S   C    L F  G+            CG +  I  +      + I F   +   +  F  +     CGG+     G IASPNYP +Y  ++ C W +       I LTF D D++++  C+  +++V       + +I   C +S    I +  + + +IF ++      GF   +  +   CGG        + S ++P+      RC+W +    SK++ +      ++    G C     ++ A        LL   C +      +  ++  I VF S  T +  +++   S CG N     N SG I   N      N   C Y I   P     L   S  +   + I  S       I  G       F T C     +   + LG V +NF        + ++   +  YK + CGG+   S G IKSP Y    YP+N  C + I+  ++ ++QL      +     C+ D+L I        P   K CG N   N   S H   M L F +D   +  G+ I +   + P   C G +  ++ +  SP+      Y  NL C W I  P    + LTF   F LE ++++  C YD +++ D ++    L    CG+  P+ P  SS N +++ F +D     EGF+A Y ++   CGG Y+     Q      +       S+   +L       +++              N ++  D  + NG+  PG +ICG++     T   S+S  IV        +N    + ++    + E  K F +      LK+P +P  Y +N + T I  AP  +  S+   S  IE S + C +DF+     S +SS     +CG L    P     N L +RF++D +   ++ G+      +P    GCGG +    G++           G Y NN  C+W I AP G  V V F   SI        G C  +++ +YDGPD+  P     CG D  +      S+ +++ F  ++ +  S  +LT+
Sbjct:  838 CRWTIHQPQSQVVILNFTAFGIESSAHCDTDYIEIGSSSILGSPENK--KYC--GTDIPLFITSVYNFLYV-IFVKSSSTENHGFMAKFSAADLA--------CGEILTEST----GIIQSPGHPNIYPHGINCTWHILVQPG--HLIHLIFRKFHL-EFHYNCTN-DYLEVYDTGSNTYLGRYCGKSIPPSLTSSTNSLKLIFVADS--DLAYEGFLINYEATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRIT-VETSQQIALHFTNFALEEAIGGQCVADF--VEIRDGGYETSPPLGTYCGSIPPPRIISHSNKLWLQFTSDFLGSGPGFSAYWDGSLTGCGGNITT---PTGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEFEDFHLEHHPNCTLDYLAVYDGPSTSSHLLSQLC-GNEKPPVIRSTGD---SMFLKFRTDEDQQGGGFLAKYQQT-------CRNVVIVNRNYGILESIHY--PNPYSDNQRCNWTIQATTGNTVNYTFLAFELENHINCSTDYLELYDGPRRMGRYCGADMPPTGSTTGSKLQVLFYTDGVGHQEKGFQMQWFI----HGCGGELSGTTGSFSSPGYPNTYPPNKECIWYITTAPGSS---IQLTIHDFDVEYHARCNFDVLEVYGGPDFH----------SPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFN--ASWQAVPGGCGGIFQAPNGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQDSCITAYD-----GLSSTTTRLASVCGRQQLTNPITSSGNSLFLRFQSGPSRQGRGFRAQFNQVCGGHILTNSFDTISSPLFPAKYPNNQNCSWVIQAQPPFNHITLSFDHFGLE--SSTTCTQDFLEILDGDYDDAPLRGRYCGHS-MPHPITSFSSALTLRFVSDSRVNSDGFHA----TYAASSSACGGTFH---------MAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRDFV------EVREGNATGHLVGRY-CGNVLPLNYSSIVGHILWIRFVS--DGSGSGTGFQAT--FTKIFGNDNIVGTHGKIASPLWPGRYPHNSNYQWIVNVNATQVIHGRILEIDIEGAQSCYYDKLRVYDGLGIHSRLIGTYCGTQT----TSFSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPTIATGACGGFLRTGDAPVFLFSPGWPESYS-NSADCTWLIQAPDSTVELNILSLDI-----EAQRTCDYDK-LVIRDGDSNLAPQLAVLCGREIPGPIRSTGEYM--FIRFTSDFSITGAGFNASFHKSCGGYLHADRGIITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSRPSSTLFTSDNQMFVQFISDGSNGGQGFKIKYEAKSLACGGNIYIHDVNSAGYVTSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNI---EETPNCVSNYLELRDGVDSNAPLLAKLCGRSLPSSQLSSGEVMYLRFRSDNSSTQVGFKIKY---------AIAQCGG--RVTGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCEKD---------------FVEIWE-------NHTSGNLLGRYCGNTIPDSIDTSSNVALVRFVTDGSVTASGFRLRFESSMEACGGELQGP-TGTFTSPNYPNPNPHGRVCEWRIMVQEGRRITLTFNNLRLEAHPSCYSEHVTIFNGIRNNSPQLEKLCGS---VNASSEIKSSGNTMKVVF--FTDGSRPFGGFSATYTSSEDAVCGG--SLTHFPEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLESHQDCQFDVLEFRVGNADGPLM---WRLCGPSKPIVPLVIPYPEVWIHFVTNEHVEHVGFHAEYSFTDCGGIQLGESGVIASPNYPASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHATCAWDSVSVRNGGSPGSPIIGQYCGTSNPRTIQSGSNQLVVIFNSDHSVQNGGFYATWNTQTLGCGGILHSDNGTIRSPHWPQNFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQCQNSFVKVWAGTEEVAESLLATGCGNVAPGSILTPRNVFIAVFQSQETPAQGFSASFVSRCGGNF---TNPSGYILSPNYPRQYDNNMNCTYIIEADPLSVVLLTFESFHLEARSAITGSCANDGVHIIRGSNLSSTPFATVCGNE-ILSPVTILGPVLLNFY----SNAHTTDLGFKFNYKITSCGGVFNVSTGVIKSPAYSYSDYPNNIYCLYTIVGRDDRVVQLKFSDFDVVPSTFCSQDYLAIYDGSNISDPLLGKFCGSNLPPNIKSSNH--SMLLVFKTDSFQTARGWKITFQQTLGPQQGCGGYLTGSDNTFASPDSDSNGRYDKNLNCVWFIIAPVNKLIKLTFNT-FALEAQSAMQRCIYDYVKLYDGDSENANLAGTFCGSTVPA-PFISSGNFLTVQFVSDVTLEREGFNATYTTVDMPCGGTYNATWTPQSISSPNSSNPEVPLSMCMWFLEAPPHQQVKITVWALELHSQDCDQNYLEFRDSPESNGS--PGPQICGRNASATPTFYSSRSTAIVIFKSEVLNRNSRVGFTYQIAGCNREYNKAFGN------LKSPGWPDNYDNNLDCTVILTAPQNHTISLFFHSFGIEDSSE-CTHDFLEVRNGSDSSSPLFGTYCGTLLP-DPIFSRNNKLYLRFKTDSA--TSNRGYEIVWTSSPS---GCGGTLYGDSGSF-----TSPGYPGTYPNNTDCEWAIIAPAGRPVTVTFYFISI-----DDPGDCVQNYLILYDGPDANSPSFGPYCGADTNIAPFVASSHRVFIKFHAEYAVYPSAIRLTW 3618          

HSP 3 Score: 399.053 bits (1024), Expect = 1.434e-109
Identity = 604/2601 (23.22%), Postives = 1028/2601 (39.52%), Query Frame = 2
Query: 3641 SSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRIL-----IKINHIRSGSVDETKLCND---KNPVL-KFVTAKKEINIVCSEQITKMHV-----FEEQSVHVIFQNLASTKYRFRLYYTQDCEFPITSSSGRIESKNEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSI-IIQSSTHNFYLKFF---SANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAME---SNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFE-----GGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTS---GNAIFKAAYGVGSST-CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRS----QGGDFTNHIKFLAKYHINYNTEF--RSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLIL---SAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKK---ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYIL-NLTALDLPPPTNGKCVNGFLKILAMNIN-KTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTS-PPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK-----NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKE--SENAVIWSNCNSSTWDIYTEYSTV-----RIIFKTNTVTTRKGFKL---KYFFEDFMCG--GEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN--QGCFRIRAR---GVGYRSVLLYIICASN---------------------------LENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSD-NTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLD-------CNY-DHLFIRYAEEFDSPPFR------KLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIF----NTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRI-IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK-SICGGVYDLRQGEIVSANVALINYGSIT-CEYLIPGWENHLQVVYI----YPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQ-VDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYD-LRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFK------QKKYSHNLICNLTLIT-PAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTC 11026
            SSN A   ++  ++  +G   +TI + +   ECG I + T G I SP YP   P    C W++ ++P   I      + + H    S D  ++ +    ++P L KF T      +  +    ++H        +Q  H+ +    S  +    Y   D E  ++S      + N   R C + +    G +I +     +L   Q+    S + + D    LL K C N+ L    +  N+ I I    D S    ++RA    V +    G +             T  GVI+S  +PN       C+W         V L F    +ESS +C    I      EI   + +    N+   G  I +  +S +NF    F   S+ + +G M KF       + +C   ++ S GIIQSP +PN YPH + C+W++ V+    IHL    F  E    C  DY+E++   +N    L   CGK    I    +S  N + + F  D  ++  GF   Y E        ME    N    +          +  C + +   TS+   +I  +F  F      GG     C +D  + I +G    S      C   P   IIS  H  K+ L+ TS   G+    +AY  GS T CGG+     G+FTSP YP       +C ++++ S GS  +L  E+F  E+  +  L D++ + +GP+ +S LL +   L             DS++++ R+    QGG       FLAKY            +YG+L S  + + Y+ +    WT+ A +   + +TF  F +   ++   C+   L +YD       +CG+ +  +   T     +L      G++  GF ++W          I  C   +  T  T   +SP YPN     + C W I T    ++ + +  FD+E    C ++   +E  G  +          + +  S  +SE  +  +   N + I +K D      GF  S++     C   F+ P  G + +  YP+    N +C++++R    + IL N T  DL P     C+  +  + +      ++CG        PI ++ + + +      S + R  GF+  +   ++ CGG H LT   D+    +   +    P+   C W   + PP   + + F+   + S   C + FL   DG        G   +CG +  + I +  + LT+ F      N D F +        +CGG  H  +G   SP YP  YP    C+W I     + ++L+F+   L+  ++CS+     + V+E  +   ++   C +    +   YS++      I F ++   +  GF+    K F  D + G  G+ + P   L    YP   ++     W +NV+ ++ I  ++ ++ +   Q C+  + R   G+G  S L+   C +                            LE F ++     +    +GA   F    D P    S  +P +           N + C + I   P+    L++   D      C     V + G+    P      G   R       + G+ +   F     +  + +          CGG L    G I SP YPE Y  N +C W ++    + I      +H E           C+  D+L ++   +  SPP          CG  P S  TL    N+M + F SD S    GF I+Y   + A  C G I+    N+ G + SP +P  YP +  CNW I  P G  + + F+  F++E T     +Y  LR  +DSNA  LL++LCG   PS+ + SS   M L F +D +    GF  +Y  + CGG    + G I S+    + Y   + CE+ + G   H   ++       N  GC    + ++I     +GN L   R CG +    +I  S ++ +V    +  +    FR R+          + + P     +PN+P+P  H     W      G   ++   ++ +E ++  C  + V+      N+S  +   CG++   S      N + V F +D S      GF A    +   +  CGG +  T    G   S   +    Y  NL C+W ++ P      +        LE       C++D +    G ++  P++  LCG  + +  +      +++ F T+ +++  GF   ++        +      S ++ SP YP  + YD L     L+ A +   IT+T  D  I     C+ D   +++        I ++C + S  R   S  +++++ +           +D   Q +   Y    T+    G I++ +N         + +  N  C+ T+IT  +  L   F   +        C   +++   G     + +L   CG+  P S +T  +    +F + Q     G+  ++V       +CGG     SG I SP +   Y  +  C++ I+    S +   F    L   +++  +C
Sbjct:  556 SSNNALYFHLYSEHFRSGR-GFTIRWETQQPECGGILMGTYGSIKSPGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLYQDPSLGKFCTTLSVPPLQTTGPFARVHFHSDNQINDQGFHITYLTSPSDLHCGGNY--TDPEGLLSSDLSGPFTHN---RQCIYIIKQPLGEQIQVNFTHVELEG-QSSCSQSHIEVRD-DKILLGKVCDNETLPHIKSIRNH-IWIRLKIDAS----LVRASFRAVYQVACGGEL-------------TGEGVIRSPFYPNVYPGERICRWTIHQPQSQVVILNFTAFGIESSAHCDTDYI------EIGSSSILGSPENKKYCGTDIPLFITSVYNFLYVIFVKSSSTENHGFMAKFSAA----DLACGEILTESTGIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYNCTNDYLEVYDTGSN--TYLGRYCGKS---IPPSLTSSTNSLKLIFVADSDLAYEGFLINY-EATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQ---QIALHFTNFALEEAIGG----QCVAD-FVEIRDGGYETSPPLGTYCGSIPPPRIIS--HSNKLWLQFTSDFLGSGPGFSAYWDGSLTGCGGNITTPTGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEFEDFHLEHHPNCTL-DYLAVYDGPSTSSHLLSQ---LCGNEKPPVIRSTGDSMFLKFRTDEDQQGG------GFLAKYQQTCRNVVIVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFLAFELENHIN---CSTDYLELYDGPRRMGRYCGADMPPTGSTTGSKLQVLFYTDGVGHQEKGFQMQW---------FIHGCGGELSGT--TGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVEYHARCNFD--VLEVYGGPD-----FHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASWQAVPGGCGGIFQAP-NGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEP--QDSCITAYDGLSSTTTRLASVCGRQ--QLTNPITSSGNSLFLRFQSGPSRQGR--GFRAQF---NQVCGG-HILTNSFDTISSPLFPAKY---PNNQNCSWVIQAQPPFNHITLSFDHFGLESSTTCTQDFLEILDGDYDDAPLRG--RYCGHSMPHPITSFSSALTLRFVSDSRVNSDGF-HATYAASSSACGGTFHMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRD---FVEVREGNATGHLVGRYCGNV---LPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTKIFGNDNIVGTHGKIASP---LWPGRYPHNSNY----QWIVNVNATQVIHGRILEIDIEGAQSCYYDKLRVYDGLGIHSRLIGTYCGTQTTSFSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPTIATGACGGFLRTGDAPVFLFSPGWPESYS---------NSADCTWLIQA-PDSTVELNILSLDIEAQRTCDYDKLVIRDGDSNLAPQLAVLCG---REIPGPIRSTGEYMFIRFTSDFSITGAGFNASF---HKSCGGYLHADRGIITSPQYPETYSPNLNCSWHVLVQSGLTI-----AVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSRPSS--TLFTSDNQMFVQFISDGSNGGQGFKIKYEAKSLA--CGGNIYIHDVNSAGYVTSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNIEETPNCVSNYLELRDGVDSNA-PLLAKLCGRSLPSSQL-SSGEVMYLRFRSDNSSTQVGFKIKYAIAQCGGRVTGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCE--KDFVEIWENHTSGNLL--GRYCGNTIPD-SIDTSSNVALVRFVTDGSVTASGFRLRF-ESSMEACGGELQGPTGTFTSPNYPNPNPHGRVCEWRIMVQEGRRITLTFNNLRLE-AHPSCYSEHVTIFNGIRNNSPQLEKLCGSVNASSEIKSSGNTMKVVFFTDGS--RPFGGFSATYTSSEDAV--CGGSL--THFPEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLESHQD---CQFDVLEFRVG-NADGPLMWRLCGPSKPIVPLVIPYPEVWIHFVTNEHVEHVGFHAEYSFTDCGGIQLGE----SGVIASPNYP--ASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHATCAWDSVSVRNGGSPGSPIIGQYCGT-SNPRTIQSGSNQLVVIFN----------SDHSVQ-NGGFYATWNTQTLGCGGILHSDNGTIRSPHWPQNFPENSRCSWTVITHESKQLEISFDNNFRIPSGDGQCQNSFVKVWAGTEEVAESLLATGCGNVAPGSILTPRNVFIAVFQS-QETPAQGFSASFVS------RCGGNFTNPSGYILSPNYPRQYDNNMNCTYIIEADPLSVVLLTFESFHLEARSAITGSC 2974          

HSP 4 Score: 337.421 bits (864), Expect = 7.362e-91
Identity = 544/2402 (22.65%), Postives = 928/2402 (38.63%), Query Frame = 2
Query: 4139 CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTL---LKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQ-----GCMETFYYDPHESDYSTKNGVIQSAQFP-NSIANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTY--EFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSP-YHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNT-----EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAK----VFCGSGVIDSAIFTPPVTLILSAEGYRY----------PGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKD-FRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL-AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVIS-RIICNESFLAFFDGSTTFTQKIGGQNFCGKTNS-----IFTIGNVLTILFK-----NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKESENAVIWSNCNSS--TWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGE-YSDPERELNSTNYPKTLSWFLRCTWKINVDVS-KRIIVKVKKLKMNQGC-----FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSD--------QPSLCGSNIYPNN---NESGVITIENVNISLCQYNIHNYPEDEGTLSMF---MSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPAD---------TCNGIIFNTEGSIK--SPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSL--RIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF------FGCRYHDNQIQIDLED----QNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARY------------LHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLR-SVDIERSYDGC-NYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENIN--SATDRRFQISYELYTCNRTEKAY-SGRIVNVENFKQKKYSHNLICNLTLITP-APNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIP-PSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTS 11011
            C W + +     + I    F L  + N   + F++I D  ++    L + CG+ +L     SSN  +    Y++        R+  G  + ++TQ     G +   Y            G I+S  +P N     DC W   T P   +   F  + +E   +CS+   L   +  +  +  + + C  +       +Q++     + F S N  N   + F  TY    ++  C    +  EG++ S +    + HN +C + +K      I +     E E +S C   ++E+     +D + L  +C    N       S+ N + I+ + D ++    F+A Y   CGG    +     + SP YP+VY   + IC W +    S++ +  F  F    G  ++ +C +D        I  +   K    T  P +   + N  Y+  +  S++ N  F A +      CG       G+  SP +PN     ++C + I   PG  I L   +F  E   +   +D++++ +    +++ LGR+   S   + T     + +  ++L         +  FL  Y     +     ++  + G   SP F + Y  + +  + +  E+S+++   F  F++   +  GQC    + I D  Y+       +CGS         PP  +I  +               PGF   W    D +    G        T  T + TSP+YP        C W +        +++   F LE    C  +   V + G      S   ++    CG   N +  V ++   +S+ + ++ DE     GF   Y++ C      N   G L+++ YPN   +N+ C + +++   N + N T L      +  C   +L++          CG+++PP      T  S + V LF       +  GFQ+ +      CGG  EL+    S       N     P   EC W+ T+ PG+ +Q+   +  +     CN   L  + G    + +I     C + +S     + + GN L I FK     N   F+     V  G CGG+     G I SPNYP  Y   + C W I       I L F D DL+     S +T      S    + S C     T  I +  +++ + F++      +GF+ ++   + +CGG   ++    ++S  +P        C+W I        I +      +         F     G    + L    C  ++ +      S++   F S + +    NSD          S CG   +      N  G   +   N+  C +NI + P +   LS     + D+    CS  +   + GN     V   G  C     +   S +G ++   F      + + ++      F      +  + G I SP +P +YP N++ +W++      +I   I  + +E    C YD L +       S      CG    S    S  RN +   F SD S++  GF++E+  +N +           C G +   +  +   SP +P+ Y ++  C W I  P+   V L   L  D+E  +  TC YD L  R  DSN    L+ LCG   P  PI S+   M + F++DF+    GF+A +   CGG     +G I S         ++ C + +         V+    F        C   D  +  +  D      G Y      CG SR   T+  S +   V    +       F+ +Y            +HD N   +        + +P  P+ Y  +A+  W+  AP G +  +      +IE + +   NY  +    +S+    A  CG  +  S  +    V+ +RF+SD S      GF + +       +  CGG +    G  G+I+S        Y +N  C+W +  P GH + + FE+    L+  S   GC  D + I++   S   ++   CG+   DSI T SNV  + F TD ++  SGF+L F +  S       +   +    SP YPN +P+  R     I   E   IT+T  +L++ +  +C  +   I +    +  ++EK C S++      SS + + + +           SAT      S E   C  +   +  G   +        YS NL C  TL  P   N     +F+ F LE    C +D ++F +G       ++ ++CG S P    V     V + FVT++ + + G+   Y         CGG    +SGVI SP +  +Y     CSW ++      I   F+D  + ++ +
Sbjct:  497 CFWVIRTEDRKVLRITFTFFQLESVNNCP-HEFLQIHDGDSSAALQLGRFCGS-VLPHELLSSNNALYFHLYSEH------FRSGRGFTIRWETQQPECGGILMGTY------------GSIKSPGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLEHHDDCSKD-YLEIRDGPLYQDPSLGKFCTTL---SVPPLQTTGPFARVHFHSDNQIND--QGFHITYLTSPSDLHCGGNYTDPEGLLSS-DLSGPFTHNRQCIYIIKQPLGEQIQVNFTHVELEGQSSCSQSHIEV----RDDKILLGKVC---DNETLPHIKSIRNHIWIRLKIDASLVRASFRAVYQVACGG---ELTGEGVIRSPFYPNVYP-GERICRWTIHQPQSQVVILNFTAF----GIESSAHCDTDYIEIGSSSILGSPENKKYCGTDIPLFITSVYNFLYVIFVKSSSTENHGFMAKFSAADLACGEILTESTGIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYN-CTNDYLEVYD--TGSNTYLGRYCGKSIPPSLT-----SSTNSLKLIFVADSDLAYEGFLINYEATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQQIALHFTNFALEEAI-GGQCVADFVEIRDGGYETSPPLGTYCGS--------IPPPRIISHSNKLWLQFTSDFLGSGPGFSAYW----DGSLTGCGG-----NITTPTGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEFEDFHLEHHPNCTLDYLAV-YDGP-----STSSHLLSQLCG---NEKPPVIRS-TGDSMFLKFRTDEDQQGGGFLAKYQQTCRNVVIVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTV-NYTFLAFELENHINCSTDYLELYDGPRRMGRYCGADMPPTGS---TTGSKLQV-LFYTDGVGHQEKGFQMQWFIHG--CGG--ELSGTTGSFSSPGYPNTY---PPNKECIWYITTAPGSSIQLTIHDFDVEYHARCNFDVLEVYGGPDFHSPRI--TQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASWQAVP-GGCGGIFQAPNGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQ--DSCITAYDGLSSTTTRLASVCGRQQLTNPITSSGNSLFLRFQSGPSRQGRGFRAQF---NQVCGGHILTNSFDTISSPLFPAKYPNNQNCSWVIQAQPPFNHITLSFDHFGLESSTTCTQDFLEILDGDYDDAPLRGRYCGHSMPHPITSFSSALTLRFVSDSRV----NSDGFHATYAASSSACGGTFHMAEGIFNSPGYPEVYPSNVE-CVWNIVSSPGNRLQLSFITFQLEDSQD--CSRDFVEVREGNATGHLV---GRYCGNVLPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTKIFGN--DNIVGTHGKIASPLWPGRYPHNSNYQWIVNVNATQVIHGRILEIDIEGAQSCYYDKLRVYDGLGIHSRLIGTYCGTQTTS---FSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPTIATGACGGFLRTGDAPVFLFSPGWPESYSNSADCTWLIQAPDS-TVELNI-LSLDIE--AQRTCDYDKLVIRDGDSNLAPQLAVLCGREIP-GPIRSTGEYMFIRFTSDFSITGAGFNASFHKSCGGYLHADRGIITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCG-SRPSSTLFTSDNQMFVQFISDGSNGGQGFKIKYEAKSLACGGNIYIHDVNSAGY--------VTSPGHPNNYPQHADCNWLIAAPPGKLIRVQFEDQFNIEETPNCVSNYLELRDGVDSNAPLLAKLCGR-SLPSSQLSSGEVMYLRFRSDNS--STQVGFKIKYA------IAQCGGRV---TGQSGIIESSGYPTL-PYRDNSFCEWHLKGPSGHYLTIHFED--FHLQNSS---GCEKDFVEIWENHTSGN-LLGRYCGNTIPDSIDTSSNVALVRFVTDGSVTASGFRLRFES--SMEACGGELQGPTGTFTSPNYPNPNPHG-RVCEWRIMVQEGRRITLTFNNLRLEAHPSCYSEHVTIFNGIRNNSPQLEKLCGSVNASSEIKSSGNTMKVVFFTDGSRPFGGFSAT----YTSSEDAVCGGSLTHFPEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYLESHQDCQFDVLEFRVGN--ADGPLMWRLCGPSKPIVPLVIPYPEVWIHFVTNEHVEHVGFHAEYSFT-----DCGGIQLGESGVIASPNYPASYDSLTHCSWLLEAPQGFTITLTFSDFDIEDHAT 2738          

HSP 5 Score: 336.265 bits (861), Expect = 1.809e-90
Identity = 522/2274 (22.96%), Postives = 910/2274 (40.02%), Query Frame = 2
Query: 4505 IANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEE-SLCRYDYVEIF-SPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET-----CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKS--PYHPIISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLG----RFYTLSEIRNY-TYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYH---INYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYD--SNYDAKVFCGSGVIDSAIF-TPPVTLILSAEG-YRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSY--ECKYENFTVEFTG--SKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTFILR-SHFLNYILNLTALDLPPPTNGKCVNGFLKI-----LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDS--RIVDMNSN-----RLHMTPHFIE---CKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGK--TNSIFTIGNVLTILFKNMDDFSY----FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYST----VRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRA-RGVGYRSVLLYIICA-SNLENFEIDTKSSMIEVFGSGAT-ISFSYNSDQPSLCGSNIYPNNNE---SGVITIENVNISLCQYNIHNYPE-DEGTLSMFMSDNTGIP----CSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAV--TLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI--------------CGGVYDLRQGEIVSANVALINYG-------SITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQRI-CGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINL-RSVDIERSYDGC---------NYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG--YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSR-VSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEI-YLDSGVITSPGFG--TNYYESGECSWNIKLV--SNSYIKWRFTDMQL 10996
            + +++C W  +T     +++ F   ++ES  NC     L+  + +      + + C  +   +   + SS +  Y   +S +  +G  R F   +E     C   + G+ G I+SP YP  YP    C W +     + I         E    C  DY+EI   P+  D   L   C  ++        +      + F +D+ ++ +GF   Y  +     CGG     E    LLS +    +T  +  C + +     E  +++ F  +  EG S+   CS  +    IE + ++  +   +C     P+   I N  ++++ + ++   A F+A Y V    CGG+    +G+  SPFYPN    +  C + I       + L+   F  E++ ++   D+I+I      +SS+LG    + Y  ++I  + T  Y F   ++++  S     T +  F+AK+    +          G++ SP   ++Y      TW +  +    +   F +F +    +   C    L +YD  SN     +CG  +  S    T  + LI  A+    Y GFLI +    D +   + D       T  +   TSPN+PN       C + I  + ++ + +   +F LE +   +C  +   +   G  +  P+ ++        CGS+             N + + + +D     PGF   +  +   C  +   P  G   +  YP   + +  C ++L+ SH   + L      L    N  C   +L +      + ++   LCG+  PP ++                 + +S +  F     + DE+  G   L +YQ +   +V +N N      +H    + +   C W   +  G  +   F    + + I C+  +L  +DG     +++G   +CG     +  T G+ L +LF   D   +    F+++  I  CGG L    G  +SP YP  YPP   CIW I+    S+I+LT  D D++    C+   L V    +  +  I   C+  + +   + S+    + I FKT++    +GF   +      CGG +  P  E++S NYP        C+W I V+ + RI++      +      I A  G+   +  L  +C    L N    + +S+   F SG +     + +    +CG +I  N+ +   S +   +  N   C + I   P  +  TLS    D+ G+     C+  +     G+    P+     G +  + + SFS+    +   F     VN   +        S CGG    + G   SPGYPE YP N +C W I++     +QL+  T  LE   DC+ D + +R          R    + P++  ++  H   +R  F SD S S  GF   +  I   D     I  T G I SP +P  YP N    W ++V    +V     L  D+E     +C+YD LR+ D   +   L+   CG    S   +SS N ++  FS+D +   +GF  ++ ++              CGG   LR G+   A V L + G       S  C +LI   ++ +++  +  +    R  D   ++ + D + N  P   + CG+          + + I +T+ +F +    F A +       + +D     ++ +P +P  Y  N N +W      G   +++  +   I      C         N   +          +  FCG+  + + F  D N + V+F SD S+     G   F        L CGG  Y++  V + G + S    NN  Y  +  C W IAAP G  ++V FE+   ++E       C  +++ + DG DS  P++  LCG     S  +   VMYL F +D +  + GFK+ +            VT  S ++ES  YP     D  F    +      ++TI  +D  +++S  C  D F+    +    N + ++C +   + +  SS+  ++     G +    +A+  R +    +  C    +  +G   +  N+      H  +C   ++      R    F    LE   +C  +++    G        L K+CGS    S + +S   + ++F TD S  + G+  TY  + D    CGG + +   G  TSPG+   +NY  +  C W +      NS I   F D  L
Sbjct:  492 VHDVNCFWVIRTEDRKVLRITFTFFQLESVNNCPH-EFLQIHDGDSSAALQLGRFCGSVLPHE---LLSSNNALYFHLYSEHFRSG--RGFTIRWETQQPECGGILMGTYGSIKSPGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLYQD-PSLGKFCTTLS---VPPLQTTGPFARVHFHSDNQINDQGFHITYLTSPSDLHCGGNYTDPEG---LLSSDLSGPFTH-NRQCIYIIKQPLGE-QIQVNFTHVELEGQSS---CSQSH----IE-VRDDKILLGKVCDNETLPHIKSIRNHIWIRLKIDASLVRASFRAVYQV---ACGGEL-TGEGVIRSPFYPNVYPGERICRWTIHQPQSQVVILNFTAFGIESS-AHCDTDYIEIG-----SSSILGSPENKKYCGTDIPLFITSVYNFLYVIFVKSSS-----TENHGFMAKFSAADLACGEILTESTGIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYN---CTNDYLEVYDTGSNTYLGRYCGKSIPPSLTSSTNSLKLIFVADSDLAYEGFLINYEA-TDASSACMED------YTENSGTFTSPNFPNNYPNNWKCIYRITVETSQQIALHFTNFALEEAIGGQCVADFVEIRDGGYETSPPLGTY--------CGSIPPPRIISHS----NKLWLQFTSDFLGSGPGFSAYWDGSLTGCGGNITTP-TGVFTSPSYPMPYYHSSECYWLLKASHGSPFELEFEDFHLEHHPN--CTLDYLAVYDGPSTSSHLLSQLCGNEKPPVIRS----------------TGDSMFLKF-----RTDEDQQGGGFLAKYQQTCRNVVIVNRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFLAFELENHINCSTDYLELYDGP----RRMG--RYCGADMPPTGSTTGSKLQVLFYT-DGVGHQEKGFQMQWFIHGCGGELSGTTGSFSSPGYPNTYPPNKECIWYITTAPGSSIQLTIHDFDVEYHARCNFDVLEVYGGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASWQAVPGGCGGIFQAPNGEIHSPNYPSPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQDSCITAYDGLSSTTTRLASVCGRQQLTNPITSSGNSLFLRFQSGPSRQGRGFRAQFNQVCGGHILTNSFDTISSPLFPAKYPNNQNCSWVIQAQPPFNHITLSF---DHFGLESSTTCTQDFLEILDGDYDDAPLRGRYCGHSMPHPITSFSS---ALTLRFVSDSRVNSDGFHATYAASSSACGGTFHMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDCSRDFVEVREGNATGHLVGRYCGNVLPLNYSSIVGHILWIR--FVSDGSGSGTGFQATFTKIFGNDN----IVGTHGKIASPLWPGRYPHNSNYQWIVNV-NATQVIHGRILEIDIE--GAQSCYYDKLRVYDGLGIHSRLIGTYCGTQTTS--FSSSRNSLTFQFSSDSSITGKGFLLEWFAVNASGGPLPTIATGACGGF--LRTGD---APVFLFSPGWPESYSNSADCTWLIQAPDSTVELNILSLDIEAQRTCDYD-KLVIRDGDSNLAPQLAVLCGREIPGPIRSTGEYMFIRFTS-DFSITGAGFNASFHKSCGGYLHADRG---IITSPQYPETYSPNLNCSWHVLVQSGLTIAVHFEQPFQIPSGDSSCSQGDYLVLKNGPDIYSPPLGPYGRNGHFCGSRPSSTLFTSD-NQMFVQFISDGSN-----GGQGFKIKYEAKSLACGGNIYIH-DVNSAGYVTSPGHPNN--YPQHADCNWLIAAPPGKLIRVQFEDQ-FNIE---ETPNCVSNYLELRDGVDSNAPLLAKLCGRSLPSSQLSSGEVMYLRFRSDNSSTQVGFKIKYAIAQCGGR----VTGQSGIIESSGYPTLPYRDNSFCEWHLKGPSGHYLTIHFEDFHLQNSSGCEKD-FVEIWENHTSGNLLGRYCGNTIPDSIDTSSNVALVRFVTDGSV----TASGFRLRFESSMEACGGELQGPTGTFTS-PNYPNPN-PHGRVCEWRIMV-QEGRRITLTFNNLRLEAHPSCYSEHVTIFNGIRNNSPQ-LEKLCGSVNASSEIKSSGNTMKVVFFTDGSRPFGGFSATYTSSED--AVCGGSLTHFPEGNFTSPGYNGVSNYSRNLNCEWTLSNPNQGNSSIYIHFEDFYL 2619          

HSP 6 Score: 288.115 bits (736), Expect = 6.651e-76
Identity = 347/1452 (23.90%), Postives = 591/1452 (40.70%), Query Frame = 2
Query: 7016 MNSNRLHMTP-----HFIECKWHFTSPPGTRMQIDFEELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVL-----TILFKNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCNS-STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFE--DFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYR--SVLLYIICAS-NLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVIT---IENV--NISLCQYNIHNYPEDEGTLSMFMS--DNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTL----GKVVNF---IFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPP---FRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK---SICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNG----NYLPGQRICGKSREKITIMHSKSIKIVYTAR-NFHLKNYNFRARYLHD-ENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDS---ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDH-ITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQ----ALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWSPV 11197
            M+ +  +M+P     H + C W   +     ++I F    +  +  C   FL   DG ++   ++G   FCG    + + +  N L     +  F++   F+  R + +   CGG+L    G I SP YP NYPP   C+WQ+       I  TF    L+  ++CSK  L +      ++  +   C + S   + T     R+ F ++     +GF + Y     D  CGG Y+DPE  L S++     +   +C + I   + ++I V    +++ +G        +  R   +LL  +C +  L + +       I +    + +  S+ +     CG  +       GVI      NV     +C++ IH  P+ +  +  F +    +   C   Y      + L  P           N+ Y  + +      V NF   IF          +  +       CG +LTES G I+SPG+P  YP   +C W I+     +I L  +  HLE H +C  D+L     E +D+       + CG +     +L+   N ++L F +D  ++  GF+I Y   + +  C        G+  SPN+P  YP+N +C + I V    +++L F   F LE      C  D + I D    T   L   CG+IPP   I+ S N++ L F++DF  +  GF A +    + CGG      G   S +  +  Y S  C +L+    +H     +    F   +H N     L   +G    ++L  Q +CG   EK  ++ S    +    R +   +   F A+Y     NV +     R Y +L++ ++P+PY  N    W   A  G   +    + ++E   + C+ D++             +CG     +     + + ++ +   + H E       FI+       GCGG ++ T G++    S    N   Y  N  C W I    G ++++   +  +    R     C +D + +Y GPD   P I  LC     ++   +++  N + + F TD +I   GF  ++ AVP     I    N    + SP YP  SPY        +   E +H I +   D  +    +C        D       ++   C          SS + + +++Q GP     S   R F+  +    C       S   ++   F   KY +N  C+  +    P       F +F LE S+TC  D+++ + G+  +   +  + CG S+P    + SS +++ FV+D  +N DG+  TY  +   S  CGG  ++  G+  SPG+   Y  + EC WNI     + ++  F   QL ++         + DFV+V  GN       +YCG +L      I      + + S   G G GF+ +++ +
Sbjct:  478 MDGSFSYMSPDVGYVHDVNCFWVIRTEDRKVLRITFTFFQLESVNNCPHEFLQIHDGDSSAALQLG--RFCGSVLPHELLSSNNALYFHLYSEHFRSGRGFT-IRWETQQPECGGILMGTYGSIKSPGYPGNYPPGRDCVWQVVTSPDLLITFTFGTLSLEHHDDCSKDYLEIRDGPLYQDPSLGKFCTTLSVPPLQTTGPFARVHFHSDNQINDQGFHITYLTSPSDLHCGGNYTDPEGLL-SSDLSGPFTHNRQCIYIIKQPLGEQIQVNFTHVEL-EGQSSCSQSHIEVRDDKILLGKVCDNETLPHIKSIRNHIWIRLKIDASLVRASFRAVYQVACGGEL----TGEGVIRSPFYPNVYPGERICRWTIHQ-PQSQVVILNFTAFGIESSAHCDTDYIEIGSSSILGSP----------ENKKYCGTDIPLFITSVYNFLYVIFVKSSSTENHGFMAKFSAADLACGEILTESTGIIQSPGHPNIYPHGINCTWHILVQPGHLIHLIFRKFHLEFHYNCTNDYL-----EVYDTGSNTYLGRYCGKS--IPPSLTSSTNSLKLIFVADSDLAYEGFLINYEATDASSACMEDYTENSGTFTSPNFPNNYPNNWKCIYRITVETSQQIALHFT-NFALEEAIGGQCVADFVEIRDGGYETSPPLGTYCGSIPPPRIISHS-NKLWLQFTSDFLGSGPGFSAYWDGSLTGCGGNITTPTGVFTSPSYPMPYYHSSECYWLLKA--SHGSPFELEFEDFHLEHHPNCTLDYLAVYDGPSTSSHLLSQ-LCGN--EKPPVIRSTGDSMFLKFRTDEDQQGGGFLAKYQQTCRNVVIV---NRNYGILESIHYPNPYSDNQRCNWTIQATTGNTVNYTFLAFELENHIN-CSTDYLELYDGPRRM--GRYCGADMPPTGSTTGSKLQVLFYTDGVGHQEKGFQMQWFIH-------GCGGELSGTTGSF---SSPGYPNT--YPPNKECIWYITTAPGSSIQLTIHDFDVEYHAR-----CNFDVLEVYGGPDFHSPRITQLCSQRSSENPMQVSSTGNELAIRFKTDSSINGRGFNASWQAVPGGCGGIFQAPNGE--IHSPNYP--SPYRGNTDCSWVIRVERNHRILLNFTDFDLEPQDSC----ITAYDGLSSTTTRLASVCGRQQLTNPITSSGNSLFLRFQSGP-----SRQGRGFRAQFN-QVCGGHILTNSFDTISSPLFP-AKYPNNQNCSWVIQAQPPFNHITLSFDHFGLESSTTCTQDFLEILDGDYDDAP-LRGRYCGHSMPHPITSFSSALTLRFVSDSRVNSDGFHATYAAS---SSACGGTFHMAEGIFNSPGYPEVYPSNVECVWNIVSSPGNRLQLSFITFQLEDSQDC------SRDFVEVREGNATGHLVGRYCGNVLPLNYSSIVGHILWIRFVSDGSGSGTGFQATFTKI 1847          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. UniProt/SwissProt
Match: sp|Q9JLB4|CUBN_MOUSE (Cubilin OS=Mus musculus OX=10090 GN=Cubn PE=1 SV=3)

HSP 1 Score: 895.575 bits (2313), Expect = 0.000e+0
Identity = 972/3817 (25.47%), Postives = 1622/3817 (42.49%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPK-PFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA-NAYTC--GPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR-ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQI--IPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI-PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHL---------KVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRKIA-ISFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSV--FDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL---IHDNQTKRFCGNH-AKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIK-----INHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--FPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES---LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTS--GNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAK-----VFCGSGVIDSAIFTPPVTLILSAEGYRYP-GFLIRWNPPVDENFK----KIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHF-------IECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT---NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLN-YPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN--QGC---FRIRARGVGYRSVLLYIICAS-NLENFEIDTKSSMIEVFGSGATISF-----SYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYN-IHNYPED---EGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLG--KVVNFIFQPGREVN-MSNYRVE-----IGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLN---PISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT---LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFF---------GCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIE-RSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT--NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPN-NSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCES-LSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPT---CYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            PR+ ++ GN++F T+S+++I F T + G+I+LND DL     +I++ +++I    DLK+    L  + L     ++  L       N K+  LE +   +++ +    C++NPCHNG  C++ ++SF CICP  +KG  C+EDVNEC+  +GT  GCQ+G+ C NT+GSFRC C+    G  C    N C   S   +C HG C       + +  F C+CD+GW+  P   +C  D DEC +   PCS H    C NT G   C  CP G++GNG+ C DINEC  N   C   P   C+N  G++ C  C  G       +C   ++C  +NGGC  +A CS+++       +CTC PGY+G+G G NGCV +S   +         R  C N G C ++++ + C+C  G+ G  C   I N+C+SNPCLNGG C     N + C C   ++G  C+     CGG  + +        F    P+ +   +  C W + +  ++ L I     +L+   +C  EY+Q+H+      A   +G+YC    STP +   + +  +        I++  GF  +        +  +C     G+        G   SP +P  Y    +C        G+   +     TL L +  ++CS  DYL+I    F    I    C        +       +HFHSD  S+ +   F   +    S   CG   T     ++  P   P      C + I Q    +++               +  +  E+ +     + FI     E L               + N  +I  +    +    F+   + ACG  +  + +     +S  YP  Y+G   C +      R++  ++F DF I   S C  D+I+I  S+      ++++C  N    IT   N     + +TF  +S+    GF A  S    +CG    LT    I     H N         Y     CTW I       I  VF  F+LE H NCA DYLE+   I      R+CG     S  + +H + + FVSD++++ EGF + +  +     C   +  + G +++P       +++ C Y I V   ++I ++ T    +   F   C+    ++                  P R  I + SN   + +       A  F+   + SS    CG    +  G + SPNYP+    ++ C W + ++ G   L++     + H  + S+D   + +  +      T  + IN +C +         +  V +  +  A  + R F + Y Q C+    +  +SG +ES N     +  + C+W + +  G+ +     +FD+    N     ++ + D     + + CG  +     T+ +  I + H TD      V    +G  + +   GC           + S   G   S  +PNS   N +C WN +  PG S++L     ++E   +C     L  +         + Q C+R      + I S+ +   ++F + +  NG  R F  ++      C      S G I SPNYPN Y  N  CSW ++V++   + L I DF+ E +   L  YD     +       ++  +CG+         +S  N + ++F++  +  SRGF+A++ + CG   +  +S+  + SP YP  Y  P+   C W + A      + + F     +  +   +C+ D  + I++G  +++ V+   C  S  HPIIS G+ L V   S S  G   F A Y   +S CGG FY  DG+F SP YP   + + +CV+ I +SPG+ + LS   F  EN+++    DF++IR G N T  L+GR+   S   NY+     N  +W+R  S G      + F A++ +I  N      +G +A+P +   Y  ++   WTV  +SS  +     +  +    +   C   +L IYD  +D        +CG+     +     +T   S++  +   GFL+ W      N        G C   +   +      SP +P        C W I    +  +++ +LS D+E+   C Y+   ++   S+      +     V CG            Y++    I + +D      GF  S++K+C   + +   G + + +YP+    N NC++ +L    L   ++          +  C  G   +L                N   CG   P  L    T+ + + +    + S+  +  GF+I Y  K   CGG    T Y    I D NS+    +P++        EC W   +P G  +Q+ FE+   +     C+ S+L   DG+ +    +     CG T   N + + G ++ + F       Y  F+ K  I SCGG +    G I S  YP   Y     C W I G     + + F D +L  +  C+K +   I    +   ++   C NS    + T  +   I F T+   T  GF+L++     +CGG+   P     S NYP        C W INV   ++II+    L+++  Q C     I   G+   S  L  +C+  N+ N    + ++M  +F +  +  +     SY S + ++CG  +          ++   N S   YN I +Y  +   E TLS    +N+ I    +    +        V +F  G  +   +  F +L   +V   I  P   ++ +SN RVE     + Y F+ CGG+ T   G I SP YP  Y   T C WL+ APE   I LT     +E+H  C  D + +R  +   SP   + CG +   PI + +     N++ ++F+++      GF   +N       C G + +  G+IKSP++P+ +P N RC+WT    E     ++F   F +  +S   C    +++ +    T   LL+  CGN+ PS PI +  N  + VF ++     +GF A + S CG  ++   G+IVS N       ++ C Y I      L V+  + +F           C Y    I   ++  N +  P   ICG    +   +    +   Y+  + ++ ++ F+  Y       ++S      VL +P+F    + N N+  +++  V     I LR  D E    + C++D++      S  + +I  FCG+     P +I +  N L + F++D S  +   G+      T GP  GCGGY+     ++    S D D++GLY+  L C W I AP    VK+ F  N+ +LE  S  G C +D++ I DG      +    CG  +     +  N + + F +D +IQ  GF  T+T V          T+  Q   SP+  N   P+       +I A     + ITV  L++ S  +CS     +QD+   + N++ +FC +  +T  VF SS    ++ ++   + N NS    R   +YE+  CNR      G + +      + Y++NL C++ L  P  N R   +F +F LE S  C  D+++   G       +L K C + +P    + S+ + + F +D S  + GY+I +  +      CGG +  + G++ +PGF  +Y  +  C W I   S   +   F  + + +    +      ++  D     +G     +CG   +   F   S+   + + +    V +GF I WS
Sbjct:   39 PRMTTEEGNLVFLTSSAQNIEFRTGSLGKIKLNDDDLGECLHQIQRNKDDII---DLKRNTTGLPQNILS----QVHQL-------NSKLVDLERDFQSLQQNVERKVCSSNPCHNGGTCVNLHDSFICICPSQWKGLFCSEDVNECVLYAGTPFGCQSGSTCVNTMGSFRCDCTPDTYGPQCASKYNDCEQGSQ-QLCKHGICEDLQRVYHGQLRFNCICDAGWTTLPNGISCTEDKDECSLQPSPCSEH--AQCFNTQGSFYCGACPKGWQGNGYQCQDINECEINNGGCSQAPLVPCLNTPGSFTCGNCPAGFSGDG-RVCTPLDICSIHNGGCHPDATCSSSSVLGSLLPVCTCPPGYTGNGYGSNGCVRLSNMCS---------RHPCVN-GQCIETVSSYFCKCDSGWFGQNCTENI-NECVSNPCLNGGTC-IDGVNGFTCDCTSSWTGYYCQTPQAACGGILSGTQ-----GTFAYQSPNDTYVHNVNCFWVVRTDEEKVLHITFTFFDLESASNCPREYLQIHDGD--SSADFPLGRYC---GSTPPQGVHSSANSLYFHLYSEYIKRGRGFTAR-----WEAKLPECGGILTGNY-------GSITSPGYPGNYPPGRDCVWNLLVSPGS--LITFTFGTLSL-ESHNDCS-KDYLEIRDGPFHHDPILGKFCTSLSTPPLQTTGPAARIHFHSD--SETSDKGFHITYLTTPSDLYCGGNYTDTEGELLLPPLTGPFSHSRQCVYLISQPQGEQIV---------------INFTHVELESQRGCSHTFIEVGDHESLLRKICGNETLFPIRSISNNVWIRLRIDALVQKASFRADYQVACGGELRGEGV----IRSPFYPNAYAGRRTCRWTISQPPREVVLLNFTDFQIGSSSSCDTDYIEIGPSSVLGSPGNEKFCGTNIPSFITSVYN----VLYVTFVKSSSMENRGFMAMFSSEKLECGK--VLTESTGIIESPGHPN--------VYPSGVNCTWHIVVQRGQLIRLVFSSFYLEFHYNCANDYLEVYDTIAQTSLGRYCGKSIPPSLTSSSHSIKLIFVSDSALAHEGFSINYEAINASSVCLYDYTDNFGRLSSPNFPNNYPHNWNCVYRITVGLNQQIALHFTDFALE-DYFGPKCVDFVEIRDGGFETSPLIGIYCGSVFPPR--IISHSNKLWLRFKSDTALTARGFSAYWDASSTG--CGGNLTTPTGVLTSPNYPMPYYHSSECYWRLEASRGSPFLLEFQDFHLEHHPNCSLDYLAVFDGPS------TNSRLINKLCGDTPPAPIRSSKDIVLLKLRTDAGQQGRGFEINYRQTCDNVVIVNKTSGILESINYPNPYDKDQRCNWTIQATTGNTVNYTFLEFDVENYVNCST-DYLELYDGPQR-IGRYCGENIPPPGATTGSKLIVVFH-TD-----GVDSGEKGFKMHWFIHGC---------GGEMSGTMGSFSSPGYPNSYPHNKECIWNIRVAPGNSIQLTIHDFDVEYHASCKYD-TLEIYTGLDFHSPRIAQLCSRSPSANPMQISSTDNELAIRFKTDSSLNG--RGFNASWRAVPGGCGGIFQVSRGEIHSPNYPNNYRANTECSWIIQVEKYHRVLLNITDFDLEATDSCLMTYDGSSSAN------TRVATVCGRQQP--PNSITSSGNSLFVRFQSGSSSQSRGFRAQFRQECGA-HIITDSSDSISSPLYPANY--PNNQNCTWIIEAQPPFNHIALSFTHFHLQSST---DCTRD-FVEILDGRDSDAPVQGRYCGTSLPHPIISFGNALTVRFVSDSVYGFDGFHAIYSASTSACGGTFYTGDGIFNSPGYPEDYHSNTECVWNIASSPGNHLQLSFLSFQLENSLN-CNKDFVEIREG-NATGHLMGRYCGNSLPGNYSSIEGHN--LWVRFVSDGSG--TGMGFQARFKNIFGNDNIVGTHGKIATPFWPGNYPLNSNYRWTVNVDSSHIIHGRILEMDIELTTN---CFYDSLKIYDG-FDIHSRLIGTYCGTQRESFSSSRNSLTFQFSSDSSKSGRGFLLEWFAVDVSNVTLPTIAPGACGGYMVTGDTPVFFFSPGWPGPYGNGADCIWIIYAPDS-TVELNILSMDIEAQLSCSYDKLIIKDGDSR------LSQQLAVLCGRSVPGPIRSTGEYMY----IRFTSDGSVTGAGFNASFQKSC-GGYLHADRGIITSPKYPDNYLPNLNCSWHVLVQSGLTIAVHFEQPFQIQNRDSSCSQGDYLVLRNGPDNHSPPLGPSGGNGRFCGIYTPSTL---FTSDNEMFIQFISDNSNGGQ--GFKIRYEAKSLACGG----TIY----IHDANSDGYVTSPNYPANYPQHAECIWILEAPSGRSIQLQFEDQFNIEETPNCSASYLELRDGANSNAPVL--SKLCGHTLPRNWVSSRG-LMYLKFHTEGGSGYMGFKAKYSIVSCGGTVSGDSGVIESVGYPTRLYANNVFCQWHIQGLPGHYLTIRFEDFNLQSSPGCAK-DFVEIWENHTSGILLGRYCGNSIPSSVDTSSNVASIRFVTDGSVTDSGFRLQFKSSREVCGGDLHGPTGTFTSPNYPNPNPHPRICEWTINVHEGRQIILTFTNLRLSTQQSCNTEHLIVFNGIRNNSPRLQKLCSRVNVTNEFKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGTL---------PSVSGGNFSSPGYNGIRDYARNLDCEWTLSNPNRENSSISIHFLGLSLESHQDCTFDVLEFRVGNADGPLIEKFCSLSAPRVPLVIPYPQVWIHFVSNERVEYTGFYVEYSFTNCGGIQTGENGVISSPNYPNLYSRWTQCSWLLEAPEGHTITLTFSDFSVENHPTCTSDSVTVRNGDSPGSPIIGRYCGQSVPGPIQSGS-----NQLVVTFNTNNQGQSRGFYATWN--TNTLGCGGTLHSDNGTIKSPHWPQTFPENSRCSWTAVTHESKHWEISFDSNFRIP-SSDSQCRNSFVKVWEGMLETNDALLATSCGNVAPS-PIVTLGNIFTAVFQSE-EMPAQGFSASFISRCGRTFNSSTGDIVSPNFPKHYDNNMNCNYYIDVAPQSL-VILTFVSFHLEDRSAVSGTCDYDGLHI---IKGHNLSSTPLVTICGSETLRPLTIDGPVMLNFYS--DAYITDFGFKISYRVANCGGIYSGTYG--VLNSPSFSYTNYPN-NVYCVYSLQVRNDRLILLRFNDFEIVPSNLCSHDYLEVFDGPSIGNRSIGKFCGSTL---PQVIKSTNNSLTLLFKTDSS--QTARGWKVSFRETIGPQQGCGGYLTEDSKSF---VSPDHDSDGLYDKGLNCIWYIIAPENKLVKLTF--NAFTLEEPSSPGKCTFDYVQIADGASINSYLGGRFCGSSRPAPFISSGNFLTVQFVSDISIQMRGFNATYTFVDMPCGGTYNATSMPQNTSSPQLSNIRRPFST--CTWVIEAPPHQQVQITVWKLQLPSQ-DCSRSSLELQDSEQTNGNQVTQFCGANYTTLPVFYSSGSTAVVVFKSDFL-NRNS----RVHFTYEIADCNREYNQAFGNLKSPG--WPQGYANNLDCSIILRAPQ-NHRISLFFYWFQLEDSRQCMNDFLEVRNGSSSSSP-LLGKYCSNLLPNPIFSQSNELYLHFHSDDSDTHHGYEIIWASS---PTGCGGTLLGNEGILANPGFPDSYPNNTHCEWTIVAPSGRPLSVGFPFLSIDSPGGCDQNYLILFNGPDANSPPFG----PFCGIDTVVAPFHASSNRVFIRFHAEYATVSSGFEIMWS 3622          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. UniProt/SwissProt
Match: sp|O60494|CUBN_HUMAN (Cubilin OS=Homo sapiens OX=9606 GN=CUBN PE=1 SV=5)

HSP 1 Score: 879.011 bits (2270), Expect = 0.000e+0
Identity = 938/3813 (24.60%), Postives = 1612/3813 (42.28%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIP--INLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITACNQNMYFNKKFIVNRFM-------VHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI--PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREML--------SENHLK-VENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFY-AETRKIAISFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIH-DNQTK--RFCGNHAKSGPTVT---HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEKLSNS-FTCFYSIKVPQFKKILI---NITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIK-----INHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCE--------FPITSSSGRIESKNEMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGK--MANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS-NYDAKV---FCGSGVIDSAIFTPPVTL-ILSAEGYRYPGFLIRW---NPPVDENFKKI--GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII--CNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLD--ENCSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM--NQGC---FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEV--FGSGAT----ISFSYNSDQPSLCGSNIYPNNNES-----GVITIENVNISL-CQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM---SNYRVE-IG----YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCG-LNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRI---IDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYL---------PGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFM--GELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL---GNNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISW 11188
            PR+ ++ GN++F T S+++I F T + G+I+LND DLS    +I+K           K+   EL  S + +     +++ + +   N K+  LE +   +++ +    C++NPC NG  C++ ++SF CICP  +KG  C+ DVNEC   SGT   CQNG  C NT+GS+ C C  +  G  C    + C   S    C HG C         +P + C+CD+GW   P +  C  D DEC     PCS    V C NT G   C  CP G++GNG+ C DINEC       +  P  ECVN  G+  C+      +    +C L ++C  +NGGC  +A+CS+    +   +CTC PGY+G+G G NGCV +S N+       C+    C NG  C  +++G+ C+C  G+ G  C   IN +CLSNPCLNGG C     + + C C  L++G  C+    VCG + +  N       F+   P         C W I +   + L+I      L+ + +C  E++Q+++      +   +G++C   +S P    ++ + L        +++   GF ++        +  +C     G         G  +SP +P  Y    +C             V     TL L +   +C + DYL+I    R+  +        F   F V           +HFHSDS+  ++   F   +  + S   CG   T +P   +  P +  P      C + +KQ    ++                +  +  E+        ++I  +  E L        + +H+K + N  +I FK    +    F+   + ACG+ +  + +     +S  +P  Y G   C +  +  +++ I ++F  F+I   + C+ D+++I  S+      +++YC  +    IT   N     + +TF  +S+    GF AK S  D      LT          H N         Y     CTW I    +  I  +F+ FHLE H NC  DYLE+   D++T   R+CG      P++T   + L++ FV+D+ ++ EGF++ +  +     C + +    G  T+P       + + C Y I V   + I +   N ++ E+ G+ +      +         +G    +N+ PT      I + SN   + +   Q      F+   + SS    CG    ++ G   SPNYP+    ++ C W ++S+ G    ++     + H  + ++D   + +  +     +T       +C ++   +      S+ +  +     + R F+  Y Q CE        + I  S G     +E  ++C+W + +  G+ +      FDL    N     ++ + D    +  + CG  L     T+S+  +++   TD      V R  +G  +++   GC           + S   G   S  FPN    N +C W  +T PG S++L     ++E    C+   +L  +         + Q C +      + + S+ +   ++F +    NG  R F  +++     C        G I SPNYP+ Y  N  CSW ++V  +  + L   DF+ E    +   +  +  +++ + +L   CG+  +AN I     S  N + ++F++  +  +RGF+A++ + CGG  +   S   + SP +P  Y  P+   C W + A      + + F     E    +  C+ D  + I++G   ++ ++   C     HPI   S+   L+ +  S+     F        S CGG FY+ +G+F SP YP+    +++CV+ I +SPG+ + LS   F  E++      DF++IR G N T  L+GR+   S   NY+       ++W+R  S G    +   F A +  I  N      +G +ASP +   Y  ++   WTV   +S  +     +  +   + N  C    L IYD  +  A++   +CG+     +     +T    S       GFL+ W   + P D     I  G C   ++  +    L SP +P+    R  CTW I    +  +++ +LS D+ES   C Y++  +   G  N     +     V CG            Y+F    I + +D      GF  S+ K+C   + +   G + + +YP     N NC++ +L    L   ++       P  +  C  G   +L                N   CGS+    L    T+ + + V    + S+E +  GF+I Y  K   CGG   +    DS     + N  H  P   +C W   +PP TR+Q+ FE+     +   C  ++L   DG  +    +    FCG +  +S ++ G V+ + F++ +  ++  F+ K  I  CGG +  + G + S  +P L Y     C W + G S   + ++F D +L     C K  + +     S N ++   C ++  D I T  +T  + F T+   T  GF+L++      CGG+         S NYP        C W+I     +RI +    L++  +  C     I   G+   S  L  +C+S   + EI +  + ++V  F  G+      + SY S + ++CG ++ PN  E      G   + N + +L C++ + N  +   ++S+   D          F  +     +  V +F  G  +   M+      K    +  P  +V +   +N RVE IG    Y F+ CGG+     G I SP YP  Y   T C  L+ AP+   I LT     +E H  C +D + +R     +SP   + CG  NP    T+    N++ ++F+SD S+   GF   +N       C GI  +  G+I+SP++P+ +P N RC+WT    +   + ++F   F L  +    C    +++    +     LL+  CGN+ P  P+ +  N  + VF +      +GF A + S CG  +    G I+S N       ++ C Y+I    N L VV +   F                 +G ++         P   +CG        +    +   Y+        + F  R +    V  FS      ++ +P +  + Y ++ +  +        +  +     D+  S   C++D+++    ++ S   +  FCG+    +    + ++L+V F++D   ++   G+      T GP  GCGGY+  +  T+    S D D+NG+Y+ NL C W I AP    + + F  N+ +LE  S    C YD++ +YDG      +  T CG        +  N + + F +D  +++ GF  T+T +          T   Q + S   PN+S  D+ F     +I +     + ITV  L++ +S +C+ +   +QD+   H N   +FC  + S   VF SS    ++ ++ G + N NS    R   +Y++  CNR      G + +        Y ++  C +TL  P  N     +F    +E S  C  D+++   G       +L K CG+ +P    + ++ + + F +D   +  GY+I +     PS  CGG +Y D G  TSPG+   Y  +  C W +   +   +   F  + +   G+      T Y   +    S G     YCG       F   S+   +++ +      + FR++W
Sbjct:   42 PRMATERGNLVFLTGSAQNIEFRTGSLGKIKLNDEDLSECLHQIQKN----------KEDIIELKGSAIGL----PQNISSQIYQLNSKLVDLERKFQGLQQTVDKKVCSSNPCQNGGTCLNLHDSFFCICPPQWKGPLCSADVNECEIYSGTPLSCQNGGTCVNTMGSYSCHCPPETYGPQCASKYDDCEGGS-VARCVHGICEDLMREQAGEPKYSCVCDAGWMFSPNSPACTLDRDECSFQPGPCST--LVQCFNTQGSFYCGACPTGWQGNGYICEDINECEINNGGCSVAPPVECVNTPGSSHCQACPPGYQGDGRVCTLTDICSVSNGGCHPDASCSSTLGSLP--LCTCLPGYTGNGYGPNGCVQLS-NI-------CLSHP-CLNG-QCIDTVSGYFCKCDSGWTGVNCTENIN-ECLSNPCLNGGTCVDGV-DSFSCECTRLWTGALCQVPQQVCGESLSGIN-----GSFSYRSPDVGYVHDVNCFWVIKTEMGKVLRITFTFFRLESMDNCPHEFLQVYDGD--SSSAFQLGRFC--GSSLPHELLSSDNALYFHL-YSEHLRNGRGFTVR-----WETQQPECGGILTGPY-------GSIKSPGYPGNYPPGRDCVWIVVTS--PDLLVTFTFGTLSL-EHHDDC-NKDYLEI----RDGPLYQDPLLGKFCTTFSVPPLQTTGPFARIHFHSDSQ--ISDQGFHITYLTSPSDLRCGGNYT-DPEGELFLPELSGPFTHTRQCVYMMKQPQGEQI---------------QINFTHVELQCQSDSSQNYIEVRDGETLLGKVCGNGTISHIKSITNSVWIRFKIDASVEKASFRAVYQVACGDELTGEGV----IRSPFFPNVYPGERTCRWTIHQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSFITSVYN----FLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPN--------VYPHGINCTWHILVQPNHLIHLMFETFHLEFHYNCTNDYLEVYDTDSETSLGRYCGKSIP--PSLTSSGNSLMLVFVTDSDLAYEGFLINYEAISAATACLQDYTDDLGTFTSPNFPNNYPNNWECIYRITVRTGQLIAVHFTNFSLEEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPT------IISHSNKLWLKFKSDQIDTRSGFSAYWDGSSTG--CGGNLTTSSGTFISPNYPMPYYHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQ------LCGDEKPPLIRSSGDSMFIKLRTDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYPNPYSEN-QHCNWTIRATTGNTVNYTFLAFDLEHHINCST-DYLELYDGPRQM-GRYCGVDLPPPGSTTSS-KLQVLLLTD-----GVGRREKGFQMQWFVYGC---------GGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEYHSRCNFD-VLEIYGGPDFHSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSING--RGFNASWQAVTGGCGGIFQAPSGEIHSPNYPSPYRSNTDCSWVIRVDRNHRVLLNFTDFDLEP---QDSCIMAYDGLSSTMSRLARTCGREQLANPI----VSSGNSLFLRFQSGPSRQNRGFRAQFRQACGG-HILTSSFDTVSSPRFPANY--PNNQNCSWIIQAQPPLNHITLSFTHFELE---RSTTCARD-FVEILDGGHEDAPLRGRYCGTDMPHPITSFSSALTLRFVSDSSISAGGFHTTVTASVSACGGTFYMAEGIFNSPGYPDIYPPNVECVWNIVSSPGNRLQLSFISFQLEDSQD-CSRDFVEIREG-NATGHLVGRYCGNSFPLNYS--SIVGHTLWVRFISDGSG--SGTGFQATFMKIFGNDNIVGTHGKVASPFWPENYPHNSNYQWTVNVNASHVVHGRILEMDI-EEIQN--CYYDKLRIYDGPSIHARLIGAYCGTQTESFSSTGNSLTFHFYSDSSISGKGFLLEWFAVDAP-DGVLPTIAPGACGGFLRTGDAPVFLFSPGWPDSYSNRVDCTWLIQAPDS-TVELNILSLDIESHRTCAYDSLVIR-DGDNN-----LAQQLAVLCGREIPGPIRSTGEYMF----IRFTSDSSVTRAGFNASFHKSC-GGYLHADRGIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTL---FTSDNQMFVQFISDHSNEGQ--GFKIKYEAKSLACGGNVYI-HDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPIL--SKFCGTSLPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGGRVPGQSGVVESIGHPTLPYRDNLFCEWHLQGLSGHYLTISFEDFNLQNSSGCEKDFVEIWDNHTSGN-ILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIVFNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGSRPYGGFTASYTSSEDAVCGGSL-PNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFED----------FYLESHQDCQFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSFTDCGGIQIGDSGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPIIGQYCGNSNP---RTIQSGSNQLVVTFNSDHSLQGGGFYATWN--TQTLGCGGIFHSDNGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNF-LIPSGDGQCQNSFVKVWAGTEEVDKALLATGCGNVAP-GPVITPSNTFTAVFQSQ-EAPAQGFSASFVSRCGSNFTGPSGYIISPNYPKQYDNNMNCTYVIEA--NPLSVVLL--TFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFATVCGDEMPAPLTIAGPVLLNFYSNEQITDFGFKFSYRIISCGGVFNFSSG----IITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDVVPS-TSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLV-FKTD--SFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTF---ASPDSDSNGMYDKNLNCVWIIIAPVNKVIHLTF--NTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMPCGGTYNATWTPQNISS---PNSSDPDVPFSICTWVIDSPPHQQVKITVWALQL-TSQDCTQNYLQLQDSPQGHGNSRFQFCGRNASAVPVFYSSMSTAMVIFKSG-VVNRNS----RMSFTYQIADCNRDYHKAFGNLRSPG--WPDNYDNDKDCTVTLTAPQ-NHTISLFFHSLGIENSVECRNDFLEVRNGS-NSNSPLLGKYCGTLLPNPVFSQNNELYLRFKSDSVTSDRGYEIIWT--SSPS-GCGGTLYGDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINFYFISIDDPGDCVQNYLTLYDGPNASSPSSG----PYCGGDTSIAPFVASSNQVFIKFHADYARRPSAFRLTW 3621          

HSP 2 Score: 234.958 bits (598), Expect = 8.268e-60
Identity = 373/1620 (23.02%), Postives = 648/1620 (40.00%), Query Frame = 2
Query: 4472 GVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFD----IIEMESSINCSEGPILRAWENEIVDENYVFQACNRI-DDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEM----SGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILD-FETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKY-FETCGGLRMAMESN--QFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFE--GGSNNPNCSSDNSLTIIEGIGNNSS--VKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAIS----YILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYK---FNDSVWIRLRSQGGDFTNHIKFLAKY-----HINYNTEFRSDYGVLASPQFGHV--YNQDTEITWTVFA--ESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV---FCGSGVIDSAIFTPPVTL---ILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGS-KNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKK---ACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILA--MNINKTL----CGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDF-----EELVISRIICNESFLAFFDGSTTFTQKIGGQNFCG-KTNSIFTI-GNVLTILFKN--MDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDL--DENCSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKY---FFEDFMCGG-------EYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRA--------RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNS-----DQPSLCG----SNIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFV---SKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL---NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSE--LCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS 9022
            G+I S ++P +  +N++C W+     G ++ + F+    I   +SS N  +  +LR   +                    S  + +S +  +++F S +   G  + F+  YE  + +C   +    + S G + SPN+P+ YP +  C W L       I L+  D F+ E +  C  +Y+E+   +++D   L   CG     + +   S    M ++FR+D++ +  GFKAKY    CGG R+  +S   + +  P  P+   L    CEW+L       GL   +  + FE     N+  C  D     +E   N++S  +    C  +    I   SN   ++ +   +   + F+  +      CGGD     G FTSP YPN       C + I    G  I L           S    +++  F  IR+   +   L       +EI++     K   F D      R  GG       F A Y      +   +   +  G   SP +  V  Y+++    WT+    + +  +   F+ F +    D   C    L     + D  +    CG       +  P   +    ++ E   + GF  +++   D    +IGD          + ++TSPNYPN   +   C+  +   +   + +    FD+E    C +++ TV   GS ++PI    +Y     CG   NS     Q+   N + +T+ +D      GF  ++      C   F +   G++++  +P    EN  C++   +H   ++ ++     L P  +G+C N F+K+ A    ++K L    CG N+ P   P+IT S+     +F   S E+   GF   +  +   CG     + +       ++ N      + + C +   + P + + + F     E        C    +    G +  +        CG +  +  TI G VL   + N  + DF  F+   +I SCGG+ +   G I SP Y   +YP    C++ I+      I L F D D+    +CS   L +     + + ++   C S    ++ +  +++ ++FKT++  T KG+K+ +         CGG        ++ P+ + N   Y K L+    C W I   V+K I +      +     R R          G    + L    C S +    I + + +   F S  T+    +N+     D P  CG    +   P N  S   +  +V  S+C + I + P  +  ++++    T   C+  Y     S  G+G     +  G   +     YS  +   V   IF+ G  V   N R+   Y+ + C     ++FG ++SPG+P+ Y ++ DC   + AP+N  I L   +L +E+ ++C  D L +R     +SP   K CG    NP+ ++      N + L F SD   S  G+ I +   +    C G ++   GS  SP YP  YP+N  C W +  P G  V++ F   + +       C  + L + D    +  S    CG      P  +S NQ+ + F  D+      F   + S
Sbjct: 2101 GIITSPKYPETYPSNLNCSWHVLVQSGLTIAVHFEQPFQIPNGDSSCNQGDYLVLRNGPDICSPPLGPPGGNGHFCGSHASSTLFTSDNQMFVQFISDHSNEG--QGFKIKYEAKSLACGGNVYIHDADSAGYVTSPNHPHNYPPHADCIWILAAPPETRIQLQFEDRFDIEVTPNCTSNYLELRDGVDSDAPILSKFCGTS---LPSSQWSSGEVMYLRFRSDNSPTHVGFKAKYSIAQCGG-RVPGQSGVVESIGHPTLPYRDNL---FCEWHLQ------GLSGHYLTISFEDFNLQNSSGCEKD----FVEIWDNHTSGNILGRYCGNTIPDSIDTSSNTAVVRFVTDGSVTASGFRLRFESSMEECGGDLQGSIGTFTSPNYPNPNPHGRICEWRITAPEGRRITLMFNNLRLATHPSCNNEHVIV-FNGIRSNSPQLEKLCSSVNVSNEIKSSGNTMKVIFFTDGS----RPYGG-------FTASYTSSEDAVCGGSLPNTPEGNFTSPGYDGVRNYSRNLNCEWTLSNPNQGNSSISIHFEDFYLESHQD---CQFDVLEFRVGDADGPLMWRLCGPSKPTLPLVIPYSQVWIHFVTNERVEHIGFHAKYSF-TDCGGIQIGD----------SGVITSPNYPNAYDSLTHCSSLLEAPQGHTITLTFSDFDIEPHTTCAWDSVTVRNGGSPESPIIG--QY-----CG---NSNPRTIQSGS-NQLVVTFNSDHSLQGGGFYATWNTQTLGCGGIFHSD-NGTIRSPHWPQNFPENSRCSWTAITHKSKHLEISFDNNFLIPSGDGQCQNSFVKVWAGTEEVDKALLATGCG-NVAPG--PVITPSN-TFTAVFQ--SQEAPAQGFSASFVSR---CG-----SNFTGPSGYIISPNYPKQYDNNMNCTYVIEANPLSVVLLTFVSFHLEARSAVTGSCVNDGVHIIRGYSVMSTPFA--TVCGDEMPAPLTIAGPVLLNFYSNEQITDFG-FKFSYRIISCGGVFNFSSGIITSPAYSYADYPNDMHCLYTITVSDDKVIELKFSDFDVVPSTSCSHDYLAIYDGANTSDPLLGKFCGSKRPPNVKSSNNSMLLVFKTDSFQTAKGWKMSFRQTLGPQQGCGGYLTGSNNTFASPDSDSNGM-YDKNLN----CVWIIIAPVNKVIHLTFNTFALEAASTRQRCLYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFISDLTLEREGFNATYTIMDMP--CGGTYNATWTPQNISSPNSSDPDVPFSICTWVIDSPPHQQVKITVWALQLTSQDCTQNYLQLQDSPQGHG-NSRFQFCGRNASAVPVFYSSMSTAMV---IFKSG--VVNRNSRMSFTYQIADCNRDYHKAFGNLRSPGWPDNYDNDKDCTVTLTAPQNHTISLFFHSLGIENSVECRNDFLEVRNGSNSNSPLLGKYCGTLLPNPVFSQ-----NNELYLRFKSDSVTSDRGYEIIWT--SSPSGCGGTLYGDRGSFTSPGYPGTYPNNTYCEWVLVAPAGRLVTINF---YFISIDDPGDCVQNYLTLYDGPNASSPSSGPYCGGDTSIAPFVASSNQVFIKFHADYARRPSAFRLTWDS 3623          

HSP 3 Score: 206.068 bits (523), Expect = 4.103e-51
Identity = 238/989 (24.06%), Postives = 397/989 (40.14%), Query Frame = 2
Query: 8276 NMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPAD-TCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFF--GCRYHDNQIQIDLEDQNGNYLP-GQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDT-NVLIVRF--QSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYD-GYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLG-----NNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSS--FTVEYKSLTGGVGAGFRISWSPV 11197
            N   + V    +   CGG+LT  +G IKSPGYP  YP   DC W+++   ++++  T  TL LEHH DCN D+L IR    +  P   K C     S   L       R+ FHSD  +S  GF I Y   +P+D  C G   + EG +  P    P+    +C + +  P+G ++ + F    +L+  S  + +Y  +R    +  TLL ++CGN   S+ I S  N + + F  D +     F A Y+  CG      +G I S     +  G  TC + I   +   QV+ +    F  G   H     +++   +    P  ++ CG       I    +   V   ++   +N+ F A++  ++        +    +++P  P+ Y H  N TW       ++  +   +  +E  Y+ C  D++      S +S   +CG   +I P +  + N L++ F   SD+++      + A    T      C       +GT+    +   +    +E    C ++I    G  + V F N S+       +G    D + I DG     P++    G +   +I + SN ++L F +D    +SGF   +    S       +T  S    SP YP    Y        + ++      +  KD  +    NC+LD   + D    + + + + C       +  SS D + I+     +        R F+  Y     N      +  I+    +    YS N  CN T+     N    + F  F+LE    C+ DY++   G     +Y     CG  +PP   T SS++ ++ +TD     + G+ + + V       CGGE+   +G  +SPGF   Y  + EC W I+    S I+    D  +      N   LE   Y   DF    +  +  + C     +   Q+ S+     + +K+     G GF  SW  V
Sbjct:  575 NGRGFTVRWETQQPECGGILTGPYGSIKSPGYPGNYPPGRDCVWIVVTSPDLLVTFTFGTLSLEHHDDCNKDYLEIRDGPLYQDPLLGKFC--TTFSVPPLQTTGPFARIHFHSDSQISDQGFHITY-LTSPSDLRCGGNYTDPEGELFLPELSGPFTHTRQCVYMMKQPQGEQIQINFTH-VELQCQSDSSQNYIEVR----DGETLLGKVCGNGTISH-IKSITNSVWIRFKIDASVEKASFRAVYQVACGDEL-TGEGVIRSPFFPNVYPGERTCRWTI--HQPQSQVILLNFTVFEIGSSAHCETDYVEIGSSSILGSPENKKYCGTDIPSF-ITSVYNFLYVTFVKSSSTENHGFMAKFSAEDLACGEILTESTGTIQSPGHPNVYPHGINCTWHILVQPNHLIHLMFETFHLEFHYN-CTNDYLEVYDTDSETSLGRYCGK--SIPPSLTSSGNSLMLVFVTDSDLAYEGFLINYEAISAAT-----ACLQDYTDDLGTF-TSPNFPNNYPNNWE----CIYRITVRTGQLIAVHFTNFSL----EEAIGNYYTDFLEIRDGGYEKSPLLGIFYGSNLPPTIISHSNKLWLKFKSDQIDTRSGFSAYWDG--SSTGCGGNLTTSSGTFISPNYPMPY-YHSSECYWWLKSSHGSAFELEFKDFHLEHHPNCTLDYLAVYDGPSSNSHLLTQLCGD-EKPPLIRSSGDSMFIK-----LRTDEGQQGRGFKAEYRQTCENVVIVNQTYGILESIGYP-NPYSENQHCNWTIRATTGN-TVNYTFLAFDLEHHINCSTDYLELYDGPRQMGRY-----CGVDLPPPGSTTSSKLQVLLLTDGVGRREKGFQMQWFV-----YGCGGELSGATGSFSSPGFPNRYPPNKECIWYIRTDPGSSIQLTIHDFDVEYHSRCNFDVLE--IYGGPDF----HSPRIAQLCTQRSPENPMQVSSTGNELAIRFKTDLSINGRGFNASWQAV 1506          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. UniProt/SwissProt
Match: sp|F1RWC3|CUBN_PIG (Cubilin OS=Sus scrofa OX=9823 GN=CUBN PE=1 SV=3)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 944/3829 (24.65%), Postives = 1584/3829 (41.37%), Query Frame = 2
Query:  164 PRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYS--RKIESLETSLTTSNHKISA----LENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGR--ICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYA-VSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQIIPINLQL--LGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITACNQNMYFNKKFIVNRFM-VHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAI--PADVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLK-VENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFY-AETRKIAISFLDFDINDDSECKFDFIKISGSN--SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL---IHDNQTKRFCGNHAKSGPTV-THKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSG-----------LITNPTL-EKLSNSFTCFYSIKVPQFKKILINIT---VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR---------FRLYYTQDCE--FPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAI----FKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKY-HINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYD-SNYDAKV---FCGSGVIDSAIFTPPVTLILSAE-GYRYPGFLIRW--NPPVDENFKKI--GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFIL--------------------RSHFLN---YILNLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVISRII--CNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK--NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKESENA--VIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNY--PKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCF-----RIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEV--FGSGAT----ISFSYNSDQPSLCGSNIYPNNNESGVITIENVNISLCQYNIHNYPED---EGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM---SNYRVE-IG----YKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCG-LNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT---LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRY------HDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFS-DFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAV--PSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL---GNNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            PR+ ++ GN++F T  +++I F T + G+I+LND                     D+ +C  ++  +K +I +  R I  L  ++++  H++ +    LE     ++  +    C++NPC NGA C++ ++SF CICP  +KG  C++DVNEC   SGT  GCQNGA C NT GS+ C+CS +  G  C    + C   S    C HG C         +P F+C+C +GW+    +  C  D DEC     PCS    V C NT G   C  CP G++GNG+ C DINEC       +  P  ECVN  G+Y C       +    MC L ++C  NNGGC  +AACS     I G   +CTC PGY+G+G G +GCV +S NV       C+ R      G C ++ +G+ C C  G+ G  C   I N+CLSNPCLNGG C     N + C C   ++G  C     VCGGT + VS  +  +S      P         C W + +   + L+I     QL  + +C  E++Q+H+      A   +G++C    S+P     +    +       +++   GF I+           +C     G       T G  +SP +P KY    +C  K  A       +     TL L +   +C   DYL+I    + ++  +     ++          F  +HFHSD++  +N   F   +    S   CG   T +P  ++ SP +  P      C + I Q    + I++  T     +G      S  E+     +       +T      +H+K + N  +I  K    +    F  + + ACG  +  + +     +S  YP  Y G   C +  +  +++ + ++F  F++   + C  D+I+I  S       +++YC  +    IT   N     + + F  +S+    GF AK S         LT    I     H N         Y     CTW I       I     QFHLE H NC  DYLE+   + D    R+CG       T  T+ L + FV+D  ++ EGF++           YE+ ++S+G           + T+P       N+  C Y I V   ++I ++ T   + E  G      C          G   S  +   C + P    I + SN   + +    + +   F+   + S     CG    +  G   SPNYP+    ++ C W ++S+ G    ++ N        +  L    N  L ++     ++   S  +T++   E+  +     +  S K R         F + Y Q C+    +  + G +ES +    Y     C+W + +  G+ +      F+L    N     ++ + D     + + CG  ++  + +++   +++  +TD      V +   G  +++   GC           + S   G   S  +P    AN +C W   + PG S++L     ++E    C+   +L  +         + Q C +      + + S+ +   L+F + +  NG  R F  ++      C        G I SPNYP+ Y  N  C+W ++V+++  + L   DF+ E    +   +  F  +++   +L  +CG+    +     S  + + ++F++  +  SRGF+A++ + CGG  +  +S   + SP +P  Y  P+   C W + A      + + F   G E  S    C+ D  + I++G  +++ ++   C  S  HPI S G+ L  +L+  S +++    F A Y   +S CGG F++ +G+F SP YP     +++CV+ I +SPG+ + LS   F  E++      DF++IR G N T  L+GR+     +    Y+      +WI+  S G    + + F A + +I  N      +G +ASP +   Y  ++   W V    S+ +     +  V    +   C    L IYD ++  +++   +CG+     +     +T   S++      GFL+ W      D     I  G C   ++  +    L SP +P        C W I    +  +++ +LS D+ES   C Y+   +   G  N     +     V CG            Y+     I + +D      GF  S+ K+C   + +   G + +  YP     N NC++ +                    R  F N   Y++     D+  P  G              N   CGS     L    T+ + + V    + S+E +  GF+I Y  K   CGG   +     S  V  + N     P   +C W   +P G  ++++FE+     I   C  S+L   DG+ +    +    FCG +   S  + G V+ + F+  N    + F+ K  I  CGG +  + G I S  YP L Y     C W++ G S   + + F D +L +N S      + + E+  +  ++   C ++  D I T  +   + F T+   T  GF+L++      CGG+   P     + NY  P    W   C W+I V   +R+ + +  L++    F          G+   S  L   C+S   + EI +  + ++V  F  G+      + SY S + ++CG ++   N+  G  T    +         NY  +   E TLS     N+ I      F  +     +  V +F     +   ++      K    +  P  +V +   +N RVE IG    Y F+ CGG+     G I SP YP  Y   T C WL+ AP+   I LT     +E H  C +D + +R      SP     CG  NP    T+    N++ + F++D SV   GF   +N       C GI+ +  G+I+SP++P+ +P N RC+WT+       + ++F   F L  +    C    +++          LL+  CGN+ P   I +  N  + VF +      +GF A + S CG  +    G IVS N       ++ C Y+I      + ++ +       R         + + I +   + +  P   +CG        +    +   Y+  N H  ++ F+  Y        F+  F    ++K+P++  S Y ++ +  +        +  +     D+  S   C+ D++     S+ S   +  FCG  + + P +  + N + + F++D  H     G+      T GP  GCGGY+  +  T+G   S D D+NG Y+ NL C W I AP    +K+ F  ++ +LE  + +  C YD++ +YDG      +  T CG        +  N + + F +D ++++ GF  T+T +  P       T T+ S    S   P+     L     +I A     + ITV   ++ S  +C  +    +D   ++ N   +FC  + S    F SS    II ++    E  N  TD R   +Y +  C+R  +   GR+ +        Y+ +  C + L  P  N     +F  F LE S  C  D+++   G       +L K CG+ +P    + S  + + F +D + +  GY+I +     PS  CGG +Y DSG++TSPG+   Y     C W I       +   F+ + +   G         Y   D    S G     YCG       F   S    + + +      +  R++W+
Sbjct:   43 PRMAAERGNLVFFTGLAQNIEFRTGSQGKIKLND--------------------EDVGECLRQIQKNKFDIMNLKRGIIGLPQNVSSQIHQLESKLVDLERRFQSLQLTVDGKVCSSNPCQNGATCLNLHDSFFCICPSQWKGPLCSDDVNECEIYSGTPLGCQNGATCINTPGSYSCLCSPETHGPQCASKYDDCEGGSEMR-CVHGICEDLTRVQAGEPRFRCICHAGWTSPSNSTACTLDRDECSSWPAPCSA--LVPCFNTLGSFYCGACPTGWQGNGYICEDINECEINNGGCSVAPPVECVNTPGSYYCPSCPPGYQGDGRMCTLIDLCSVNNGGCHPHAACSL----ILGSLPLCTCLPGYTGNGYGLHGCVPLS-NV-------CLTRPCLH--GQCMETASGYVCNCDSGWAGMNCTENI-NECLSNPCLNGGTCVDGI-NAFSCECTRFWTGSLCHLPQQVCGGTMSDVSGSFSYMS------PDVGYVHDVDCFWVLRTEEGKVLRITFTFFQLESVDNCPHEFLQIHDGD--SPAAFPLGRFC---GSSPPHELLSSDNALYFHFFSEHLRNERGFTIR-----WETRQPECGGVLTG-------TYGSLKSPGYPGKYPPGRDCVWKVIAS--PDLLITFTFGTLSL-EHHDDCR-KDYLEIRDGPLHQDPVLGKFCTSLSVPPLQTTGPFARIHFHSDNQ--INDQGFHITYLTTPSDLHCGGNFT-DPEGLL-SPDLSGPFTHSRQCIYVITQPLGEQ-IQVNFTHVE-LEGQSGCSQSYIEVRDDQTLLGKVCGNET-----PSHIKSITNSIWIRLKIDASVVRASFGAAYQVACGGELTGEGV----IRSPFYPNVYPGERICRWTIHQPQSQVVLLNFTAFEMGSSAHCDTDYIEIGSSPVLGSPENKKYCGTDIPSFITSVYN----SLHVVFVKSSSTENHGFMAKFSTEALACGEILTESSGIIQSPGHPN--------IYPHGVNCTWHILVQPGHLIHLEIRQFHLEFHYNCTRDYLEIYDTVSDTSLGRYCGKSIPPSLTSNTNSLKLIFVADADLAYEGFVIN----------YEATDASAGNTTALLYRRIWIFTSPNFPSNYPNNMECIYRITVETSQQIALHFTDFSLEEPIGGA----CAADYVEITNGGYASSPPLGKYCGSNPP-PRIISHSNKLWLKFKSDFFGSGPGFSAYWDGSLTG--CGGNLTTPTGTFTSPNYPMPYYHSSECFWWLKSSHGSPFELEFN--------DFHLEYHPNCTLDYLDVYDGLS-TSSHLLTRLCGNEKPPLIRSTGDSMSLKLRTDEGQQGGGFLVKYQQTCDNVVIVNRTYGILESIHYPKPYSVNQRCNWTIQATAGNTVNYTFLAFELESHANCST-DYLELYDGPQR-MGRFCG-AVIPPSGSTTGSRLQVLFHTD-----GVGQGERGFQMQWLVHGC---------GGELSGDTGTFSSPGYPVGYPANKECIWYIHSSPGSSIQLTIHDFDVEYHATCNFD-VLEIYGGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNG--RGFNVSWRAVPGGCGGIFQAPSGEIHSPNYPSPYRSNTECTWLIQVEKNHRVLLNFTDFDLEP---QDSCIMAFDGLSSATARLVGVCGRQQ--LSNPIISTGSSLFVRFQSGPSRQSRGFRAQFRQACGG-HILTDSFDTISSPRFPASY--PNNQNCSWIIQAQPPFNHITLSFSHFGLESSS---TCTRD-FVEILDGSHSDAPLRGRYCGSSMPHPITSFGNAL--MLRFVSDSSVNFDGFHATYVASTSACGGIFHMAEGIFNSPGYPEVYPSNVECVWNIASSPGNQLQLSFITFQLEDSRD-CSRDFVEIREG-NATGRLVGRY--CGNVLPLNYSSIIGHDLWIKFVSDGSG--SGVGFQAAFNNIFGNDHIVGTHGKVASPLWPRNYPHNSNYQWIVNVNESQVIHGRILEMDVEGTFN---CYYDKLRIYDGADIHSRLIGTYCGAQTESFSSTGSSLTFQFSSDSSISGRGFLLEWFAMDASDGPLPTIATGACGGFLRTGDAPVFLYSPGWPGSYSNGADCMWLIQAPDS-TVELNILSLDIESHRTCDYDKLVIR-DGDNN-----MAQELAVLCGREIPGPIRSTGEYM----TIRFTSDFSVTRAGFNASFHKSC-GGYLHADRGIITSPGYPEAYTSNLNCSWHVQVQQGLSIAVHFEQPFQVSNRDAFCNQGDYLVLKNGPDIYSPPLGP----------HGGNGRFCGSRPSSTL---FTSDNELFVQFISDNSNEGQ--GFKITYEAKSLACGGNIYIHDADSSGYV-ASPNHPDNYPQHADCIWVIAAPSGRPIRLEFEDQFSIEITPNCTSSYLELRDGADSNAPVLA--KFCGTSLPPSQLSSGEVMYLRFRSDNSPTHAGFKAKYSIAQCGGTVTGQSGVIESSGYPALPYANNLFCEWRLQGLSGHYLTIHFEDFNL-QNSSGCERDFVEIWENHTSGNLLGRYCGNTVPDSIDTSGNVALVRFVTDGFLTASGFRLRFDSSMEGCGGDLQGPTGTFTAPNYLNPNPHGWM--CEWRITVQEGRRVTLTLNDLRLEAHPFCNSEHVAVFNGIRSNSPQLEKRCSSVNGSNEIRSSGNTMKVVYFTDGSRPYGGFTASYTSSEDAVCGGSL--TNSPEGNFTSPGYD------GTRNYSRNLNCEWTLSNSNQGNSSIYIDFEDFYLESHQDCQFDVLEFRVDNADGLLIWRLCGSSKPTMPLVIPYPQVWIHFVTNERVEHIGFRARYSFTDCGGIQIGDHGVISSPNYPASYDSLTHCSWLLEAPQGHTITLTFSDFDIEAHASCAWDSVTVRNGGSPGSPIIGHYCGSSNP---RTIQSGSNQLVVIFNTDSSVQNGGFYATWN--TETSGCGGILHSDTGTIRSPHWPQNFPENSRCSWTVITHPSKHLEISFDNNF-LIPSGDSQCLNSFVKVWAGTQEADKDLLATSCGNVSPGR-IITPRNAFTAVFQSQ-ETPAQGFSASFLSRCGRNFTNPSGYIVSPNYPKQYDNNMNCTYIIEASPLSVILLKVVSFHLEARSTVSGSCDSDGVHI-IRGHSLSSTPLVTLCGDEALSPVTISGPVLLNFYS--NAHTTDFGFKFSYRITPCGGTFNLSFG---IIKSPSYSYSNYPNDMHCLYTVTVRDDRVIQLKFNDFDLVPS-TFCSQDYLEIYDGSNISDPLLGKFCG--STLPPNVKSSNNTMFLVFKTDSVHTAR--GWKISFRETLGPQQGCGGYLTGSTHTFG---SPDSDSNGRYDKNLNCIWFITAPVNKLIKLTF--STFALEAATSLQRCIYDYVKLYDGDSENANLAGTFCGSTVPAPFISSGNFLTVQFVSDSSLEREGFNATYTLLDMPCGGTYNATWTSQSIWSPSSSDPD---VPLTTCTWVIEAPLHQQVEITVWTFQLHSQ-DCDQNYLEFRDPPERNGNPGIRFCGRNASAVPTFYSSLSTAIIIFK---SEVFN--TDSRVGFTYRIAGCSREYQKAFGRLRSPG--WPAGYASDADCAVVLRAPQ-NHTISLFFHAFGLEDSGGCTRDFLEVRNGSESTSP-LLGKYCGTLLPNPIFSQSRDLYLRFKSDSATSGRGYEIIWT--SSPS-GCGGTLYGDSGLVTSPGYPGTYPNHTHCEWVIIAPGGRPVTVSFSFISIDDPGECVQNYLMLYDGPDANSPSSG----PYCGADTDVAPFAASSHRVFIRFHAEAAARPSALRLTWA 3624          

HSP 2 Score: 486.108 bits (1250), Expect = 5.756e-136
Identity = 705/2994 (23.55%), Postives = 1159/2994 (38.71%), Query Frame = 2
Query: 1634 CIWTIISSNDQ--FLQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNST--PTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITA-CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRLIRLKGT---FENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYA-ETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQ-TKRFCGNH-AKSGPTVTHKLVIRFVSDNSVSGE-GFIMRFYTVKRDQYCYESFESSSGLITNPTLEKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLG---QATLKXXXXXXXXX---XXXNVCPTCPQRE-----EIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPI------TSSSGRIESKNEMLRYCSWKLSSLRG-SKILIQIDKFDLPPLQNGQC-YSFVRISDRSNT---LLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSST---HNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE--------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFKAAYGVG-SSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEE-FSRENAISYILH-DFIDIRNGPNETSSLLGRFYTLSEI---RNYTYNYKFNDSVWIRLRS------QGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTF-DQFSVGRRLDNGQCNRGNLIIYD-SNYDAKV---FCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKK---IGDCEYIIKATNQTQILTSPNYPNFDITRR-FCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIK-----------ITYKADEFDPFPGFKLSYK---KACYKDFRNPLEGSLQNVEYPNKIFENKNCTF---ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKILAMNIN-----KTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMY-SKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSP--PGTRMQIDFEELVI-SRIICNESFLAF----FDGSTTFTQKIGGQNFCGKTNSIFTIG---NVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRI--------IVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNI-----------YP---NNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGI------PCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYP-EKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYN-FINPADTCNGIIFNTEGSIKSPNYPK--PYPSNLRCNWTIHVPEGYKVSLTFKLPFDLER-TSLHTCHYDSLRIIDSNA--VTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI---CGGVYDLRQGEIVSANVALIN--YGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLED---QNGNYLPGQRICGKSREKITIMHSK--SIKIVYTARNFHLKN---YNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCG-DDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA 10102
            C WTI     Q   L      +     C  +Y+++          N   KYC     +   + YN+   + +     K++  +NHGF  K      + E L C        E+   ++G+ QSP  P  Y   +NC      + G    + L+I+   L +   NC+  DYL+I     +  +   C +++  +     N   + F +D+  D+    F   ++   +       +      I  SP  P++      C ++I    +S+ I L  T    E    G C+      EIT  G   +  +            +   N+ ++ FK     S P F      +   CG ++      T  F S NYP  Y  +S C +   +       + F DF +     C  D++ +    S S HL  R C   K  LI    +  + K+    +++    G GF  K             N +I+      L    Y +   Y  N+ C W I       + Y F  F LESH NC+ DYLEL    Q   RFCG     SG T   +L + F +D    GE GF M++        C       +G  ++P            Y +  P  K+ +  I  S        I        AT       I          +   C QR      ++ ++ N   + +      N   FN  +++ ++   CG I  +  G I SPNYP    +NT C W I+     R+L+          D   +  D    L   TA+  + +   +Q++   +    S+ V FQ+  S + R FR  + Q C   I      T SS R  +     + CSW + +    + I +    F L    +  C   FV I D S++   L  + CG+ + +   TS    + +   +D S + +   A         T  C   F+            G+  S  +P    +N++C WN  + PG  ++L F   ++E S +CS   +      EI + N   +   R   G  + +  S+   H+ ++KF S  D +G    FQ    F N      + G+ G + SP +P  YPHN    W + V ES  IH +IL+ + E +  C YD + I+   +     +   CG         FSS  + +  +F +D ++S RGF  ++F                CGG     ++  FL SP +P  Y+     C W + A  S + L I    +      ++  C  D  L I +G  N +   AVLC +    PI S G Y+ +  + TS  ++ +A +      +CGG  + D G+ TSP YP +   +L+C + ++   G SI +  E+ F   N  ++    D++ ++NGP+  S  LG           R  +  +  ++ ++++  S      QG   T   K LA     Y  +  S  G +ASP     Y Q  +  W + A S   ++  F DQFS+    +   C    L + D ++ +A V   FCG+ +       PP  L  S+    Y  F    N P    FK    I  C   +  T Q+ ++ S  YP        FC W +       L I    F+L++S  C+ +               F+E          N++  N+   Y  N++            + +  D F    GF+L +    + C  D + P  G+     Y N       C +   +     +   LN   L+  P  N + V  F  I + +        ++ GSN       I ++ + + V  F + S    Y GF   Y S +D  CGG   LT   +        +        + C+W  ++     + + IDFE+  + S   C    L F     DG   +         CG +     +      + I F   +   +  FR +     CGG+     G I+SPNYP +Y  ++ C W +       I LTF D D++ +  C+  ++TV       + +I   C SS    I +  + + +IF T++     GF   +  E   CGG        + S ++P+      RC+W +    SK +        ++     +      ++ A        LL   C +      I  +++   VF S  T +  +++   S CG N            YP   +NN +    IE   +S+    + ++  +  +      D+ G+        S+   V+  G+    PV   G                 ++NF        + +++  +  Y+ + CGG    SFG IKSP Y    YP++  C + +   ++ +IQL      L     C+ D+L I        P   K CG     N   S   N M L F +D   +  G+ I +   + P   C G +  +  +  SP+      Y  NL C W I  P    + LTF   F LE  TSL  C YD +++ D ++    L    CG+  P+ P  SS N +++ F +D +   EGF+A Y  +   CGG Y+         + +  +      TC ++I     H QV      F       +Q  ++  D   +NGN  PG R CG++   +   +S   +  I++ +  F+  +   + +R      E  K F        L++P +P+ Y  +A+   +  AP  +  S+   +  +E S  GC  DF+     S ++S  +  +CG L   +P    +  L +RF+SD +   +  G+      +P    GCGG +    G  G++ S      G Y N+  C+W I AP G  V V F   SI   G      C  +++ +YDGPD+  P     CG D  V      S+ +++ F  +   + S  +LT+ +
Sbjct:  842 CRWTIHQPQSQVVLLNFTAFEMGSSAHCDTDYIEIGSSPVLGSPENK--KYCGTDIPSFITSVYNSLHVVFV-----KSSSTENHGFMAK-----FSTEALAC-------GEILTESSGIIQSPGHPNIYPHGVNCTWHILVQPG--HLIHLEIRQFHL-EFHYNCT-RDYLEIYDTVSDTSLGRYCGKSIPPSLTSNTNSLKLIFVADA--DLAYEGFVINYEATDASAGNTTALLYRRIWIFTSPNFPSNYPNNMECIYRIT-VETSQQIALHFTDFSLEEPIGGACAADY--VEITNGGYASSPPLGKYCGSNPPPRIISHSNKLWLKFKSDFFGSGPGFSAYWDGSLTGCGGNLTT---PTGTFTSPNYPMPYYHSSECFWWLKSSHGSPFELEFNDFHLEYHPNCTLDYLDVYDGLSTSSHLLTRLCGNEKPPLIRSTGDSMSLKL----RTDEGQQGGGFLVKYQQT-------CDNVVIVNRTYGILESIHYPKP--YSVNQRCNWTIQATAGNTVNYTFLAFELESHANCSTDYLELYDGPQRMGRFCGAVIPPSGSTTGSRLQVLFHTDGVGQGERGFQMQWLV----HGCGGELSGDTGTFSSPG-----------YPVGYPANKECIWYIHSSPGSSIQLTIHDFDVEYHATCNFDVLEIYGGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNGRGFN--VSWRAVPGGCGGIFQAPSGEIHSPNYPSPYRSNTECTWLIQVEKNHRVLLNFTDFDLEPQDSCIMAFDG---LSSATARL-VGVCGRQQLSNPIISTGSSLFVRFQSGPSRQSRGFRAQFRQACGGHILTDSFDTISSPRFPASYPNNQNCSWIIQAQPPFNHITLSFSHFGLE--SSSTCTRDFVEILDGSHSDAPLRGRYCGSSMPH-PITSFGNALMLRFVSDSSVNFDGFHA----TYVASTSACGGIFH---------MAEGIFNSPGYPEVYPSNVECVWNIASSPGNQLQLSFITFQLEDSRDCSRDFV------EIREGNATGRLVGRYC-GNVLPLNYSSIIGHDLWIKFVS--DGSGSGVGFQAA--FNNIFGNDHIVGTHGKVASPLWPRNYPHNSNYQWIVNVNESQVIHGRILEMDVEGTFNCYYDKLRIYDGADIHSRLIGTYCGAQTE----SFSSTGSSLTFQFSSDSSISGRGFLLEWFAMDASDGPLPTIATGACGGFLRTGDAPVFLYSPGWPGSYS-NGADCMWLIQAPDSTVELNILSLDI-----ESHRTCDYDK-LVIRDGDNNMAQELAVLCGREIPGPIRSTGEYMTI--RFTSDFSVTRAGFNASFHKSCGGYLHADRGIITSPGYPEAYTSNLNCSWHVQVQQGLSIAVHFEQPFQVSNRDAFCNQGDYLVLKNGPDIYSPPLGPHGGNGRFCGSRPSSTLFTSDNELFVQFISDNSNEGQGFKITYEAKSLACGGNIYIHDADSS-GYVASPNHPDNYPQHADCIWVIAAPSGRPIRLEFEDQFSIEITPN---CTSSYLELRDGADSNAPVLAKFCGTSL-------PPSQL--SSGEVMYLRFRSD-NSPTHAGFKAKYSIAQCGGTV--TGQSGVIESSGYPALPYANNLFCEWRLQGLSGHYLTIHFEDFNLQNSSGCERD---------------FVEIWE-------NHTSGNLLGRYCGNTVPDSIDTSGNVALVRFVTDGFLTASGFRLRFDSSMEGCGGDLQGP-TGTFTAPNYLNPNPHGWMCEWRITVQEGRRVTLTLNDLRLEAHPFCNSEHVAVFNGIRSNSPQLEKRCSSVNGSN------EIRSSGNTMKVVYFTDGSRP--YGGFTASYTSSEDAVCGG--SLTNSPEGNFTSPGYDGTRNYSRNLNCEWTLSNSNQGNSSIYIDFEDFYLESHQDCQFDVLEFRVDNADGLLIW-------RLCGSSKPTMPLVIPYPQVWIHFVTNERVEHIGFRARYSFTDCGGIQIGDHGVISSPNYPASYDSLTHCSWLLEAPQGHTITLTFSDFDIEAHASCAWDSVTVRNGGSPGSPIIGHYCGSSNPRTIQSGSNQLVVIFNTDSSVQNGGFYATWNTETSGCGGILHSDTGTIRSPHWPQNFPENSRCSWTVITHPSKHLEISFDNNFLIPSGDSQCLNSFVKVWAGTQEADKDLLATSCGNVSPGRIITPRNAFTAVFQSQETPAQGFSASFLSRCGRNFTNPSGYIVSPNYPKQYDNNMNCTYIIEASPLSVILLKVVSFHLEARSTVSGSCDSDGVHIIRGHSLSSTPLVTLCGDEALSPVTISGP---------------VLLNFY----SNAHTTDFGFKFSYRITPCGGTFNLSFGIIKSPSYSYSNYPNDMHCLYTVTVRDDRVIQLKFNDFDLVPSTFCSQDYLEIYDGSNISDPLLGKFCGSTLPPNVKSS--NNTMFLVFKTDSVHTARGWKISFRETLGPQQGCGGYLTGSTHTFGSPDSDSNGRYDKNLNCIWFITAPVNKLIKLTFST-FALEAATSLQRCIYDYVKLYDGDSENANLAGTFCGSTVPA-PFISSGNFLTVQFVSDSSLEREGFNATYTLLDMPCGGTYNATWTSQSIWSPSSSDPDVPLTTCTWVIEA-PLHQQVEITVWTFQLHSQDCDQNYLEFRDPPERNGN--PGIRFCGRNASAVPTFYSSLSTAIIIFKSEVFNTDSRVGFTYRIAGCSREYQKAFGR------LRSPGWPAGYASDADCAVVLRAPQNHTISLFFHAFGLEDS-GGCTRDFLEVRNGSESTSPLLGKYCGTLLP-NPIFSQSRDLYLRFKSDSA--TSGRGYEIIWTSSPS---GCGGTL---YGDSGLVTSPGYP--GTYPNHTHCEWVIIAPGGRPVTVSFSFISIDDPGE-----CVQNYLMLYDGPDANSPSSGPYCGADTDVAPFAASSHRVFIRFHAEAAARPSALRLTWAS 3625          

HSP 3 Score: 236.498 bits (602), Expect = 2.598e-60
Identity = 248/990 (25.05%), Postives = 417/990 (42.12%), Query Frame = 2
Query: 8276 NMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADT-CNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNYLP-GQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMI-DTNVLIVRFQSDIS-HYENHTGFVAFINPTPGPMLGCGGYMNATVGTY---GVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYD-GYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGN------QALKYCGYILLDEEFQIPSSS--FTVEYKSLTGGVGAGFRISWSPV 11197
            N   + +    +   CGG+LT ++G +KSPGYP KYP   DC W +IA  +++I  T  TL LEHH DC  D+L IR       P   K C    +S   L       R+ FHSD  ++  GF I Y    P+D  C G   + EG + SP+   P+  + +C + I  P G ++ + F     +E      C    + + D    TLL ++CGN  PS+ I S  N + +    D +     F A Y+  CGG     +G I S     +  G   C + I   ++ + ++       G   H +   I++        P  ++ CG            S+ +V+  ++   +N+ F A++  +         +   ++++P  P+ Y H  N TW      G++  + +R   +E  Y+ C  D++      S++S   +CG   +I P +  +TN L + F +D    YE   GFV     T           N T   Y    +  S +  +N  Y NN+ C ++I       + + F +   SLE     G C  D++ I +G  ++ P +   CG +    I + SN ++L F +DF     GF   +    S       +T  +    SP YP    +       L +++ +    +   D  +    NC+LD   + D      + + + C +     +  S+ D + ++ +    +       +  Q    +   NRT     G + ++     K YS N  CN T+   A N    + F  F LE  + C+ DY++      G Q+  + + CG+ IPPS  T  SR+ ++F TD     + G+ + ++V+      CGGE+  D+G  +SPG+   Y  + EC W I     S I+    D  +        TC  N D +++ YG       +  + C     +   Q+ S+     + +K+ +   G GF +SW  V
Sbjct:  576 NERGFTIRWETRQPECGGVLTGTYGSLKSPGYPGKYPPGRDCVWKVIASPDLLITFTFGTLSLEHHDDCRKDYLEIRDGPLHQDPVLGKFC--TSLSVPPLQTTGPFARIHFHSDNQINDQGFHITY-LTTPSDLHCGGNFTDPEG-LLSPDLSGPFTHSRQCIYVITQPLGEQIQVNFT---HVELEGQSGCSQSYIEVRDDQ--TLLGKVCGNETPSH-IKSITNSIWIRLKIDASVVRASFGAAYQVACGGEL-TGEGVIRSPFYPNVYPGERICRWTIHQPQSQVVLLNFTAFEMGSSAHCDTDYIEIGSSPVLGSPENKKYCGTDIPSFITSVYNSLHVVF-VKSSSTENHGFMAKFSTEALACGEILTESSGIIQSPGHPNIYPHGVNCTWHILVQPGHLIHLEIRQFHLEFHYN-CTRDYLEIYDTVSDTSLGRYCGK--SIPPSLTSNTNSLKLIFVADADLAYE---GFVINYEATDASA------GNTTALLYRRIWIFTSPNFPSN--YPNNMECIYRITVETSQQIALHFTD--FSLE-EPIGGACAADYVEITNGGYASSPPLGKYCGSNPPPRIISHSNKLWLKFKSDFFGSGPGFSAYWDG--SLTGCGGNLTTPTGTFTSPNYPMPYYHSSECFWWLKSSHGSP-FELEFNDFHLEYHPNCTLDYLDVYDGLSTSSHLLTRLCGN-EKPPLIRSTGDSMSLKLRTDEGQQGGGFLVKYQQTCDNVVIVNRTY----GILESIH--YPKPYSVNQRCNWTIQATAGN-TVNYTFLAFELESHANCSTDYLELY---DGPQR--MGRFCGAVIPPSGSTTGSRLQVLFHTDGVGQGERGFQMQWLVH-----GCGGELSGDTGTFSSPGYPVGYPANKECIWYIHSSPGSSIQLTIHDFDV----EYHATC--NFDVLEI-YGGPDFHSPRIAQLCVQRSAENPMQVSSTGNELALRFKTDSSVNGRGFNVSWRAV 1508          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. TrEMBL
Match: K1P334 (Cubilin OS=Crassostrea gigas OX=29159 GN=CGI_10014626 PE=4 SV=1)

HSP 1 Score: 1137.48 bits (2941), Expect = 0.000e+0
Identity = 994/3668 (27.10%), Postives = 1585/3668 (43.21%), Query Frame = 2
Query:  389 IESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDH--SPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQC-KCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLH-FPCIWTIISSNDQFLQII--PINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI-NFVDREIKITA--CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADV--EAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTK-------RFCGNHAKSGPTVTHK---LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINIT--VSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKI------NH---------IRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDR---SNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAI--FKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS----NYDAKVFCGSGVIDSAIFTPPVTLI-------LSAEGYRYPGFLIRWNPPVDE---------NFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV--EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILR-------SHFLNYILNLTALDLPPPTNGKCVNGFLKIL----------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCG--KTNSIFTIGNVLTILFK--NMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKE--SENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLYIICASN---LENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNE---SGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVS--------------KIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS---NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVV-YIYPNF-----FGCRYHDNQIQIDLEDQNGNYLPGQRICG-KSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYI 10969
            +  + + LTT  + +S LE     +++ LT ++C +NPC NG  C+D YN F C CP  +KG  C  DVNEC + +GT  GCQNGA C NT GSF C C+  W G+ C+   + CS AS+ ++CGHGTC      +P  PK + C+C+ GW+    +  C+ D DEC      CS  P V C+N PG   C  CP G+ GNGF+C+DINEC       +  P  +C N  G+  C  C  G +      C    +C  NNGGC + A C  +   I+G +C+C PGY G+G G NGCV  +  VT+     C     CRNG  CQ S + + C C PG+ G +C+T  N +C SNPC NGG C     N Y C C   ++G NCE E   CGG        +E    T    + +   H   C W I+S+  + + +     +++    C+ +Y+Q+H+        + IG YC  +   P   NTT   + I      +I  + GF +  I  +     L           + Q  +G   SP +P  Y  N +CA       G        +  L+  D   NCS  DY++I + +D    +    C+               + FHSD+   ++   F   +    +   CG   T +   +I SP  P+    E+ C W I       +     T +  F+  C+      E+       +          L        N  +I F      +   F+ +   ACG + +  E S   F S +YP  Y  N  CVY    +    + +SF  FD+   + C +D++ +   GS    L  R+C       ++   N  T K    F ++ +   TGF A  +    G    L+          H N         Y     C+W I       +   F  F +ES+ NC YDY+EL +DN T        R+CG  A   P++T     + + FVSD S++ EGF   + T+     C      S+G+IT+P       +   C ++I      +IL+N+T    ES  SC          L+I +G   S+ + N          I++ SN   I +     Q+A  F   I+Y +    CG+   +  G   SPNYP     N  C W I  + G RI +        NH         IR GS     L                    C  Q+  +       + + F++  S   R F  +YT  C+  +T  SG IES N        R C+W + +  G+ + +    F +    +  C Y  +++ D    ++  +   CGN +     +SS Y + +   +D S  SN  R      LEY T GC    Y+    +D+++ N       +PN   +   C W  +   G +++L     ++E+  +C    +L  +    +    + Q C++    +  ++ ++ +  Y+ F S    NG  + F  +Y+     C    S   G + S N+P  YPHN  C W + V+ S  + L   DF+ E S  C YDYV ++   N +  +L   CG         + S    M +K R+D ++S RGFKA+Y   CGG+ +  E +  + SPNYP+ Y +    C W + A+ S+  + + F  M  E  S+   C  D  + ++ G   N+      C ++   PI S+G  L +   S     +  F+A Y    S+CG +     G   +P YPN      +CV+ IR +PG+ + +S + F+  N  S   +D++++R G +    L+GR+        +  N    + +WI+ RS   ++ +   FLA+++  Y  +     G +ASP + + Y  +    WT+  +   +++ T +   +    +   C    L   D       +   FCG+       F  P  +I        S+ G    GF+ +W    D+             +  C   + A+NQ  + TSP YP+       C W I T     + + + + DLE  + C +++ TV     G+   +  F        CG   N    +  T   N + + ++ D      GF ++Y++AC     +  +G + +  YP+    N+NC ++++           N   N+        + G C   ++ +L            + N   CG+  P  ++   T S+ + V    + +  +   GF++ + +   +CG    LT       + M+ N     PH ++C W    P    +Q++F+E   + S   CN  ++ F DG T  +  IG   +CG  + +++ +  NV+   F+  N    + F+  V I  CGG    + G IASPN+P NY    +C W + G +   + LTF+  +L+ + S ++   + +++  S   V+ + C S     I T  S   + F +N   T  GF+LK+      CGGE++       S N+P   +    CTW I V   +R+ +    L +        +R V Y  V +Y    S+   +  +  DT   ++E  G+   + F  +    +   S  Y + NE    GV+T    N++   Y + NY  +E  L +F + N       + F +              +I  G  E  E  G  C   N       +    N   +   +V++ +    + Y ++ CGG+LTE  G I SP +P  Y  +  C WLI+APE   IQ+T +   LE+H  CN+D++ I       SP   K CG      +  +   N +R+ F +DFSV+ NGF I+Y F+   D C G+  +  G I SPNYP  YP N  C W I+V EGY V L F  PFD+E  +   C YD + + D+     +  L   C N  P  P  S+ +QM + F +D   N  GF A + S CG ++    G+ VS         ++ C Y I        V  +   NF      GC Y   QI     D  G  L   + CG  + + ++   S  I+ V T RN       FRA+Y   +    +++   PY  ++TP +P+PYH+ AN TW+       +  +   S ++E ++  C YD+V      S SS  +  FCG   ++   +  T N ++V F +D +  +   GF A      G   GCGG +N+T G +G   S+D+D +G+YE    CKW I       V + FE     LE       CRYD++ ++DG     P+I   CG      IT+ SNV+Y+ F  D+ + K+GF  T+    +      + ++  Q + SP YP     DLR    + + +    I ++   L + S  NCS++   ++D+ L    +   +C + S    F S+   + I Y V      +S+  + F + Y++  CNRT     G+I +        Y  N  C +++  PA       YF  F +E  STC YDY++   G       ++ ++CG++IP       + + M  VTD SI + GYDIT+  +    + CGG+I   +G ITSP +  NY E   C W I   +   I
Sbjct:  177 LNDIRSRLTTLENNVSDLEENVQSLQQLLTQNECNSNPCRNGGSCVDRYNGFFCQCPPAWKGAFCDVDVNECSEYAGTDLGCQNGATCVNTPGSFTCQCAANWYGIRCSERHDDCSQASHQELCGHGTCVNSDRVTPGQPK-YTCICEDGWTTSGSSPMCVVDRDECSEPGPRCSADPSVPCINLPGSFTCGQCPAGYSGNGFSCVDINECEINNGGCSVNPRVDCTNTRGSRTCGPCPPGYQGNGV-TCTWVGLCNINNGGCHSLATCQESP-GIQGVVCSCPPGYVGNGQGSNGCV--TQGVTDGP---CASNP-CRNGALCQNSGSTYNCVCQPGYEGNQCQTNTN-ECASNPCQNGGTCTDRV-NGYTCACTSSYTGNNCEEETQSCGGVLT-----QETGTLTYPTQTGATYPHGVSCSWRIVSTPGKIISVTFTSFSVENHPGCAYDYLQVHDGP--SATAHKIGTYCGYT--LPPPINTTQHQMYIWFYSDQSISSD-GFSLNWISADPVCGGL-----------LNQGDHGTLSSPGYPGNYPHNRDCAWTVMVSPGMNIMFTFAVMALEHHD---NCS-YDYVEIRDGLDENAPLLQKYCSTQSPVPITTTNPYAHIRFHSDA--SLSDQGFLITYAAVSAGPQCGGQYTSSEGVVI-SPGFPSPYTHESECVWTITVPAGDTITLTFTTIDIEFESTCNYDF--VEVRDGPNEMSPLFNKFCGSTLPSPLTSTGNTMFIRFSSDHSQTGQGFRATWTTACGGTYSEPEGS---FSSPSYPNAYPANKECVYTINQSPGSVVTLSFTAFDLEGSTNCIYDYLTVYDGGSVQSPLLGRFCGAQIPAPVSSTQNMMTVK----FVTDGSQHNTGFMASYTSSSAGCGGMLSEPTGTVTSPGHPN--------IYPHGVNCSWTIQASPGLVVRLTFHTFSIESNANCRYDYVEL-YDNYTASSNSLLGRYCG--ASLPPSITSSTNFMTVVFVSDESIAHEGFSAGYVTLNASTICGAELTDSTGVITSPNYPNNYPHERECVWTITAQDGNQILLNVTDFRLESHASC------AYDFLEIRNGGFPSSPLVNTYCGTTIDTTIRSHSNRMYIRFKSDASQSARGFR--ISYDTTATGCGADLTNPTGSFVSPNYPNQYSHNAECFWTITISRGSRIHLTFVDFNFENHVNCLYDYVEIRDGSATGALLAR-----------------YCGSQVPDIIDSLSNKLWIKFRSDMSVSGRGFHAFYTSICDTVLTDYSGVIESPNFPNPYPHNRNCTWVIQATLGNTLNVSFSHFQVE--THTSCNYDHLQVRDGNLPTSPEIGTYCGNNIPPAISSSSEY-LWLNFISDFSVASNGFR------LEYITNGCGG--YFTQSTNDFTSPN-------YPNPYPHRRVCVWRIEVATGQAIQLTIKDFDLETHSDC-RFDVLEVYAGRDMSAPRLVQLCHKQTSEQ--VLTTTGNLMYVIFRSDVSING--KGFSASYKSIVGGCGGNFSTPTGTLMSKNFPENYPHNTDCEWLISVEVSKRVVLTFQDFDVESSTNCTYDYVAVYDGTNANSTELMRHCGNSLPSPSI-YRSSGQYMYVKMRSDVSLSGRGFKAQYVTGCGGI-LNGEDDGVITSPNYPNSYDMMSN-CSWLIRADHSDDRITLTFTHMDIEEFSD---CGKD-YIRVLNGDDLNAPEVGTYCGRTIPTPITSSGSALMIQFVSDRSVQMSGFRALYTKSMSSCGAEITAQSGYIATPGYPNEYPHSTECVWTIRVTPGNRVGISFQTFNLMNHPS-CNYDYVELREG-DVHGRLIGRYCGT----RFPGNLTAANGLWIKFRSD--EYGSGTGFLAEFNTMYGGDLTGSSGQVASPNYPNQYPHNVNYVWTITVDIGMRIRVTVNALDIESVAN---CYFDYLRFLDGPDADGAEIGKFCGT--TTPPPFLSPGNVIRVEFHSDFSSSGQ---GFMFQWAATSDQIPSTTPSPGTTTPVPGCGGNLGASNQDNVFTSPGYPSGYANNLNCLWMITTLPGNRVWLNISTLDLEGHFTCSFDSITVYDNAFGTGRVLGRF--------CGREGNPAPLLSTT---NYMSVRFQTDASVNATGFSINYRQACGGRM-DMSQGVIASPNYPSPYPGNQNCEWVVQVTTGRTIEVAFNSSFNVVG------SVGGCDGDYVMLLNGDNANAPPVGTSTNGRYCGNQSPATME---TGSNRLYVKFVSDGAGSA--VGFRLTFREVHVQCGESIRLTHDVPQAYI-MSPNYPAAYPHNVDCVWTILVPATETVQVEFDENFNIESHQNCNFDYIEFRDGGTENSDLIG--RYCGTSRPSTVKSTDNVMYARFRTDNSVPRAGFKALVHIARCGGTYIGQSGMIASPNFPSNYGNNENCEWNLRGPTGHFLTLTFLTFNLESSSSCNSADYLEIRDVNSTGPVLMTRCGSQVPQPILTSDSYAHVKFVSNNANTFPGFQLKFEASVEECGGEFTTSTGAFTSPNFPGQYAHNRLCTWLIRVPAGRRVSLMFNALNIED-----HSRCV-YDYVAVYNGILSDSPIIGRYCGDTPPPVVESSGNTMKVVFWTDGSVSNGGFSARYTSPNEQKCGGVLTRPIGNVTSPGYAVGNYTNNEQCLWLFRNQNQTSSSILIVFNNFRLENHARCLFDFLEIKEGSTENGELIGRYCG--NTTLPDPIISPSANLWMRFRTDVSIVDRGFALTYAYTDCGGVLTEDNGEILSPNFPNNYNHSDACAWLILAPEGAKIQVTFKNFSLENHPRCNFDYVDILNGRMVSSPSIGKKCGA--TVPQPFTSQSNGIRIIFKTDFSVAANGFRIQYQFV--TDGCGGLFHDESGLISSPNYPSSYPHNTECVWDINVQEGYHVVLNFIPPFDME--AHGACGYDYVEVDDALRNGTLVNLGRWCSNQTPP-PQKSTSSQMVVKFRSDPAINGNGFAANWTSGCGAIFTEDSGDFVSPGYPNQYGHNLMCNYTILAHPGRFIVFDFSRANFHLEGGVGCPYDYVQIYAG-NDTTGRSL--GKFCGTDAPDPVSSSGSMFIQFV-TDRNQAFS--GFRAQYRVTDCGGTYTE---PYGTIRTPTYPTPYHNEANCTWLITVAENRVVDLKFSSFEVE-AHPSCGYDYVEVRDGDSLSSPLMGRFCGR--SVPDLLRSTGNSMVVNFVTDPTVVQG--GFSAGYWTAYGERQGCGGVLNSTSGRFG---SVDMDRDGVYEPQ-NCKWTIIVGDNKVVTLQFE--GFDLEDHFN---CRYDYVAVHDGMSEDDPLIGRYCGTQVPAPITSTSNVLYVRFVADYTVHKAGFNATYQQQDALCGGAFSASDSPQTISSPSYPRPVGQDLRCRWTIDSGDSNQQIRVSFNGLNLISDNNCSMEYIELRDSPLGWTGRSHLYCGT-SLPPPFDSAGRTLQINYMV-----TSSSGSQGFSLRYQIANCNRTYTGTGGKIFSPG--WPGNYPRNAYCEMSISAPA-GTYVTLYFNSFYIEPHSTCRYDYLEIRNGSTSSSP-LINQLCGNTIPNPIFATGNTLWMNLVTDSSIVHPGYDITWTASTS-GMGCGGDIVGINGSITSPNYPGNYTERHSCRWLITAPARRVI 3639          

HSP 2 Score: 488.034 bits (1255), Expect = 4.613e-134
Identity = 699/3004 (23.27%), Postives = 1200/3004 (39.95%), Query Frame = 2
Query: 1538 VCGGTYAVSNEYREISLFTSLLPSPSRSLHFP----CIWTIISSNDQF--LQIIPINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITA--CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADV--EAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEY-ACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI-SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDN-----QTKRFCGNHAKSGPTVTHK-LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-DKNPVLKFVTAKK-EINIVCSEQITKMHVFEE--QSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSS-GRIESKN-----EMLRYCSWKLSSLRGS-KILIQIDKFDLPPLQN-GQCYSFVRISDRSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIAN-IDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPI-LRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKI--LDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET-------------------CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYF--MGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPY-HPIISNGHYLKVILKS-TSGNAI-FKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSI-EEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDS--VWIRLRSQGGDFTNHIKF-LAKYHINYNTEFRSDYGV----LASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQ-FSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKK---IGDC--EYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENF-TVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILAMNINKT-----LCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEE-CGGRHELTRYQDSRIVDMNSNRLHMTPHF--IECKWHFTSPPGTR--MQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKT---NSIFTIGNVLTILFKNMDDFSY----FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSSTWDIYTEYST-VRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGV-GYRSVL------------LYIICASNLENFEIDTKSSMIEVFGSGATISF-SYNSDQPSLCGSNIYPNNNE---SGVITIENVNISLCQYNIHNYPE-----DEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEY-NFINPADTCNGIIFNTEGSIKSPNYPKP---YPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIID--SNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYK---SICGGVYDLRQGE--IVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRY-HDNQIQ---IDLEDQNGNYLPGQRI-CGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYV-----LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA 10102
             CGGTY+                SPS    +P    C++TI  S      L     +L+   +C  +Y+ +++    +    L+G++C      P   ++T +++ +K     + Q N GF        MA        C    +E T    G   SP  P  Y   +NC+   QA  G   R+     +++     +NC   DY+++  N+      +    C  ++  +     N   V F SD    +    F   +    +   CGA +T +   +I SP  P +   E  C W I   + ++++     F    +   S      EI   G   +  +       +        N  YI FK     S   F+IS +  A G   ++    T  F S NYP  YS N+ C +    +   +I ++F+DF+  +   C +D+++I  GS +G L  RYC     ++I   SN    K+ I F+S+ + +G GF A  +         + + ++  Y  S + ES  +    Y  N+ CTW I   L   +   F  F +E+H +C YD+L++   N     +   +CGN+     + + + L + F+SD SV+  GF + + T      C   F  S+   T+P       +   C + I+V   + I   +T+ + D    +  C            + +  +  +C      + + T+ N   + +      N   F  + +Y S+   CG    +  G + S N+P   P NT C W I     KR+++         V+ +  C  D   V     A   E+   C   +    ++    Q ++V  ++  S   R F+  Y   C   +     G I S N     +M+  CSW + +     +I +     D+    + G+ Y  V   D  N     +   + +    TSS   + I+  +DRS   +  RA             + T       ++ + ++G I +  +PN   +  +C W  +  PG  V + F    + +  +C+   + LR  +   V    + + C     G      ++ +  ++KF S  D  G    F   +   N     +++GS G + SPNYPN YPHN+   W + V   M I + +  LD E+  + C +DY+      + D  ++   CG         F S  N + ++F +D + S +GF  ++  T                   CGG   A   +    SP YP  Y   +  C W +   T+  G R++     +  EG   +  CS D S+T+ +       V    C +     P++S  +Y+ V  ++  S NA  F   Y      CGG   +  G+  SP YP+    + +C +V++ + G +I+++    F+   ++     D++ + NG N  +  +G         N +       S  ++++  S G       +    + H+      R  + V    + SP +   Y  + +  WT+   ++E +Q  FD+ F++    +   CN   +   D   +      S +I     T   + + S +   Y  F    + P    FK    I  C   YI     Q+ ++ SPN+P+       C W +       L +  L+F+LESS  C   ++  +    S  P+        M +CGS          +Y      + + ++  + FPGF+L ++ +   C  +F     G+  +  +P +   N+ CT+++R      + L   AL++    + +CV  ++ +    ++ +      CG + PP   P++ +S   +  +F    S S   GF   Y+  +E+ CGG   LTR     I ++ S    +  +    +C W F +   T   + I F    + +   C   FL   +GST   + IG   +CG T   + I +    L + F+   D S     F L      CGG+L    G I SPN+P NY    +C W I     + I++TF +  L+ +  C+   + ++  +   +  I   C ++    +T  S  +RIIFKT+      GF+++Y F    CGG + D    ++S NYP +      C W INV     +++           F + A G  GY  V             L   C++     +  T S M+  F S   I+   + ++  S CG+    ++ +    G       N+ +C Y I  +P      D    +  +    G P    Y   +I  G        G  C         S+    + F+    R    S +R +  Y+ + CGG  TE +G I++P YP  Y +  +C WLI   EN ++ L   +  +E H  C YD++ +R  +   SP   + CG +    + L    N M ++F +D +V + GF   Y         C G++ +T G   S +  +     P N  C WTI V +   V+L F+  FDLE      C YD + + D  S    L+   CG   P+ PI S+ N + + F  D+  +  GF+A Y+   ++CGG +        I S +        + C + I   +++ Q   I  +F G     DN      I+L D    +     + CG S         ++++I Y   +    +  F  RY         ++  R Y      + +P +P  Y  NA      +AP G   ++   S  IE  +  C YD++     S++SS  I   CGN T  +P     N L +   +D S    H G+ + +   T G  +GCGG +   VG  G I S +   N  Y     C+W I AP    + V   N  I++ G      C   ++ I++G   + P     CG++Q   +    N + + F TD      GF+L +T+
Sbjct:  904 ACGGTYSEPE---------GSFSSPSYPNAYPANKECVYTINQSPGSVVTLSFTAFDLEGSTNCIYDYLTVYDGGSVQSP--LLGRFCGAQ--IPAPVSSTQNMMTVKFVTDGS-QHNTGF--------MASYTSSSAGCGGMLSEPT----GTVTSPGHPNIYPHGVNCSWTIQASPGLVVRLTFHTFSIES---NANCR-YDYVELYDNYTASSNSLLGRYCGASLPPSITSSTNFMTVVFVSDE--SIAHEGFSAGYVTLNASTICGAELT-DSTGVITSPNYPNNYPHERECVWTITAQDGNQILLNVTDFR--LESHASCAYDFLEIRNGGFPSSPLVNTYCGTTIDTTIRSHSNRMYIRFKSDASQSARGFRISYDTTATGCGADLTN-PTGSFVSPNYPNQYSHNAECFWTITISRGSRIHLTFVDFNFENHVNCLYDYVEIRDGSATGALLARYCGSQVPDIIDSLSN----KLWIKFRSDMSVSGRGFHAFYTS--------ICDTVLTDY--SGVIESP-NFPNPYPHNRNCTWVIQATLGNTLNVSFSHFQVETHTSCNYDHLQVRDGNLPTSPEIGTYCGNNIPPAISSSSEYLWLNFISDFSVASNGFRLEYIT----NGCGGYFTQSTNDFTSPNYPNPYPHRRVCVWRIEVATGQAI--QLTIKDFDLETHS-DCRFDVLEVYAGRDMSAPRLVQLCHKQTSEQVLTTTGNLMYVIFRSDVSINGKGF--SASYKSIVGGCGGNFSTPTGTLMSKNFPENYPHNTDCEWLISVEVSKRVVLTFQDF---DVESSTNCTYDYVAVYDGTNANSTELMRHCGNSLPSPSIYRSSGQYMYVKMRSDVSLSGRGFKAQYVTGCGGILNGEDDGVITSPNYPNSYDMMSNCSWLIRADHSDDRITLTFTHMDIEEFSDCGKDYIRVLNGDDLNAPEVGTYCGRTIPTPITSSGSALMIQFVSDRSVQMSGFRA-------------LYTKSMSSCGAEITAQSGYIATPGYPNEYPHSTECVWTIRVTPGNRVGISFQTFNLMNHPSCNYDYVELREGD---VHGRLIGRYCGTRFPGN----LTAANGLWIKFRS--DEYGSGTGFLAEF---NTMYGGDLTGSSGQVASPNYPNQYPHNVNYVWTITVDIGMRIRVTVNALDIESVAN-CYFDYLRFLDGPDADGAEIGKFCGTTT---PPPFLSPGNVIRVEFHSDFSSSGQGFMFQWAATSDQIPSTTPSPGTTTPVPGCGGNLGASNQDNVFTSPGYPSGYA-NNLNCLWMI---TTLPGNRVWLNISTLDLEG---HFTCSFD-SITVYDNAFGTGRVLGRFCGREGNPAPLLSTTNYMSVRFQTDASVNATGFSINY---RQACGGRMDMSQGVIASPNYPSPYPGNQNCEWVVQVTTGRTIEVAFNSSFNVVGSVGGCDGDYVMLLNGDNANAPPVGTSTNGRYCGNQSPATMETGSNRLYVKFVSDGAGSAVGFRLTFREVHVQCGESIRLTHDVPQAYIMSPNYPAAYPHNVDCVWTILVPATETVQVEFDENFNIESHQN---CNFDYIEFRDGGTE-----NSDLIGRYCGTSRPSTVKSTDNVMYARFRTDNSVP-RAGFKALVHIARCGGTYI----GQSGMIASPNFPSNYGNNENCEWNLRGPTGHFLTLTFLTFNLESSSSCNSADYLEIRDVNSTGPVL-------MTRCGSQVPQPILTSDSYA----HVKFVSNNANTFPGFQLKFEASVEECGGEFTTS-TGAFTSPNFPGQYAHNRLCTWLIRVPAGRRVSLMFNALNIE--DHSRCVYDYVAVYNGILSDSPIIGRYCG-DTPP---PVVESSGNTMKVVFWTDGSVSN-GGFSARYTSPNEQKCGGV--LTR----PIGNVTSPGYAVGNYTNNEQCLWLFRNQNQTSSSILIVFNNFRLENHARCLFDFLEIKEGSTENGELIG--RYCGNTTLPDPIISPSANLWMRFRT--DVSIVDRGFALTYAYTDCGGVLTEDNGEILSPNFPNNYNHSDACAWLILAPEGAKIQVTFKNFSLENHPRCNFDYVDILNGRMVSSPSIGKKCGATVPQPFTSQSNGIRIIFKTDFSVAANGFRIQYQFVTDGCGGLFHDESGLISSPNYPSSYPHNTECVWDINVQEGYHVVLNFIPP------FDMEAHGACGYDYVEVDDALRNGTLVNLGRWCSNQTPPPQKSTSSQMVVKFRSDPAINGNGFAANWTSGCGAIFTEDSGDFVSPGYPNQYGHNL-MCNYTILAHPGRFIVFDFSRANFHLEGGVGCP----YDYVQIYAGNDTTGRSLGKFCGTDAPDPVSSSGSMFIQFVTD--RNQAFSGFRAQ--YRVTDCGGTYTEPYGTIRTPTYPTPYHNEANCTWLITVAENRVVDLKFSSFEVEAHPSCGYDYVEVRDGDSLSSPLMGRFCGRS--VPDLLRSTGNSMVVNFVTDPTVVQGGFSAGYWTAYGERQGCGGVLNSTSGRFGSVDMDRDGVYEPQN--CKWTIIVGDNKVVTLQFE-GFDLE--DHFNCRYDYVAVHDGMSEDDPLIGRYCGTQVPA-PITSTSNVLYVRFVADYTVHKAGFNATYQQQDALCGGAFSASDSPQTISSPSYPRPVGQDLRCRWTIDSGDSNQQ---IRVSFNGLNLISDNNCSMEYIELRDSPLGWTGRSHLYCGTSLPPPFDSAGRTLQINYMVTS-SSGSQGFSLRYQ-------IANCNRTYTGTGGKIFSPGWPGNYPRNAYCEMSISAPAGTYVTLYFNSFYIE-PHSTCRYDYLEIRNGSTSSSPLINQLCGN-TIPNPIFATGNTLWMNLVTDSSIV--HPGYDITWTASTSG--MGCGGDI---VGINGSITSPNYPGN--YTERHSCRWLITAPARRVITVYVVN--INILGSPD---CNRAYVEIHNGYLDSSPSFGRYCGNEQPPPLRASGNKILIKFVTDGFHTAPGFRLLYTS 3712          

HSP 3 Score: 357.836 bits (917), Expect = 1.274e-94
Identity = 373/1471 (25.36%), Postives = 608/1471 (41.33%), Query Frame = 2
Query: 6950 KKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFK-----NMDDFSYFRLKVKIGSCGGLLHR-RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTF--MDRDLDENCSKSNLTVIPVKESENAVIWSNCNS-STWDIYTEYSTVRIIFKTNTVTTRKGFKLKY--FFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM------NQGCFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSG-ATISFSYNSDQPSLCGS---------------NIYPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTG-IPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDH--LFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSN--AVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSI---CGGVYDLRQGEIVSANVALINYGSITCEYLIP---GWENHLQVV-YIYPNFFGCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTN-VLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSI-TTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQ---LLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFC-ESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPA--PNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVS----YGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGF 11176
            ++ + CGG       Q++  +   +      PH + C W   S PG  + + F    + +   C   +L   DG +    KIG   +CG T    I T  + + I F      + D FS   +      CGGLL++   G ++SP YP NYP    C W +      NI  TF  M  +  +NCS   + +    +    ++   C++ S   I T      I F ++   + +GF + Y        CGG+Y+  E  + S  +P   +    C W I V     I +    + +      N     +R  G    S L    C S L +    T ++M   F S  +     + +   + CG                N YP N E             C Y I+  P    TLS    D  G   C   Y     G  ++ P+   G  C  +      ST   +       G + N + +        + CGG+L+E  G + SPG+P  YP   +C W I A   ++++LT  T  +E + +C YD+  L+  Y    +S    + CG +   + T S   N M + F SD S++  GF   Y  +N +  C   + ++ G I SPNYP  YP    C WTI   +G ++ L      D    S  +C YD L I +    +  L++  CG    +  I S  N+M + F +D + +  GF   Y +    CG       G  VS N       +  C + I    G   HL  V + + N   C Y  + ++I      G  L   R CG     I    S  + I + + +  +    F A Y    +  V +D+    V+++PNFP+PY HN N TW+  A +G   +++     +E ++  CNYD +     +  +S  I  +CGN  NI P +  ++  L + F SD S   N        N       GCGGY   +   +    S +  N   Y +  +C W+I    G A+++  ++    LE  S    CR+D + +Y G D + P +  LC     + + TT  N+MY+IF +D +I   GF  ++ ++     +     NFS     L S  +P N P++      LI+   +  + +T +D  + SS NC+ D   + D +  +  ++ + C  SL +  ++ SS      QY    M +  S + R F+  Y +  C          ++   N+     S++++ N + +  A   + R    F + ++E  S C  DYI+ + G+      V    CG +IP    ++ S + + FV+D+S+   G+   Y  +      CG EI   SG I +PG+   Y  S EC W I++   + +   F    L N+    P+C  N D+V++     +G    +YCG           ++   ++++S   G G GF
Sbjct:  551 EETQSCGG----VLTQETGTLTYPTQTGATYPHGVSCSWRIVSTPGKIISVTFTSFSVENHPGCAYDYLQVHDGPSATAHKIG--TYCGYTLPPPINTTQHQMYIWFYSDQSISSDGFSLNWISADP-VCGGLLNQGDHGTLSSPGYPGNYPHNRDCAWTVMVSPGMNIMFTFAVMALEHHDNCSYDYVEIRDGLDENAPLLQKYCSTQSPVPITTTNPYAHIRFHSDASLSDQGFLITYAAVSAGPQCGGQYTSSEGVVISPGFPSPYTHESECVWTITVPAGDTITLTFTTIDIEFESTCNYDFVEVR-DGPNEMSPLFNKFCGSTLPSPLTSTGNTMFIRFSSDHSQTGQGFRATWTTACGGTYSEPEGSFSSPSYPNAYPANKE-------------CVYTINQSPGSVVTLSFTAFDLEGSTNCIYDYLTVYDGGSVQSPL--LGRFCGAQIPAPVSSTQNMMTVKFVTDGSQHN-TGFMASYTSSSAGCGGMLSEPTGTVTSPGHPNIYPHGVNCSWTIQASPGLVVRLTFHTFSIESNANCRYDYVELYDNYTASSNS-LLGRYCGASLPPSITSS--TNFMTVVFVSDESIAHEGFSAGYVTLNASTICGAELTDSTGVITSPNYPNNYPHERECVWTITAQDGNQILLNVT---DFRLESHASCAYDFLEIRNGGFPSSPLVNTYCGTTIDTT-IRSHSNRMYIRFKSDASQSARGFRISYDTTATGCGADLTNPTGSFVSPNYPNQYSHNAECFWTITISRGSRIHLTFVDFNFENHVNCLY--DYVEIRDGSATGALL--ARYCGSQVPDIIDSLSNKLWIKFRS-DMSVSGRGFHAFYTSICDT-VLTDYSG--VIESPNFPNPYPHNRNCTWVIQATLGNTLNVSFSHFQVE-THTSCNYDHLQVRDGNLPTSPEIGTYCGN--NIPPAISSSSEYLWLNFISDFSVASNGFRLEYITN-------GCGGYFTQSTNDF---TSPNYPN--PYPHRRVCVWRIEVATGQAIQLTIKD--FDLETHSD---CRFDVLEVYAGRDMSAPRLVQLCHKQTSEQVLTTTGNLMYVIFRSDVSINGKGFSASYKSI-----VGGCGGNFSTPTGTLMSKNFPENYPHNTDCE-WLISVEVSKRVVLTFQDFDVESSTNCTYDYVAVYDGTNANSTELMRHCGNSLPSPSIYRSSG-----QYMYVKMRSDVSLSGRGFKAQY-VTGCGGILNGEDDGVITSPNYPN---SYDMMSNCSWLIRADHSDDRITLTFTHMDIEEFSDCGKDYIRVLNGDDLNAPEV-GTYCGRTIPTPITSSGSALMIQFVSDRSVQMSGFRALYTKSMS---SCGAEITAQSGYIATPGYPNEYPHSTECVWTIRVTPGNRVGISFQTFNLMNH----PSC--NYDYVELREGDVHGRLIGRYCGTRFPGN--LTAANGLWIKFRSDEYGSGTGF 1935          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. TrEMBL
Match: A0A0B7BPU2 (Uncharacterized protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF204376 PE=4 SV=1)

HSP 1 Score: 1130.16 bits (2922), Expect = 0.000e+0
Identity = 1019/3740 (27.25%), Postives = 1625/3740 (43.45%), Query Frame = 2
Query:  428 KISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHS--PTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLT-GFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNC--EFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQII--PINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQINFVDREIKITA-----CNQNMYFNKKFIVNRFMVHFHSD-SRSDVNSTRFQFRWKKAIS-QEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI-SGSNSGH--LDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF-----DCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPN--CAYDYLELIHDNQT-------KRFCGNHAKSGPTVTHKLVIRFV-SDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVS--ESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-DKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNTLLKKS---CGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSI-ANIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEES-LCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEG----IGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGN--AIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV----FCGSGVIDSAIFT--PPVTLILSAEGYRY-PGFLIRW--NPPVDENFKK--------IGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF--------ILRSHFLN---------------YILNLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNSSTWD-IYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIRARGVGYRSVLLY---------IICASNLENFEIDTKSSMIEV-------FGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENVNIS---LCQYNIHNYPEDEGTLSMF--MSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNT-DCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS---NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLI-PGWENHLQVVYIYPNFFG----CRYHDNQIQIDLEDQNGNYLP--------GQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDD-QVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIY-LDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-----KYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFR 11179
            +I ALE     ++  LT ++C +NPC NG  C+D YN + C CP N++G  CTEDVNEC   +GT  GCQNGA C NT G F C C+  W G+ C+   N C+ AS+ ++CGHGTC  +    P  P+ ++C+C +GW+    +  C  DIDEC  G + CS++P V C N  G   C  CP G+ GNG+ C D NECA      +  P   CVN  G+  C       +     C    +C  NNGGC  +AAC+ +     G ICTC  GY G GVG+NGCV        ++         C+NG  C  S + GF C C PGF G  C  V++  C SNPC NGG C  +   P  + C C   ++G  CE     CGG              T ++     S    C W I +S ++ L I     +L+   +C+ +++Q+H+      ++ +IGKYC          N+T + +         I  + GF+++        E+  C    NGS+       G   SP +P  Y  N +C         +          L+      NCS  DYL+  F D E   +      C        +       + FHSD S SD     F   +    + ++ CG +++  P+  I SP  P+  +    C W I  T+ S  ++L    +   +GD S  +    I          +       +    +   N   + F+    IS   F+     ACG      +    + QS N+P  Y  N +C Y+    +   I   F  F +     C FD+I I  G+N+    +  R C       I    N     + + F ++ +    GF+A+ S        CGG        I          S+     QY     CTW I       I   F  F  E   N  C +DY+  ++DN T        ++CG       T T  ++  F+ SD+S++ EGF   +  +     C  S  +++G+IT+P+   +  ++  C ++I +    +I +NIT    E+D +C +   L       +   +       V P+ P    I + SN   + +    + +   F   + Y+S    CG    +  G I SPNYP   P    C+W I  + G  I +         +D    C+     V + V A + +  +C   I          + + ++       R FR  Y  +C   +T +SG IES N    Y     C+W + +  G+KI +    F+L     G  Y  ++I D  N   ++    CGN + +    S++  + I   +D S       A+EG  LE+   GC    Y           +GVI S  +PN   +  +CQW      G  +++     ++ESS NC     L  +       + + Q C+R    +++    ST   ++ F S +  +G    F+ TY   +  C    +     I S NYPN Y HN  C WN+ V +   + L I DF+ E   LC YDY+ ++   + +   +  LCG      QT + S  N+M I+ RTD +V+ RGFKA Y   CGG R A + +  L+SP Y      P   C W + ++ +   + + F  M       N NCS +  + + +G    I   S  +   C  S    I S G  L V+ K++       F+A Y    S+CGG+F  D G FTSP +P+   ++++CV++I+ SPG+S+ LS   F + + +  I  D+++IR+ PN + ++LGR++  +   N T       +VW++ RS   + T    F A Y  ++      D G +ASP++   Y  ++   WT+ A  +++++ +F   S+    D   C    + I+D      V    FCGS  + S +++    +T++ S++ YR   GFL+ W   PP D             I  C   + A+   Q LTSP YP+       C+WTI       + + ++S D+E S  C Y+   +   G       F        CG        + Q+ + N++ +T+  D      GF L+Y+  C   F     G + +  YP+    N+NCT+         +R  F N                +LN   +  PP      VNG       N N   CGS+ P   Q + T+S++++     + ++E    GF   YS     CGG+  LT    S     + N     PH ++C W   +P   R+++DFEE   + +   C   F+ F DG TT +Q+I G   CG +   ++ + GN+L   F+      +  F+ K  I +CGG +   +G + SPNYP  Y   + C W I G     + +   D  L    NC+  +L VI    S + +++  C   T   + T  +T  I F+++   T +GF++ +      CGG+ + P   + S NYP   +    C W+I V +++R+ +    +++ +G    R     + SV +Y         I    N+    I++  + + V         SG     +Y SD+ + CG  I  +         EN   +    C +N+ N   +      F  MS      C   Y   + G  +    E  G  C     +         V   F+   ++++S+    + Y+F+ CGG++TE  G I SP YP  Y  NT  C W I+APE   I++     + E +  C+ D+L ++     DSP   K CG + + +  LS   N++RL+  S+ +     F I Y+F   +  C G++ + +GS+ SPNYP  YP N+ C W I+VP G+ ++L F  PFDLE      C  D + + D+    ++  L   C NI P N  ++S N++ +VF +D   N  GF A +   CGGV+    G ++S +       ++ C Y I PG ++H+ + +      G    C Y  + +QI       +Y+           R CG     + ++ S  I + +   N  L+   FRA Y  +E   VF+D    +   TP+ P+ Y +N N +W        I     ++ + ER +  C YD++SF   S  +S  I  +CGN+ N+  F+  T N + + F +D S      GF      T GP  GCGG +  + GT+    S+D D++GLYE+NL C+W I       V +      + +E       C  D + +YDG +   P++ T CG       I   SNV++++F TD  I   GF  +FT   +        T     + SP YPN++   +     +   + +  + + V D +++ S NC  +    +D  L +  +   +C + +    F S   +V I Y +       ++T R FQ+SY++  CNR     +GRI +        Y  N  C + L+T   N    FYFK+F +ER   C +DY++            + K CG +IP     + +  ++ F TD SI + GYD+T++ +   S  CGG +  L +G  TSPG+  +Y ES  C+WN+   +   I WR + M    NT        +TD++ +  G+        ++CG         +      ++Y S   G    FR
Sbjct:   10 RIEALETTVRNLQTLLTANECLSNPCLNGGTCVDMYNGYFCRCPSNWQGPRCTEDVNECALYAGTDMGCQNGATCVNTYGGFSCNCATNWYGIHCSERHNDCTGASHMELCGHGTCINEDRVVPGQPR-YRCICQNGWTTSGSSPACNVDIDECATGAH-CSVNPPVQCFNMHGSFACGLCPTGYTGNGYGCSDTNECAVNNGGCSTSPRVSCVNTIGSRSCGPCPPGYQGDGVTCSYVGLCNINNGGCHPSAACTDDTGGY-GTICTCPFGYVGSGVGQNGCV-------QQSQAGACASNPCQNGALCVPSGSAGFFCTCRPGFSGTTCSNVVD-ACSSNPCQNGGTCISQRQAPG-FTCQCSEDYTGNTCEQSQQDCGGYLQGQTGSFRYPRTTGVM----ASHRVNCAWVITTSANKILSITFPSFSLEYHPECNYDFLQIHDGP--SASSYMIGKYCGSQAPNGGSLNSTHNQMYFWFKSDATIASD-GFEVR-----WTSESPTCGGYLNGSSY------GTISSPGYPGNYPINRDCVWIVSVSPDSNIMFTFAHLALEA---HPNCS-YDYLE--FRDGETDSSPLINKFCTSVTSSPIQTTGPYAYIKFHSDISLSDRG---FHITYAALTANRQGCGGSLS-GPSGEISSPGYPSPYQHNIDCVWVINVTSGS-TVQLT-ILDLDLEGDPSCSMDYLRIRDGSDQMAPLVGSYCGTQIPAAFISSSNVINLEFRSDVSISGRGFRAQWTTACGGRFFGTQG---QIQSPNWPGYYPHNRNCDYRIEVPDLNTIRFEFTAFGLEGGDNCAFDYIGIYDGANADAPIIGSRLCGATTPSQIMSTGN----SLFVRFVTDGSVNNHGFQARFSAVPGGLEGCGGVLNRDMGAI----------SSPGHPNQYPHGVSCTWYINVTPGLVIRLTFSAFTFEIASNTVCYFDYVA-VYDNSTVSEQSLLGKYCGLAVPPILTSTDNVMTIFMQSDSSIAREGFTASYIAINASLVCGSSLTTATGVITSPSYPNQYRHNAQCEWTITIADGSQISLNITDMDIETDSNCNS-DFLEIRNGGYLSSPLIQKFCGQVTPSVP----ILSHSNRLYVRFKSDSFGSGRGFR--LEYTSAASGCGGDLTTPTGGIISPNYPHSYPHQAECQWSIIVSKGSTITLFFVDFE---IDNRGACHFGFLKVYEGVPAGRSLGTLCGSSIPSPITTVSNRMWLTYRTDVFLSGRGFRAQYHANCNNRLTGNSGVIESPNFPNPYFHNTNCTWTIEAPIGNKINVSFAVFNLEG-SRGCFYDRLQIRDAQNAQSRQMITLCGNDIPDN-IQSNSSQLWINFLSDASI------ANEGFRLEWIVDGCGGNIY---------GSSGVITSPNYPNHYPSQRECQWLITVDTGNMIEMTITNFDLESSSNCYWD-ALEVYAGSDKQGSQIAQLCHRQVSAQTLHTTGSTA--FIVFRSDSSVSG--TGFRLTYRALSGGCGGNFTARTATITSINYPNNYEHNTECEWNITVAQGYVVVLNITDFQLEGGHLCTYDYLSLYDGSDVNATLITKLCGATLP-AQTVYRSTGNQMYIRMRTDSSVTYRGFKATYDTGCGGTRNA-DIDGELISPTYLGSNWSP--FCIWIISSDFNNRRISLTFTHMDL-----NSNCSYE-YVAVNDGRESVINETSVPQNAYCGNSVPATITSEGSALNVVSKNSRSRHRPNFRAVYSSAYSSCGGEFTSDRGTFTSPSFPDGYPVNIECVWLIKTSPGNSVQLSFPNF-QLDPLGGINDDYLEIRS-PNVSGAILGRWFGTTAPANLTS----LSNVWVKFRSN--EDTTAPGFKAVYSNSFGGNLFGDSGQVASPRYPLFYPANSNYRWTILASQNKRIRVSFSGLSIELESDISSCIYDYVQIFDGTEQDGVSLGRFCGS-TLPSPVYSINNLITVVFSSDSYRQDSGFLMDWLAVPPEDVPTPAPSVIPATPIPGCGGQLVASETQQNLTSPGYPSVYEHNLDCSWTISVPVGNTIIVNIISIDMEGSGGCYYDYLRLSNGGLSPFRPRFNSNFRSTFCGRTGAG--TIIQS-VGNTMIVTFHTDHSISMSGFVLTYEIGC-GGFSTLATGVISSTNYPSNYKANQNCTWSTQVQPGRTIRLEFENQFNIADTGVCNDDYLLLLNGGTVQSPP----LFVNG-----TTNTNGRYCGSSKP---QVMETSSNFLVAQFISDATNEDI--GFSFTYSTVSVACGGQLRLTHAVRSGNF-TSPNYPGDYPHNVDCVWVIIAPASQRVRVDFEETFGIEAHPGCRFDFVEFRDGGTTNSQRI-GNALCGNSLPGTVLSTGNILLARFRTDSSVPHTGFKAKYSIATCGGRIIADRGVLTSPNYPGRYSNNADCEWSIVGPVGHFLTINITDSRLQYTINCTADSL-VIRDGNSTDNILFQFCEHLTLQSVLTSDNTAYIRFRSDGSVTDQGFRIVFQASVEECGGQRNTPTGIIQSPNYPGHYAHRRLCVWEITVPIARRVTLTFNDIQI-EGYSGGRCS---WDSVQVYNGYIQQSPTIGRYCNVNPGTIESSGNTMRVQFQTDGRGSSGRGFQATYTSDREAECGGYIVESPGNITSPGFENATYNHNVQCLWNLQNRLANSSIRLQFTNMSLEENPSCWFDYVEIREGTNING--EFIGRFCGHVVPVAPIILSASEVWIRFR--SDISISHIGFNLLYEFTECGGIITEPQGVITSPNYPNNYVSNTVACAWKIVAPEGTKIRVNFTDFNFETNTGCDSDNLQLQNGGLSDSPVIGKYCGTD-LPSSFLS-QSNKLRLTLQSNLTSRARRFRIVYSF--DSGGCGGLLHSNQGSLSSPNYPSSYPHNVECTWDINVPVGFMINLRFNPPFDLE---ARDCVNDYVEVFDTFYNGSLISLGRWCQNIEPPNQRSTS-NRLVVVFRSDATTNGNGFSASWDVACGGVFTNPTGVVLSPHYPSPYPNNLICHYTIGPGPDHHVLLRFTDFELEGRPSTCSY--DYVQILQGATTVDYMQWPYYYRSYRHRYCGTDSPGV-LLSSGQIILQFNTDN-SLQYKGFRAEYTSEECGGVFTDPSGTF--STPHHPNNYMNNMNCSWNITVASNRIIKFKFQTFETERHHS-CMYDYISFYDGSDTNSSMIGRYCGNMQNVPEFIRSTGNHMYITFITDFSF--TLGGFSGTYETTYGPQQGCGGALRQSSGTF---TSVDGDSDGLYESNLHCEWWIFVNDNKVVSLTI--TGLDIEASQD---CSRDSLKVYDGLNKDDPLLGTFCGRTLPQQPIWASSNVIFVVFETDDLISGRGFNASFTENNALCGGAYNATTNPVTISSPNYPNSTGTAVHCSWIIDTGDSSKQVRLIVSDFQLQVSSNCVDEHLTFRDRPLGNNGQELTYCGN-TIPPHFDSKGAQVKIIYFLS-----TTSTSRGFQLSYQIADCNRNITLPNGRITSPG--YPGVYQRNSDCTI-LVTSPENTTLSFYFKFFEMERHPNCNWDYLEI----KNSMSTTVSKECGYTIPSPVFLSDNVATLRFKTDSSIQHPGYDVTFMSSTQGS-GCGGNMTGLTAGAFTSPGYPNSYMESSTCTWNLTPPARRPILWRISFM----NTPDGAGGNCDTDYLTIYLGSTTAAPLLQRFCGLPEPSSNQVVVEQPLLIQYVSTGNGTAPVFR 3566          

HSP 2 Score: 155.606 bits (392), Expect = 2.496e-33
Identity = 142/604 (23.51%), Postives = 253/604 (41.89%), Query Frame = 2
Query: 9404 VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTL-ITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQA-----LKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
             + +P +P  Y  N +  WI +             + +E ++  C+YD++ F    ++SS  I  FC ++T+ SP         ++F SDIS  +   GF            GCGG ++   G  G I S    +   Y++N+ C W I    G  V++   +  + LEG      C  D++ I DG D   P++ + CG     +  + SNV+ L F +D +I   GF+  +T                  ++SP +P   P++ R     I   + + I        +    NC+ D   I D +      I       +T    +S+ + + +++      N +    R   +   L  C        G I +  +  Q  Y H + C   + +TP   +R  F    F +  ++ C +DY+         +Q +L K CG ++PP   +  + +++   +D SI  +G+  +Y+   + S+ CG  +   +GVITSP +   Y  + +C W I +   S I    TDM +  +++       N+DF+++  G         K+CG +         S+   V +KS + G G GFR+ ++
Sbjct:  507 TISSPGYPGNYPINRDCVWIVSVSPDSNIMFTFAHLALE-AHPNCSYDYLEFRDGETDSSPLINKFCTSVTS-SPIQTTGPYAYIKFHSDISLSDR--GFHITYAALTANRQGCGGSLS---GPSGEISSPGYPS--PYQHNIDCVWVINVTSGSTVQLTILD--LDLEGDPS---CSMDYLRIRDGSDQMAPLVGSYCGTQIPAAFISSSNVINLEFRSDVSISGRGFRAQWTTACGGRFF-----GTQGQIQSPNWPGYYPHN-RNCDYRIEVPDLNTIRFEFTAFGLEGGDNCAFDYIGIYDGANADAPIIGSRLCGATTPSQIMSTGNSLFVRFVTDGSVNNHGFQARFSAVPGGLEGCGGVLNRDMGAISSPGHPNQ--YPHGVSCTWYINVTPGLVIRLTFSAFTFEIASNTVCYFDYVAVYDNSTVSEQSLLGKYCGLAVPPILTSTDNVMTIFMQSDSSIAREGFTASYIA-INASLVCGSSLTTATGVITSPSYPNQYRHNAQCEWTITIADGSQISLNITDMDIETDSNC------NSDFLEIRNGGYLSSPLIQKFCGQVTPSVPILSHSNRLYVRFKSDSFGSGRGFRLEYT 1081          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. TrEMBL
Match: A0A2T7PRE4 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_02958 PE=4 SV=1)

HSP 1 Score: 1065.06 bits (2753), Expect = 0.000e+0
Identity = 977/3686 (26.51%), Postives = 1576/3686 (42.76%), Query Frame = 2
Query:  356 INSKLEIYSRKIESLETSLTTSN----HKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHG-CQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHSPTNPKP-FKCLCDSGWSLDPVTK--TCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNG----GTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGG---TYAVSNEYREISLFTSLLPSPSRSLHFPCIWTIISSNDQFLQII--PINLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPA--DVEAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSE-CKFDFIKI---SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVF--DCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIH----DNQT--KRFCGNHAKSGPTVT-HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITV--SESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCN-DKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDCEFPITSSSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISD---RSNTLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIANID-CQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKST--SGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNG-QCNRGNLIIYDSNY----DAKVFCGSGVIDSAIFTPPVTLI--LSAEGYRYPGFLIRWN--------PPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLF-NSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTFILR---SHFLNYILNLTALDLPPPTNGKCVNGFLKIL------------------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEE--LVISRIICNESFLAFFDGST--TFTQKIGGQN---FCGKT--NSIFTIGNVLTILFKNMDDFSY----FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDE--NCSKSNLTVIPVKESENAVIWSNCNS---STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCF----RIRA-RGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFS-----YNSDQPSLCGSNIYPNNNESGVITIENVNIS---LCQYNIHNYPEDEGTLSMFMSDNTGIP---CSNVYFVSKIG-NGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGL-NPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF-----FGCRYHDNQIQIDLEDQNGNYLPGQRICGK-SREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDT--NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQL 10996
            + S+L     ++ +L + L +      ++I  LE +   +K+ LT ++C +NPC NG  C+D YN F C CP N+KG  C+ DVNEC + +GT  G  Q+GA C N  GSFRC C+  W G+LC+  ++ C++AS+  +CGHGTC  + +    +P ++C+CD+GW+ +P +    C  D++EC   + PCS  P V C+N PG   C  CP GF GNGFTC DINEC       +  P  EC+N  G+  C       +     C    +C  NNGGC  +A CS N+  + G ICTC PGYSG+GVG NGCV  S+              LC N     G+C  S + + C C PG+ G  C +   N+C SNPCLNGG C       +RC C   ++G  C++    CGG    ++ S  Y  I+         + S    C W I +S ++ L I     +L+   +C+ +++Q+H+      + + IG YC  S       N+T + L        ++  + GF I     +          C     ++T ++ G   SP +P  Y  N +C     A  G    +      +   ++ +NCS  DYL+I         + +  CN               +HFHSD  S ++   F   +    +   CG  +T +   +I SP  P   +  A C W I   +S  +I     F+   +   S Q    E+      ++  +       +  +     N  ++ F     +    F       CG      + +    +S  YP  Y  + HCVY      + +I+++F  FD+ + +E C  ++++I       S  L ++YC      + T   N     +++ F++ ++ +GTGF A  +    DCGG        I+  P        +     Y     CTW I       +   F  F LE    C YD++++      DN +    +CG+   S  T T + L + F SD+SV+ EGF   + T      C  +  SS+G+IT+P       ++  C + I V    +I +N T    E    C                               Q + ++ SS    + +      +A  F   I Y      CG    +  G   SPNYP     N  C W I    G  IL+        S++    C  D   V +     +++   C   +          + + ++   S   R FR  YT DC   +T+ SG IES N    Y     C+W + +  G+ + I    FDL    N + Y ++ I D    S+ LL K CG+ + +   +S +  + I   TD S   N      G  LEY T GC             +  +G   S  +PNS  +   C+W      G ++ L F   EME+S NC    +   +         + Q C    +    ++ S+ +   ++  + N  +G  R F  T+      C    +   G+I S NYPN YPH+  C W +++ ++  + +   DF+ E   C +DYV ++   N    ++  +CG         + S  N M +K RTD +VS RGFKA +   CG ++ A   +  + SPNYP  Y  P+   C W  +  +S    RI   F   +  S N +C  D  + I+ G   N+ V    C      PI S+G  L V+  S+  S    F+A Y V +S+CGGDF    G F SP YPNS   + +CV+  ++SPG+ + LS   F+ E + S   +D+++ R   N    LLGR+   +   N T   K    VW++  S   D    + F+  ++  Y      D G L+SP++   Y  D  + WT+   S  ++   F    +  R++N  QC    ++I D       +   +CG+ +    I T     I  ++     Y GFL+ W         PP       +  C   +   ++T  LTSP YP        C W+I T   + + + + + DLES   C Y+               F++     K  +L+      F   LF   + I       D F G  L               G + +  YP+    N NCT+ +R      +N   N T  ++P   N  C + ++++L                      +   CGS +P  +  + T+S+ + V    NF S+   SG  ++    D    G      Y +              PH +EC W  ++P   ++Q+DFE    +     C   ++ F DG T  +    +G  N    CG     S+ + GN L + F    D S     F+ + KI +CGG +    G I SPNYP NY   S+C W + G     +  TF   +L+   NC+   + V    E+ N ++ + C S   +++D    YS V  +   N V++  GF L +      CGG+ + P     S N+P   +    C WKI V   +R+ +      + +        I    G+   S  L   C +N       T ++M   F + +++S       Y S    +CG       N +     E+ N +    C + + N      ++ + + D    P   C + +   + G +G    +E F   C          +  + +   F+    +    + + +  +F+ CGG LT   G I SP +P  Y  N  C WLI APE   I++T    +LE H  C +D+L I      DSP   K CG  NP    T+    N +RL F +D + S  GF   Y F   ++ C G++ +++G++ SPNYP  YP N  C W I V  GY + L     FDL+     + + +   I+ +    L    C N PP  P+ SS N++ L F +D N N  GF A + S CGG+++   G I S         ++ C Y I G  +H  ++   P F       C Y  + +Q+   + + + L G R CG  + + +  +HS  I+    +    +    F+A Y       V+++     +++TP +PS Y H++N +W        I ++   S ++E  +  C YD++     ++ S+  I  +CG     +P +I +  N + + F +D S  E+  GF      T GP  GCGG++N T G    I+S+D++ +G YE+NL C+W I        ++ F   S  LE       C YD + +YDG  +   ++   CG     ++   SNVM ++F+TD +I  SGF   F    +    I   T+  Q + SP YP+ S   +R    + +      +++T+ D+ +     C+ D    +D+ +    +   +C + +  + F S+   V + Y         ++ +R F +SY+    NR   + +GRI +        Y  N  C++++ +P        YF  F++E  S C +D+++   G       VL ++CGS++P      S+   + FVTD S+ + GYDIT+       + CGG++    G +TSP F  N+ +S  C+W I + S   ++  F+ + +
Sbjct:  127 LGSRLTTLEARVSALASHLGSGESGLLNQIQTLEADVQNLKQLLTTNECQSNPCQNGGTCVDSYNGFICQCPPNWKGVTCSADVNECGEYAGTDRGSSQHGATCVNLPGSFRCDCAPNWYGILCSSSVDDCASASHQALCGHGTCINEANTHVGQPRYRCICDNGWTHNPNSSDPACNTDVNECLASQSPCSTDPQVQCINVPGTFYCGPCPAGFNGNGFTCQDINECEINNGGCSISPRVECINTRGSRACGPCPAGYQGNGVTCTWVGLCSNNNGGCHPSATCSENSATVSGVICTCPPGYSGNGVGSNGCVTDSSGT------------LCSNNPCQHGSCMVSGSTYVCSCNPGYTGRNCDSDF-NECSSNPCLNGGTCINSI-GSFRCQCSSNYNGNLCQSAQQSCGGYLNGFSGSFSYPPIT-------GTNYSHSVSCAWQITTSANKILMITFRRFSLEFHPECNFDFLQIHDGP--TASAHTIGTYCGNSLPNGGSINSTHNQLYFWFKSDASVASD-GFDILWTSADPV--------CGG---QLTDVSYGTINSPGYPGNYPINRDCIWTISASPGNVISITFAYMAI---EVHANCS-YDYLEIRSGLTASSPLVVRHCNTTSPPPVTTSGPFAYIHFHSD--SSLSDRGFLLTYAATQAGAGCGGVLTGS-RGVITSPNFPEPYNHNAMCVWTISVNSSDIIILHFAHFD--LETSSSCQYDYLEVRDGINERSPVLGTYCSNSVPSDVRTTGNVMFVKFVTDSNLHGSGFSAWWTVGCGGVFTASQGT---LRSPGYPNGYPPSKHCVYLISQPSSYRISLTFSAFDVENAAESCTDNYVEIRDGGSETSPLLGEQYCGSALPPVQTSTGN----LMVVIFRTGNSVSGTGFLATYTAHTSDCGG--------ILTGPRGEFTSPGH--PNIYPHGVNCTWYIRPAEGLIVQLTFWTFMLEGGA-CTYDFVKVYDSFNADNGSLIGTYCGSSFPSLITSTNNALTVVFQSDSSVAMEGFSATYITQNATTACGRNMASSTGVITSPDFPNNYPHNRDCVWVITVGAGNQIQLNFTTFNLEQHARC-------------------------------QYDYLEISSRLW-LRFHSDNSMSAPGFQ--IVYDGTASGCGGDLTTPTGSFVSPNYPNPYDHNAECYWTITVAQGSSILLTFEDF---SMENHIQCMYDYVEVRENNAFGRQLGKFCGTTLPAPVNSTANKLWIKYRTDFSISGRGFRALYTSDCTNRLTAFSGAIESPNYPQPYPHNISCTWIIDTTEGNAVNISFATFDLESDSNCR-YDYLEIRDGGSSSSNLLGKYCGSSIPSPLSSSGDQ-VWIRLVTDISVRGN------GFHLEYITHGCGGLL---------TGPSGTFSSPNYPNSYDHARVCEWLITVETGKAISLTFTDFEMETSHNCQYDAV-EVFAGSDDTGIMIAQLCQHYTNWTQSVM-STGNTMLVRMRTDNSLSG--RGFSATFSAIGGGCGGNFTTMNGVIMSKNYPNNYPHSTECEWLIQLPDNHPVVINFTDFDVEGGYCSFDYVALYDGPNAGYPEMARVCGSSLPSPSL-YRSSTNSMFVKMRTDSSVSGRGFKANFSAGCGVVKNA-SIDGVITSPNYPGNY--PNNANCTW--LITSSHNTDRITLTFTHMDIMSLN-SCQYD-YVRILNGGNINAPVIGTYCGDVVPSPITSDGSNLFVVFASSLFSQATGFRAVYTVSTSSCGGDFTAQSGAFNSPGYPNSYPPNTECVWTFQSSPGNRVALSFSLFNIEASDS-CNNDYLEARQNDNN-GLLLGRWCGTNIPTNVTAMNK----VWVKFVSN--DQITGVGFMGNWNGEYGGNLLGDSGQLSSPRYPQQYPNDVSVAWTITVSSGMQVLIAF----LFMRIENSIQCTFDYVLIRDGGLSDSPEIGRYCGANLPGPIISTSNQVRIEFVTDASLTYQGFLLNWQATNEMPTAPPTGVTPPTVAGCGGSVVVGSETVTLTSPGYPYGYAANLNCIWSITTPVGQRIWLNISNIDLESHQSCFYD---------------FVKIYNCKKFHNLHKFLLTCFSVELFYMQMCICVHGLSVDKFCGGSLVIPT-----------GIISSPSYPSNYPSNSNCTWNVRVTVGRTVNVQFNGT-FNIPSTVN--CSSDYVQLLNGGHTNSPPLINANATSATATASGRYCGSGLPA-VSSLETSSNLLTV----NFVSDGSGSGTLML---TDSVRMGYFTSPNYPNPY------------PHNVECIWIISAPANKKIQVDFELPFRLEQHSRCRYDYIEFRDGGTQDSPVMNVGHNNNSRICGDQLPGSVLSTGNALYVRF--FTDVSVTSVGFKAEYKIATCGGRIFSVNGSITSPNYPSNYESNSNCSWLVYGPVGHYLTFTFNAFNLESSTNCTNDFVEVREYNETGNLLLRA-CGSNLPASFDTSDSYSYVLFVSNQNVVSS--GFSLSFQASVEECGGDLTTPSGVFTSPNFPGLYAHSRVCEWKIIVQQDRRVTLTFDVFTLEESSICAWDNIEVFNGIMPDSPRLGRFCGTNNPGVIESTGNTMRVRFRTDSSVSHGGFSARYTSVNEKVCGQLYTTPGNITSPGYYEHGNYTNNLECIWRVENPARTNSSILVIVDDLALEPHLTCVHDFLEVREGRDGDGSIIEKF---CGNNTIPPPVLSPSQHIWLRFRTDGSIVDRGFAITV--QFTTCGGELTAPQGQITSPNFPNNYEHNDGCAWLISAPEGERIRITFSDFNLEEHSSCVFDYLKILNGGLPDSPLIGKYCGTSNP---GTILSQSNHLRLMFVTDINQSGRGFRATYTF--DSEACGGLLQSSQGTVSSPNYPSSYPPNTECEWEIRVDSGYILILNVNSSFDLQPGDCSSDYLEITDILANGTQVLKGRYCSNAPP--PVTSSFNRLLLKFHSDGNINGNGFSASWTSDCGGIFNSPTGVITSPGYPRNYRNNLRCNYTIYGDTDHYIILTFNPAFNLEGGTSCPY--DYVQVFAGNSSSSPLQG-RFCGNVAPQPVNALHSMHIRFWTDSS---VVASGFQATYRVSACGGVYTEPTG--LIQTPTYPSSYPHDSNCSWFITVDPEKIIALKFISFNVE-PHSRCLYDYLDVFDGNNTSAPKIGRYCGTH---APDVIKSSGNAMYINFVTDSS--ESGEGFQGGYWSTYGPQHGCGGFLNQTSGQ---IRSVDINGDGNYEDNLDCRWTIMVEPNKLARLTFS--SFHLEPGEE---CSYDSVAVYDGFSTTDSLLGQFCGSSIPSALRAFSNVMLVVFTTDGSIGFSGFVAQFGQEDALCGGILIATDMPQNISSPNYPSPSSQAVRCRWTIDSGAPNKQVSLTLLDIDLTPDAQCTQDYMEFRDSPMGELGQSVHYCGT-TVPQTFYSAGQVVQVIYNTA-----GNSQNRGFILSYKQDDFNREFVSTNGRITSPG--YPGVYPQNANCSISVRSPN-GTTLALYFTQFHIEPHSQCLFDFLEIHNGSNASSP-VLARLCGSTLPDPVFIPSNVAFLRFVTDASVQHVGYDITFTSTTQ-GLGCGGQLSGIKGSLTSPNFPGNFSDSTTCTWIITVPSRRVVQITFSYLAV 3573          

HSP 2 Score: 446.432 bits (1147), Expect = 1.755e-121
Identity = 729/3207 (22.73%), Postives = 1220/3207 (38.04%), Query Frame = 2
Query: 2387 CTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHL--KVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAETRK-IAISFLDFDINDDSECKFDFIKI-SG-SNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGF----RAKVSVFDCGGSFFLTNKLIIG--YPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQTKR------FCGNHAKSGPTVTHKLV-IRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEK-LSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQ-ATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN----HIRSGSV--DETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYY-----TQDCEFPITSSSGRIESKN-----EMLRYCSWKLSSLRGSKILIQIDKFDLPPLQNGQC-YSFVRISDR-------SNTL-----------LKKSCGNQLLNRT--FTSSNYPIRIEHYTD------RSTHSNVIRAHEGIVLEYQTQGCMETF-------------------------------YYDPHESDYSTK-------------------NGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET---CGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPII----SNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISY--ILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGD---------FTNHIKFLAKYHINYNT---EFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSNYDAKV---FCGSGVIDSAIFTPPVTL-ILSAEGYRYPGFLIRWNPPVDENFKKIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTG-SKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNP---------------LEGS----LQNVEYPNKIFENKNCTFILRSHFLNYI-LNLTALDLPPPTNGKCVNGFLKILA----MNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYS--KKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEEL--VISRIICNESFLAFFDGSTTFTQKI-----------GGQNFCG----KTNSIFTIGNVLTILFKNMDDFSYFRLKVKIGSCGGLLHR----RQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIP-----VKESENAVIWSNCNSST------WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKK--LKMNQGCFR--IRARGVGYRSVLLYIICASNL-ENFEIDTKSSMI------EVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIEN-----VNISLCQYNIHNYPEDEGTLS--MFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPE--KYPDNTDCEWLIIAPE--NMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNA--VTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY---KSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLED--QNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVX--XXXXXXXXXDAIFCGNLTNISPFMIDT-NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGG-YMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTN-FSQLLESPRYPNNSPYDLRFMGELIAANETDHIT-ITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQK--------KYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQF---ILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYV---VNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQA-----LKYCGYILLDEEFQIPSS---------------SFTVEYKSLTGGVGAGFRIS 11185
            C W+I  + +  L+     F   F  +C+      +I        H I       L          N+ Y +FK    +++  F I   SA+  CG    + ++S     S  YP NY  N  C++   A     I+I+F    I   + C +D+++I SG + S  L  R+CN      +T +         I F S+S+ +  GF     A  +   CGG    +  +I    +PE             Y  N +C W I+      I   F  F LE+  +C YDYLE + D   +R      +C N   S    T  ++ ++FV+D+++ G GF   ++TV     C   F +S G + +P        S  C Y I  P   +I  ++T S  D    A  C      ++              C +      ++TS+    +         +G   +   Y++   +CG I     G   SP +P   P    C W IR  P + +++++      +  G+   D  K+ +  N           I   C      +      ++ V+FQ+ +S     F   Y     T  C   + SS+G I S +        R C W ++   G++I +    F+L   Q+ +C Y ++ IS R        N++               CG  L   T  F S NYP   +H  +       +  S+++   E   +E   Q CM  +                                +  + +D+S                     +G I+S  +P     NI C W   T  G +V + F   ++ES  NC     L   +      N + + C          + SS    +++  +     G         E+  + C   ++G  G   SPNYPN Y H   C W + V+   +I L   DFE E S  C+YD VE+F+  ++  + +  LC    N+ Q+  S+  N ML++ RTD+++S RGF A +      CGG    M  N  ++S NYP+ Y  P    CEW L+       + I F     EGG     CS D  + + +G        A +C  S   P +    +N  ++K+   S+     FKA +  G           DG+ TSP YP +   + +C ++I +S   + D     F+  + +S     +D++ I NG N  + ++G +                D V   + S G +         F+    F A Y ++ ++   +F +  G   SP + + Y  +TE  WT  +    ++  +F  F++     +  CN   L    ++ +  +   +CG+ +  +      V +  +S +     GF+  WN     N   +GD          +  L+SP YP          WTI       + I  L   +E+S +C ++   +   G S +P      Y      G + ++          N ++I +  D    + GF L+++         P               + GS    L +  YP     N NC + + +     I LN++ +DL   ++  C   F+KI       N++K L                          FS E  Y    I       D+ CGG   +     + I+   S   +  P    C W+     G  + + F     + S + C+  ++   +G  T +  +               +CG      +S+ T  N+LT+ F            V  GS  G L      R GY  SPNYP  YP    CIW IS  +   I++ F      E  S+     I       ++S    +  N NS          + +  + + + F T+   T  GFK +Y      CGG        + S NYP        C+W +   V   +        L+ +  C    +  R       LL   C SNL  +F+     S +       V  SG ++SF  + ++   CG ++      SGV T  N      +  +C++ I    +   TL+  +F  + + I C+  +   ++ NG+       G  C   N     ST G  +   F+    V+   +         +  G L  + G I SPGY E   Y +N +C W +  P   N  I + +  L LE HL C +D L +R   + D     K CG N I    LS  +  + L F +D S+   GF I   F     TC G +   +G I SPN+P  Y  N  C W I  PEG ++ +TF   F+LE  S  +C +D L+I++       L+ + CG   P   ++ S N + L+F TD N +  GF A Y      CGG+    QG + S N       +  CE+ I     ++ ++ +  +F       +   +++ D   NG  +   R C  +   +T   ++ +   ++  N  +    F A +  D        F  P  V+ +P +P  Y +N    +       +   +             C YD+V      +SS+     FCG   N++P  ++  + + +RF +D S     +GF A        +  CGG Y   T    G+I++    ++  +++N  C W I       + + F   S ++E  SR   C YD++ ++DG +++ P I   CG    D I +  N MY+ F TD +    GF+  + +     H      N  S  + S     +  Y+           E + +  +T     +     CS D   + D     ++ + +FC S S      +  + +++ +           TD     S  +    + E A  G I+   +  Q           S  + C  T+ + APN +        +L   + C  DY++F    +GE G+  +     CG+++P +F +    V +I+ T  +    G+ ++Y     NR        E    +G ITSPG+   Y ++  CS +++  + + +   FT         +EP      DF+++  G+ A      + CG  L D  F IPS+                + + + S T G+G G ++S
Sbjct:  550 CAWQITTSANKILMITFRRFSLEFHPECNFDF--LQIHDGPTASAHTIGTYCGNSLPNGGSINSTHNQLYFWFKSDASVASDGFDILWTSADPVCGG--QLTDVSYGTINSPGYPGNYPINRDCIWTISASPGNVISITFAYMAIEVHANCSYDYLEIRSGLTASSPLVVRHCNTTSPPPVTTSG----PFAYIHFHSDSSLSDRGFLLTYAATQAGAGCGGVLTGSRGVITSPNFPE------------PYNHNAMCVWTISVNSSDIIILHFAHFDLETSSSCQYDYLE-VRDGINERSPVLGTYCSNSVPSDVRTTGNVMFVKFVTDSNLHGSGF-SAWWTVG----CGGVFTASQGTLRSPGYPNGYPPSKHCVYLISQPSSYRI--SLTFSAFDVENAAESCTDNYVEIRDGGSETSPLLGEQYCGS--ALPPVQTSTGNLMVVIFRTGNSVSGT-GFLATYTAHTSDCGGILTGPRGEFTSPGHPNIYPHGVNCTWYIR--PAEGLIVQLTFWTFMLEGGACTYDFVKVYDSFN-----ADNGSLIGTYCGSSFPSLITSTNNALTVVFQSDSSVAMEGFSATYITQNATTACGRNMASSTGVITSPDFPNNYPHNRDCVWVITVGAGNQIQLNFTTFNLE--QHARCQYDYLEISSRLWLRFHSDNSMSAPGFQIVYDGTASGCGGDLTTPTGSFVSPNYPNPYDHNAECYWTITVAQGSSILLTFEDFSMENHIQ-CMYDYVEVRENNAFGRQLGKFCGTTLPAPVNSTANKLWIKYRTDFSISGRGFRALYTSDCTNRLTAFSGAIESPNYPQPYPHNISCTWIIDTTEGNAVNISFATFDLESDSNCRYD-YLEIRDGGSSSSNLLGKYCGSS---IPSPLSSSGDQVWIRLVTDISVRGNGFHL----EYITHGCGGLLTGPSGTFSSPNYPNSYDHARVCEWLITVETGKAISLTFTDFEMETSHNCQYDAVEVFAGSDDTGIMIAQLCQHYTNWTQSVMST-GNTMLVRMRTDNSLSGRGFSATFSAIGGGCGGNFTTM--NGVIMSKNYPNNY--PHSTECEW-LIQLPDNHPVVINFTDFDVEGGY----CSFD-YVALYDGPNAGYPEMARVCGSSLPSPSLYRSSTNSMFVKMRTDSSVSGRGFKANFSAGCGVVKNASI--DGVITSPNYPGNYPNNANCTWLITSS--HNTDRITLTFTHMDIMSLNSCQYDYVRILNGGNINAPVIGTY--------------CGDVVPSPITSDGSNLFVVFASSLFSQATGFRAVYTVSTSSCGGDFTAQSGAFNSPGYPNSYPPNTECVWTFQSSPGNRVALSFSLFNIEA---SDSCNNDYLEARQNDNNGLLLGRWCGTNIPTNVTAMNKVWVKFVSNDQITGVGFMGNWNGEYGGNL--LGD----------SGQLSSPRYPQQYPNDVSVAWTITVSSGMQVLIAFLFMRIENSIQCTFDYVLIRDGGLSDSPEIG--RYCGANLPGPIISTS---------NQVRIEFVTDASLTYQGFLLNWQATNEMPTAPPTGVTPPTVAGCGGSVVVGSETVTLTSPGYPYGYAANLNCIWSITTPVGQRIWLNISNIDLE--SHQSCFYDFVKIYNCKKFHNLHKFL-----------------------LTCFSVELFYMQMCICVHGLSVDKFCGGSLVI----PTGIISSPSYPSNY-PSNSNCTWNVRVTVGRTVNVQFNGTFNIPSTVNCSSDYVQLLNGGHTNSPPLINANATSATATASGRYCGSGLPAVSSLETSSNLLTVNF------------VSDGSGSGTLMLTDSVRMGYFTSPNYPNPYPHNVECIWIISAPANKKIQVDFELPFRLEQHSRCRYDYIEFRDGGTQDSPVMNVGHNNNSRICGDQLPGSVLSTGNALYVRFFTDVSVTSVGFKAEYKIA--TCGGRIFSVNGSITSPNYPSNYESNSNCSWLVYGPVGHYLTFTFNAFNLESSTNCTNDFVEVREYNETGNLLLRACGSNLPASFDTSDSYSYVLFVSNQNVVSSGFSLSFQASVEE---CGGDL---TTPSGVFTSPNFPGLYAHSRVCEWKIIVQQDRRVTLTFDVFTLEESSI-CA--WDNIEVFNGIMPDSPRLGRFCGTNNPGVIEST-GNTMRVRFRTDSSVSHGGFSARYTSVNEKVCGQLYTTPGNITSPGYYEHGNYTNNLECIWRVENPARTNSSILVIVDDLALEPHLTCVHDFLEVREGRDGDGSIIEKFCGNNTIPPPVLSPSQ-HIWLRFRTDGSIVDRGFAITVQFT----TCGGELTAPQGQITSPNFPNNYEHNDGCAWLISAPEGERIRITFS-DFNLEEHS--SCVFDYLKILNGGLPDSPLIGKYCGTSNPGTILSQS-NHLRLMFVTDINQSGRGFRATYTFDSEACGGLLQSSQGTVSSPNYPSSYPPNTECEWEIRVDSGYILILNVNSSFDLQPGDCSSDYLEITDILANGTQVLKGRYCSNAPPPVTSSFNRLLLKFHSDGN--INGNGFSASWTSD----CGGIFNSPTGVITSPGYPRNYRNNLRCNYTIYGDTDHYIILTFNPAFNLEGGTSCPYDYVQVFAGNSSSSPLQGRFCG---NVAPQPVNALHSMHIRFWTDSSVVA--SGFQATYR-----VSACGGVYTEPT----GLIQTPTYPSSYPHDSN--CSWFITVDPEKIIALKFI--SFNVEPHSR---CLYDYLDVFDGNNTSAPKIGRYCGTHAPDVIKSSGNAMYINFVTDSSESGEGFQGGYWSTYGPQHGCGGFLNQTSGQIRSVDINGDGNYEDNLDCRWTIMVEPNKLARLTFSSFHLEPGEECSYDSVAVYDGFSTTDSLLGQFCGS-SIPSALRAFSNVMLVVF----------TTDGSIGFSGFVAQFGQ-EDALCGGILIATDMPQNISSPNYPSPSSQAVRCRWTIDSGAPNKQVSLTLLDIDLTPDAQCTQDYMEFRDSPMGELGQSVH----YCGTTVPQTFYSAGQVVQVIYNTAGNSQNRGFILSYKQDDFNR--------EFVSTNGRITSPGYPGVYPQNANCSISVRSPNGTTLALYFTQFH------IEPHSQCLFDFLEIHNGSNASSPVLARLCGSTLPDPVF-IPSNVAFLRFVTDASVQHVGYDITFTSTTQGLGCGGQLS 3531          

HSP 3 Score: 436.417 bits (1121), Expect = 2.229e-118
Identity = 678/2937 (23.08%), Postives = 1156/2937 (39.36%), Query Frame = 2
Query: 1709 CSEEYVQLHEKSPFEEATNLIG-KYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI----NFVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADV--EAFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKISGSNS-GHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLEL-----IHDNQTKRFCGNHAKSGPTVTHKLV-IRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTL-EKLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINH--IRSG--SVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQ--SVHVIFQNLASTKYR-FRLYYTQDCEFPITSS-SGRIESKNEMLRY-----CSWKLSSLRGS-KILIQIDKFDLPPLQNGQCYSFVRISDRSNT---LLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVF--QACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETEESL-CRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFET------------------CGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGHYLKVILKSTSGNAIFK----AAYGVGSST-CGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSD---YGVLASPQFGHVYNQDTEITWTVFAESSEKLQ------FTFDQFSVGR----RLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFK---KIGDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTFIL-----RSHFLNY-ILNLTALDLPPPTNGKCVNGFLKILAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQI--DFEELVIS-RIICNESFLAFFDGSTTFTQKIGGQNFCGKTN---SIFTIGNVLTILFKNMDDF--SYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSST-WDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKV-KKLKMNQG--------CFRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENV-----NISLCQYNIHNYPEDEGTLSMFMSDNT--GIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEY-NFINPADTCNGIIFNTEGSIKSP--NYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQY---KSICGGVY---DLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF-FGCRYHDNQIQIDLEDQNGNYLPGQRI--CGKSREKITIMHSKSIKIVY-TARNFHLKNYNFRARYLHDENVKVFSDFKRPYV-----LKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGF-VAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA 10102
            C++ YV++ +     E + L+G +YC   ++ P    +TG+++++      ++    GF              DC     G         G F SP  P  Y   +NC    +   G    V+L   T  L   +      D++++    N  +  +  T C  +         N   V F SDS   V    F   +    +   CG  +  +   +I SP  P +      C W I     +++                +  + F +    R Q              ++L++ +  ++ F     +S P FQI        CG  +      T  F S NYP  Y  N+ C +    A+   I ++F DF + +  +C +D++++  +N+ G    ++C       +    N    K+ I ++++ + +G GFRA +   DC      TN+L        +    Y +   Y  N  CTW I T     +   F  F LES  NC YDYLE+        N   ++CG+   S  + +   V IR V+D SV G GF + + T      C       SG  ++P       ++  C + I V   K I +  T  E + S     C   A             IA +C       +   S+    +  M      +G   ++  +S++   CG    +  G I S NYP   P +T C W I+      ++I      +  G  S D   L +  N          E+  VC   +    ++     S+ V  +  +S   R F+  ++  C     +S  G I S N    Y     C+W ++S   + +I +     D+  L + Q Y +VRI +  N    ++   CG+ ++    TS    + +   +   + +   RA    V    T  C           D++ ++G   S  +PNS   N +C W FQ+ PG  V L F +  +E+S +C+    L A +N   D N +   + C     G +I    +  N     F +ND   G+  F G +   N      + G  G + SP YP  YP+++  +W + V   M + +  L    E S+ C +DYV I     +D  ++   CG  AN +     S +N++ I+F TD +++ +GF   +  T                  CGG  +       L SP YP+ Y   +  C W++   T+ +G RI+      +  S+  +C  D              VK   C K  +H    N H  K +L   S    +       +G+     CGG   +  G+ +SP YP++   + +C + +R + G ++++         +      D++ + NG +  S  L      S     +  Y  +    +       +    + F++       T   +D    G   SP + + Y  + E  W + A +++K+Q      F  +Q S  R       +G      ++    N ++++ CG  +  S         +LS     Y  F    +      FK   KI  C   I + N +  +TSPNYP+   +   C+W +       L     +F+LESS  C  +   V E+  + N        + +  CGS   + F+   +Y +    + + +++     GF LS++ +   C  D   P  G   +  +P     ++ C + +     R   L + +  L    +    N +  NG +   +  + +  CG+N      P +  S+   + +     S   + GF   Y+  +E+  G+   T      I            + +EC W   +P  T   I    ++L +   + C   FL   +G       I  + FCG       + +    + + F+         F + V+  +CGG L   QG I SPN+P NY     C W IS      IR+TF D +L+E+  C    L ++     ++ +I   C +S    I ++ + +R++F T+   + +GF+  Y F+   CGG     +  ++S NYP +      C W+I VD    +I+ V     +  G           I A G     VL    C++            +++    G      +++   S CG  I+  N+ +GVIT         N   C Y I+   +    L+   + N   G  C   Y     GN    P++    G      + +  ++    +  F     V  S ++    Y+ S CGG+ TE  G I++P YP  YP +++C W I      II L   + ++E H  C YD+L +       +P   + CG +  + + +    N M ++F +D S S  GF   Y +   P   C G +  T G I+S   N    Y  NL C WTI V       LTF   F LE      C YDS+ + D  + T  LL + CG+  PS  + +  N M +VF+TD +    GF AQ+    ++CGG+    D+ Q  I S N    +  ++ C + I     + QV     +          Q  ++  D     L GQ +  CG +  +      + ++++Y TA N   +N  F   Y  D       DF R +V     + +P +P  Y  NAN +    +P G   ++      IE  +  C +DF+     S+ SS  +   CG+ T   P  I +NV  +RF +D S    H G+ + F + T G  LGCGG ++   G  G + S +   N  + ++  C W I  P    V++ F    +++ G++    C  +++ I+DGP +    +   C ++Q   +T  SN   +   +  +     F++ +++
Sbjct:  928 CTDNYVEIRDGG--SETSPLLGEQYC--GSALPPVQTSTGNLMVVIFRTGNSVSGT-GFL-----ATYTAHTSDCGGILTGP-------RGEFTSPGHPNIYPHGVNCTWYIRPAEG--LIVQLTFWTFML---EGGACTYDFVKVYDSFNADNGSLIGTYCGSSFPSLITSTNNALTVVFQSDS--SVAMEGFSATYITQNATTACGRNMASS-TGVITSPDFPNNYPHNRDCVWVITVGAGNQI---------------QLNFTTFNLEQHARCQ-------------YDYLEISSRLWLRFHSDNSMSAPGFQIVYDGTASGCGGDLTT---PTGSFVSPNYPNPYDHNAECYWTITVAQGSSILLTFEDFSMENHIQCMYDYVEVRENNAFGRQLGKFCG----TTLPAPVNSTANKLWIKYRTDFSISGRGFRA-LYTSDC------TNRLTAF--SGAIESPNYPQP--YPHNISCTWIIDTTEGNAVNISFATFDLESDSNCRYDYLEIRDGGSSSSNLLGKYCGSSIPSPLSSSGDQVWIRLVTDISVRGNGFHLEYIT----HGCGGLLTGPSGTFSSPNYPNSYDHARVCEWLITVETGKAISLTFTDFEMETS---HNCQYDAVEVFAGSDDTGIMIAQLCQHYTNWTQSVMSTGNTMLVRMRTDNSLSGR-GFSATFSAIGGGCGGNFTTMNGVIMSKNYPNNYPHSTECEWLIQLPDNHPVVINFTDFDVEGGYCSFDYVALYDGPN------AGYPEMARVCGSSLPSPSLYRSSTNSMFVKMRTDSSVSGRGFKANFSAGCGVVKNASIDGVITSPNYPGNYPNNANCTWLITSSHNTDRITLTFTHMDIMSLNSCQ-YDYVRILNGGNINAPVIGTYCGD-VVPSPITSDGSNLFVVFASSLFSQATGFRA----VYTVSTSSC---------GGDFTAQSGAFNSPGYPNSYPPNTECVWTFQSSPGNRVALSFSLFNIEASDSCNND-YLEARQN---DNNGLLLGRWC-----GTNIPTNVTAMNKVWVKFVSNDQITGV-GFMGNW---NGEYGGNLLGDSGQLSSPRYPQQYPNDVSVAWTITVSSGMQVLIAFLFMRIENSIQCTFDYVLIRDGGLSDSPEIGRYCG--AN-LPGPIISTSNQVRIEFVTDASLTYQGFLLNWQATNEMPTAPPTGVTPPTVAGCGGSVVVGSETVTLTSPGYPYGYAA-NLNCIWSI---TTPVGQRIWLNISNIDLESHQ-SCFYD-------------FVKIYNCKK--FH----NLH--KFLLTCFSVELFYMQMCICVHGLSVDKFCGGSLVIPTGIISSPSYPSNYPSNSNCTWNVRVTVGRTVNVQFNGTFNIPSTVNCSSDYVQLLNGGHTNSPPLINANATSATATASGRYCGSGLPAVSSLETSSNLLT-VNFVSDGS-GSGTLMLTDSVRMGYFTSPNYPNPYPHNVECIWIISAPANKKIQVDFELPFRLEQHSRCRYDYIEFRDGGTQDSPVMNVGHNNNSRI-CGDQLPGS---------VLSTGNALYVRFFTDVSV-TSVGFKAEYKIATCGGRIFSVNGS--ITSPNYPSNYESNSNCSWLVYGPVGHYLTFTFNAFNLESSTNCTNDFVEVREYNETGN--------LLLRACGSNLPASFDTSDSYSY----VLFVSNQNVVSSGFSLSFQASVEECGGDLTTP-SGVFTSPNFPGLYAHSRVCEWKIIVQQDRRVTLTFDVFTLEESSICAWDNIEVFNGIMPD-SPRLGR-FCGTN-----NPGVIESTGNTMRVRFRTDSSVSHGGFSARYTSVNEKVCGQLYTT---PGNITSPGYYEHGNYTNNLECIWRVENPARTNSSILVIVDDLALEPHLTCVHDFLEVREGRDGDGSII--EKFCGNNTIPPPVLSPSQHIWLRFRTDGSIVDRGFAITVQFTTCGGELTAPQGQITSPNFPNNYEHNDGCAWLISAPEGERIRITFSDFNLEEHSSCVFDYLKILNGGLPDSPLIGKYCGTSNPGTILSQSNHLRLMFVTDINQSGRGFRATYTFDSEACGGLLQSSQGTVSSPNYPSSYPPNTECEWEIRVDSGYILILNVNSSFDLQPGDCSSDYLEITDILANGT---QVLKGRYCSNAPPPVTSSFNRLLLKFHSDGNINGNGFSASWTSDCGG-IF--NSPTGVITSPGYPRNYRNNLRCNYTIYGDTDHYIILTFNPAFNLEGGTSCPYDYVQVFAGNSSSSPLQGRFCGNVAPQPVNALHSM----HIRFWTDSSVVASGFQAT--YRVSACGGVYTEPTGLIQTPTYPSSYPHDSNCSWFITVDPEKIIALKFISFNVEPHSRCLYDYLDVFDGNNTSAPKIGRYCGTH--APDVIKSSGNAMYINFVTDSSESGEGFQGGYWSTYGPQHGCGGFLNQTSGQIRSVDINGDGNYEDNLDCRWTIMVEPNKLARLTFS-SFHLEPG--EECSYDSVAVYDGFSTTDSLLGQFCGSSIPS-ALRAFSNVMLVVFTTDGSIGFSGFVAQFGQEDALCGGILIATDMPQ-NISSPNYPSPSSQAVRCRWTIDSGAPNKQVSLTLLDIDLTPDAQCTQDYMEFRDSPMGEL-GQSVHYCGTTVPQTFYSAGQVVQVIYNTAGN--SQNRGFILSYKQD-------DFNREFVSTNGRITSPGYPGVYPQNANCSISVRSPNGTTLALYFTQFHIE-PHSQCLFDFLEIHNGSNASSPVLARLCGS-TLPDPVFIPSNVAFLRFVTDAS--VQHVGYDITFTSTTQG--LGCGGQLS---GIKGSLTSPNFPGN--FSDSTTCTWIITVPSRRVVQITFS--YLAVPGQAD---CTNNYVEIFDGPSTFARTLGRFC-NEQPSLLTASSNSATVQLVSTGSSPTPSFRIVYSS 3636          

HSP 4 Score: 231.491 bits (589), Expect = 2.486e-56
Identity = 243/981 (24.77%), Postives = 407/981 (41.49%), Query Frame = 2
Query: 8321 CGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHR---NRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT---LLSELCGNIPPSNPINSSL-NQMSLVFSTDFNHNLEGFHAQYK---SICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFF----GCRYHDNQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSD--FKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICG--SSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQA-----LKYCGYILLDEE-FQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            CGG+LT S G I SP +PE Y  N  C W I    + II L      LE    C YD+L +R      SP     C     SN   S  R   N M + F +D ++  +GF   +        C G+   ++G+++SP YP  YP +  C + I  P  Y++SLTF   FD+E  +  +C  + + I D  + T   L  + CG+  P  P+ +S  N M ++F T  + +  GF A Y    S CGG+    +GE  S     I    + C + I   E  L V   +  F      C Y   ++       NG+ +     CG S   +    + ++ +V+ + +  +    F A Y+                 V+ +P+FP+ Y HN +  W+     G    +N  + ++E+ +  C YD++                           ++ L +RF SD S   +  GF    +   G   GCGG +    G++     +  +    Y++N  C W I    G ++ + FE+   S+E   +   C YD++ + +     R  +   CG      + + +N +++ + TDF+I   GF+  +T+          +T FS  +ESP YP   P+++     +I   E + + I+     + S  NC  D   I+D      N + K+C S     +  S  D+V I+     + +I S     F + Y  + C       SG   +  N+    Y H  +C   LIT          F  F +E S  C YD ++   G   +   ++ ++C   ++   S ++  + + +   TD S++  G+  T+         CGG     +GVI S  +  NY  S EC W I+L  N  +   FTD  +          Y + D+V +  G  A      + CG  L     ++  ++S  V+ ++ +   G GF+ ++S
Sbjct:  761 CGGVLTGSRGVITSPNFPEPYNHNAMCVWTISVNSSDIIILHFAHFDLETSSSCQYDYLEVRDGINERSPVLGTYC-----SNSVPSDVRTTGNVMFVKFVTDSNLHGSGFSAWWTV-----GCGGVFTASQGTLRSPGYPNGYPPSKHCVYLISQPSSYRISLTFSA-FDVENAA-ESCTDNYVEIRDGGSETSPLLGEQYCGSALP--PVQTSTGNLMVVIFRTGNSVSGTGFLATYTAHTSDCGGILTGPRGEFTSPGHPNIYPHGVNCTWYIRPAEG-LIVQLTFWTFMLEGGACTYDFVKVYDSFNADNGSLI--GTYCGSSFPSLITSTNNALTVVFQSDS-SVAMEGFSATYITQNATTACGRNMASSTGVITSPDFPNNYPHNRDCVWVITVGAGNQIQLNFTTFNLEQ-HARCQYDYLEI-------------------------SSRLWLRFHSDNSM--SAPGFQIVYD---GTASGCGGDLTTPTGSF-----VSPNYPNPYDHNAECYWTITVAQGSSILLTFED--FSMENHIQ---CMYDYVEVRENNAFGRQ-LGKFCGTTLPAPVNSTANKLWIKYRTDFSISGRGFRALYTS-----DCTNRLTAFSGAIESPNYPQPYPHNISCT-WIIDTTEGNAVNISFATFDLESDSNCRYDYLEIRDGGSSSSNLLGKYCGSSIPSPLSSSG-DQVWIRL----VTDI-SVRGNGFHLEYITHGCGGLLTGPSGTFSS-PNYP-NSYDHARVCEW-LITVETGKAISLTFTDFEMETSHNCQYDAVEVFAGS-DDTGIMIAQLCQHYTNWTQSVMSTGNTMLVRMRTDNSLSGRGFSATFSAIGG---GCGGNFTTMNGVIMSKNYPNNYPHSTECEWLIQLPDNHPVVINFTDFDVEGG-------YCSFDYVALYDGPNAGYPEMARVCGSSLPSPSLYRSSTNSMFVKMRTDSSVSGRGFKANFS 1655          

HSP 5 Score: 127.102 bits (318), Expect = 9.774e-25
Identity = 121/471 (25.69%), Postives = 199/471 (42.25%), Query Frame = 2
Query: 9737 CGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVD--SITTQSNVMYLIFSTDFNIQKSGFKLTFT-AVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENIN-----SATDRRFQISYEL----YTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQ------ALKYCGYIL 11095
            CGGY+N   G++        +    Y +++ C WQI       + + F   S+          C +D + I+DGP ++   I T CG+   +  SI +  N +Y  F +D ++   GF + +T A P     +  V+     + SP YP N P + R     I+A+  + I+IT   + I    NCS D   I+         + + C + S   V  S           GP   I+     S +DR F ++Y        C        G ++   NF +  Y+HN +C  T+   + ++    +F +F+LE SS+C YDY++   G   E+  VL   C +S+P    T  + + + FVTD +++  G+   + V       CGG      G + SPG+   Y  S  C + I   S+  I   F+   + N      +C  N  +V++  G          +YCG  L
Sbjct:  523 CGGYLNGFSGSFSYPPITGTN----YSHSVSCAWQITTSANKILMITFRRFSLEFHPE-----CNFDFLQIHDGPTASAHTIGTYCGNSLPNGGSINSTHNQLYFWFKSDASVASDGFDILWTSADPVCGGQLTDVS--YGTINSPGYPGNYPIN-RDCIWTISASPGNVISITFAYMAIEVHANCSYDYLEIRSGLTASSPLVVRHCNTTSPPPVTTS-----------GPFAYIHFHSDSSLSDRGFLLTYAATQAGAGCGGVLTGSRG-VITSPNFPE-PYNHNAMCVWTISVNSSDIII-LHFAHFDLETSSSCQYDYLEVRDGI-NERSPVLGTYCSNSVPSDVRTTGNVMFVKFVTDSNLHGSGFSAWWTVG------CGGVFTASQGTLRSPGYPNGYPPSKHCVYLISQPSSYRISLTFSAFDVENAAE---SCTDN--YVEIRDGGSETSPLLGEQYCGSAL 955          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. TrEMBL
Match: A0A3P8XE81 (Cubilin (intrinsic factor-cobalamin receptor) OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 1045.42 bits (2702), Expect = 0.000e+0
Identity = 996/3821 (26.07%), Postives = 1621/3821 (42.42%), Query Frame = 2
Query:  155 DDSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCY-PDHSPTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP-------------CIWTIISSNDQFLQII--PINLQLLGDCSEEYVQLHEKSPFEEATNL-IGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI--NFVDREIKITA-CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI-SGSN-SGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV--SVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-------KRFCGNHAKSGPTVT---HKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFV-------TAKKEINIVCSEQITKMHVFEEQSVHVIFQ-NLASTKYRFRLYYTQDCEFPITS--SSGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTH----SNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGI-CEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFT-NHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDS----NYDAKVFCGSGVIDSAIFT-PPVTLILSAE---GYRYPGFLIRWNPPVDENFKKI-----GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTVEFTGSKN--PIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNG-FLKIL------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFE-ELVISRII-CNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKE--SENAVIWSNC-NSSTWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKM---NQGCFRIRAR---GVGYRSVLLYIICASNLENFEI-DTKSSMIEVFGSGATIS-----FSYNSDQPSLCG---SNIYPNNNESGVITIENVNISL-CQYNIHNYPEDEGTLSMFMSD---NTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS---NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHDNQIQIDLEDQNGNY---LPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISP-FMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDS-ITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSP--YDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATD-----RRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQAL-----KYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            +D P ++SDNGN++F T ++K I F T   G +++   DL+ L  +I              K N   I+   +        +   L T N K+S LE +   +++ +    C +NPC NGA C+D  +SFKC+CP N+KG  C EDVNEC  I    H CQNGA C NT GSF C CS +WSG LC    + C  A+  D+C HG C   D    N   FKC+CD+GW        CI+D+DEC + + PCS +P V C NT G   C  CP G++GNG++CLD+NEC+      +  P  +C+N  G++ C             C   ++C  NNGGC   A CS+        +CTC PGY+G+G G  GC        ++    C     C N G C  + TG+ C C PG+ G  C   + N+C SNPCLNGG C     N + C C   ++G  C+ E  VCGG                 L  P+ +  +P             C W + + N++ L+I     +L+   +C+ +++Q+H+    E A+   +GKYC    S P    ++ + L        ++    GF +                C    TE      G   SP +P  Y  N +C        G    +     TL+L D   +C + D+L+I    V  ++ +   C+       +       VHFHSD  +  +   F   +  + S   CG T T +   II SP  P +      C + I+Q  ++ +I L  T  +  +          E+       +  I       L    L   N  +I FK    I    F+   E  CG +++     T + +S  +P +Y  N  C +     +   + ++FL FD+   S C FDF+++  GS  S  L  +YC      ++        + + + FK++S+ +  GF A+   ++  CG +        +  P   LN   +     Y     CTW I+      +   F  F++E H +C YDY+E ++DN T        R+CG      PT+T   H + + FVSD S++ EGF   + ++     C +SF S +G +++P       N   C Y I V    +I++N T    +GS     C          G   S  I   C T  +   + + SN   + +       +  F    ++      CG    ++ G  ASPNYPL    N  C W IR  PG +I +        S D   L +  N V  ++       T   ++  +C  Q+          ++V  + +   +   F   YT +C+  + +  + G IES+N    Y     CSW + +  G+ I      FDL    +   + +V++    N    L+   CGN            P      T  S H    S+ + A  G  + +   GC           D S   G   S  +PN    N +C W  QT  G S+ +     ++E   +CS   +L  +    +    + Q C       S +  SST N+    F + DP    R F  ++      C   +    G I SPNYP  YP+ + CSW + V     +     D + E  S C +D+V I+         +  +CG+        F+S  N + ++FR+D + S RGF A + E CG   +  ++   + SP YP VY  P+   C W + A        +   F  F+    N NCS D S+ I++G    + V    C K   HP+   SN   +  +  S+  +  F+A +   +S+CGGD  ++ G F SP YP++   +++CV+ I +SPG+ + LS   F    + S    D+++IR G N T +L+GRF   S   NYT        +W++  S   D T +   F A +   Y  +     G +ASP +   Y  + +  WT+    ++ +Q  F    +    D   C    L I+D      Y    FCG  +  S   +   VTL   ++   G R  GFLI W+    E+   +     G C  ++   +  + L SP +PN       CTW I +  +  +++ +LS D+E      Y +  V   G  N  P+ S +       CG       +     +F    + +  D      GF  SY K C     +   G L +  YP       +C + ++ +      +N  +      +   C +G +L++       A ++   LCG+++P   Q    N   + +    + ++E    GF++ +      CGG  EL +  D      + N     P  ++C W    P G  +QIDFE E  I     C   ++   DG+T+    I     CG T  ++  + G  + + F+     ++  F+ K  I +CGG    + G I SP +P NYP  S+C W + G +   + L++ +  L ++ ++ +   + ++E  +   ++  +C NS    + T  S   I F +++     GF L +     +CGGE + P   ++S NYP        C W+I V   +R+ + +  L++      C+        G G  +  L  +C +    +++  + ++M  VF + +++S      SY+S + +LCG   S+    N  S      N + +L C++ I N      ++ + + D    +   C   +   ++G+   + +  F   C +             +   FQ  + V    ++ +  Y FS CGG  T   G I SP YP  YP  + C WL+ AP    I LT    +LE+H+ C +D + I       +P   + CG    S  ++    N++ + F +D SV K GF+  ++    +  C G+I    G IKSPNYP+ +PSN+ C+WTI   EG  + + F   F +  TS   C    +++      NA  LL+  CG+  P+ PI +  N ++  F +       GF A Y + CG  +    G +VS N       S  C YLI        V+ +    F    H   +   ++   G+     P   +CG +       ++    +V    +  +    F A Y       VF+D      + +P     YHHN N T+        I S+   +  +E S   C YD+V+     +  +  +  FCG  T + P     TN + + F++D S   +  G+ A  + T GP  GCGGY++  +  +G   S D + +G YE  L C W IA P    V + F  +S  LEG S    CRYD++ I+DG +   P++ T CG D +     + SN + + F +D +I   GF  T+ A           T   Q + SP YPN  P     R+   ++ A   + + + ++   ++ S +C+ +   + D  +    +  KFC +           D +   Y  G   +I   +D         ++Y++  C+RT +   G + +        Y HN+ C + L  P  N     +F  FNLE  STC++DY++   G       +L K CG+++P      ++++ + F +D S   DG++IT+  + +    CGG++Y D G +TSP +   Y     C W I+  S   +   F  + + +    +       +++K+  G  A       YCG       F   S +  + + +    + +GFR++WS
Sbjct:   34 NDQPCMLSDNGNLVFST-NNKEIRFQTSGSGSVKVGTEDLTQLLSQI--------------KTNKGDIDDIKQNGGGTSPDVTNQLNTLNTKVSTLETKVTALEQTVQRKSCNSNPCQNGATCLDLLDSFKCLCPGNWKGSLCNEDVNECSAIVDPSHQCQNGATCVNTPGSFSCTCSPEWSGPLCTSRYDDCRGAAQ-DLCVHGMCIDTDRVTPNVPRFKCVCDAGWMAPADNPACISDVDECSLAQKPCSTNPPVDCYNTQGSFYCGSCPAGWQGNGYSCLDVNECSTNNGGCSTAPMVQCLNTMGSFHCGPCPPGYEGDGRTCTQADICANNNGGCYPLATCSSTPGSTI-PVCTCPPGYTGNGFGPTGC--------SQNSNVCQTNNPCVN-GQCVSTSTGYLCTCSPGWDGVNCDHNV-NECASNPCLNGGTCNDGV-NGFTCTCTDHWTGPTCQTEQQVCGG----------------YLSGPAGTFSYPNTPGSDQYDHQVSCAWVLRTDNNKILRITFPHFDLEQSSNCNFDFLQIHDG---ESASAFQLGKYC--GTSVPPELFSSHNALYFWFRSDHSVSAG-GFTVAWTSQTPV--------CGGDLTEFY----GNINSPGYPGNYPPNRDCYWTVNVAPG--LLITFAFGTLNLED-HPDC-NYDFLEIRDGLVAEDVVLGKYCSNVSPAPLRTTGPAAWVHFHSDFTN--SGGGFHITYTTSPSDPGCGGTFTES-EGIIISPNWPNNYAHNRQCIYIIRQP-ANEIISLNFTDMD-LETHTGCMFDYLEVHDGPSETDPLIGKYCGSTLPAPILSSSNSLWIRFKSDGSIGKTGFRARYEVGCGGTLS----GTGQIRSPYHPNSYPHNKECEWVINQPQGYVVTLNFLTFDVEGGS-CLFDFVEVRDGSTVSSPLIGKYCGTTMPSMV----ESTQRSMYVRFKTDSSISNNGFTAEYDSAIEGCGAT--------LTAPSGSLNSPGH--PNNYPHGANCTWYISVAPGHLVRLSFTSFNMEYHTSCNYDYVE-VYDNGTVATGTKLGRYCGQSVP--PTLTSTDHMMTVLFVSDASLATEGFSASYVSINATTDCSQSFTSPTGELSSPNFPNNYPNDRQCVYEILVGVNMQIMLNFTHFSLEGS--PPSCFFDYVEIRDGGYETSPLIGKFCSTS-RPPMLVSHSNRLWLKFHSDSSVTSPGFR--AHWDGTQTGCGGTMTTSSGSFASPNYPLPYHPNAECYWLIRINPGSKITL--------SFDNFNLESSSNCVYDYLAVYDGNSTNAPQLANLCGNQVPAPIDSRGNHLYVKLRTDSVISAGGFVATYTSNCQGVVIANQTRGHIESQNYPNNYPDNSLCSWTIQASMGNTINYTFINFDLESGLSTCYFDYVKLFSGPNDQAPLIGTYCGNT-----------PPPAGSTTGSSLHMVFRSDSVIAMSGFQMLWYQNGC---------GGDLSGPTGSFNSPGYPNKYPDNRECLWYIQTAAGSSITITIYEFDVEYHPDCSFD-LLEVYGGPDLSAPRLAQLCTTT---SSPLQVSSTGNWVTVRFKS-DPYISGRGFNASWVEVQGGCGGPIKAPSGEIHSPNYPANYPNMVDCSWTISVDPGHRVLFNFTDLDIELHSSCLWDHVAIYDGPGMSSPLMGQVCGQTR---PAPFTSTQNTIYVRFRSDISQSHRGFAATFSEACGATFVTDDTGGAIASPRYPAVY--PNNQNCSWIIRAMLPFN--HVTLSFTDFDLEMLNTNCSED-SVEILDGDNYMAPVIGRYCGKDVPHPVTSFSNALVVNFVSDSSVSSKGFRATFTGSTSSCGGDMIMESGAFNSPNYPDAYPPNVECVWTITSSPGNRLQLSFIMFQLPQS-SDCNDDYLEIREG-NSTGTLVGRFCGNSLPSNYT--SLIGHILWVKFHS---DLTVSGAGFRATFSHLYGNDITGTSGQIASPLYPRTYPNNADYRWTITVPGTDYIQIHFLVIDIEDLYD---CYYDQLKIFDGPNVHAYSLGTFCGLSLPASVTSSGSTVTLEFQSDSMIGGR--GFLIEWS--AIESSGPLPTIAPGACGGVLMPGDIPRFLFSPGWPNSYDPDLECTWVIRSPDS-IVELNLLSLDIEGYTPTCYFDSLVIRDGETNLSPLLSTM-------CGRDPPGPIHSTGDSMF----LRFTTDSSVSGMGFNASYSKGC-GGLLHMDRGVLFSPRYPQNYPPGLDCRWHVMVTPGFRVSVNFQSPFQVQGSGTACSSGDYLELRNGPDASAPSLGGRLCGTSLPSITQTTDNN---LHIQFVSDANNEGH--GFKLTFEAHSLACGGVIEL-QDSDPPGYITSPNYPQNYPQNVDCVWVIIVPNGESVQIDFEGEFYIETTSNCLYDYIEVRDGATSDADPIA--KLCGNTRPSTQHSTGTNMYLRFRTDASITHTGFKAKYSIATCGGTYVGQSGTIRSPGFPANYPDNSACEWYLEGPTGHYLTLSYDNFTL-QSSTQCSGDYVEIREYNASGRLLGKHCGNSIPGPMDTGDSFAYIRFSSDSGGNAPGFSLSFVASVEVCGGELNAPSGTISSPNYPNLYPHSRTCRWEITVTSGRRVTLTIDDLRLEGSESSCYADYVEVLNGFGATAPRLQRLCGTVPAGYQVRSSGNTMTVVFQTDSSVSNGGFTASYSSSEDALCGGILSDPAGGNFTSPGYLTSNYSENLSCEWLIQNPTHINSSIVVIIEDLHIESHQRCEYDFLEFRLGDSSGDLLTKF---CGQTTPSIPLVVSMSGLWVHFQTNQAVGDLGFKAK--YLFSECGGWQTGEGGAISSPSYPNTYPSPSRCAWLLEAPVGHTITLTFSYFNLENHISCGWDSVTIFNGGSPGAPIIGQYCG--STSPGSIQSGSNKLTVVFMADHSVGKEGFLATWS--TDSSGCGGVIHADSGIIKSPNYPQNFPSNIECSWTIIAHEGNHLEMNFNPDFQIPDTSGE-CQGSYIKMWAGDRENADRLLATGCGSSAPA-PIIAPHNTITARFQS-IGTQGRGFSASYITRCGANFTASTGRVVSPNYPANYPDSSNCNYLID--FGPQTVILLEFKSFHVEAHSTCLFDGVKVYKGSEPTGTPLATVCGSTIPG--PFNTLGPMLVNFYSDSIISESGFLAEYRTIPCGGVFNDTSG--TVSSPAGIDNYHHNMNCTYHIVVSPNTIISLKWNTFHLEAS-SSCYYDYVAVYDGPNTMAPVMGQFCG--TALPPNLRSTTNQMFIVFKTDTS--VSGLGWRATYSETLGPAQGCGGYLSTPMAMFG---SPDSNGDGKYEFGLDCLWTIAMPINKVVNLTF--SSFELEGSSTT-TCRYDYVNIFDGDNMNFPLVGTYCGRDVIPGPFVSASNFLTVQFVSDSSISYRGFNATYRAQEQICGGTLNATAAGQTITSPMYPNAYPPFTQCRW---VLDAPAQESVKVALQQFNLQPSQSCNANFLQLSDWPVGDYGQSHKFCPA-----------DHIPDFYSYGRTMHIVFKSDAFMAGNGMSLTYQVAGCSRTYEQAYGYLKSPG--WPDIYPHNMDCIIILQAPQ-NNTISLFFDSFNLETHSTCSFDYLEVRNGSTASAP-LLGKYCGNTLPNPIFPGTNQLYLNFKSDFSGARDGFEITWTSSPE---GCGGQLYGDHGSVTSPNYPGTYANGTHCEWGIRAPSGRVVTVTFAQISIDDPGDCQ------NNYLKLYDGKDASTPPIGPYCGAETNIAPFTASSHNVYIVFNAQYSVLPSGFRLTWS 3623          

HSP 2 Score: 477.248 bits (1227), Expect = 8.216e-131
Identity = 686/3011 (22.78%), Postives = 1201/3011 (39.89%), Query Frame = 2
Query: 1535 IVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP----CIWTIISSNDQFLQIIPINLQLL----GDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQI---NFVDREIKITA-CNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADV--EAFCTWKIKQTNSSRLI------RLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQI---SAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQFYAET-RKIAISFLDFDINDDSECKFDFIKISGSNSGHLDQ--RYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKVSVFDCGGSFFLTNKLIIGYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESH-PNCAYDYLELIHDNQTKR-----FCGN-HAKSGPTVTHKLVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLE-KLSNSFTCFYSIKVPQFKKILINI----TVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKINHIRSGSVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQNLASTKYR-FRLYYTQDC--EFPITSSSGRIESKNEMLRY-----CSWKLSS-LRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSN---TLLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSST---HNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKES--MSIHLKILDFETEESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFE-------------TCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPIISNGH--YLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEF--SRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHI-----NYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFD-QFSVGRRLDNGQCNRGNLIIYDSNYDAKVFCGSGVIDSAIFTPPVTLILSAEGYRYPGFLIRWNPPVDENFKKIG-DCEYIIKA-----TNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKA---CYKDFRNPLEGSLQNVEYPNKIFENKNCTF-ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYS--GFQIMYSK-KDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIE---CKWHFTSPP--GTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNSIFTIGNVLTILF------KNMDDFSYFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNS-STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMN--------------QGCF-RIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATISFSYNSDQPSLCGSNIYPNNNESGVITIENV-----NISLCQYNIHNYPEDEGTLSMFMSDNTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGK-VVNFIFQPGREVNMSNYRVEIGYKFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYN-FINPADTCNGIIFNTEGSIKSP--NYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVT--LLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKS---ICGGVYDL-RQGEIVSANVALINYGSIT-CEYLI--PGWEN---HLQVVYIYPNFFGCRYHDNQIQIDLEDQN-GNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISPFMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCG-DDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTA 10102
            + CGGT + + + R          SP     +P    C W I   N     ++ +N        G C  ++V++ + S    ++ LIGKYC    + P+   +T   + ++    ++I  N+GF  +    + AIE         G        +G   SP  P  Y    NC        G   R  L   + ++ +  ++C + DY+++     V    K+   C Q++        +   V F SD+   + +  F   +    +   C  + T +P   + SP  P +   +  C ++I    + +++       L+G+  + F     ++   +E +    +   F +     ML    +   N  ++ F     +++P F+      +  CG ++     S+  F S NYP  Y  N+ C +        KI +SF +F++   S C +D++ +   NS +  Q    C GN+   +    +     + +  +++S  +  GF A  +  +C G       +I      H+    Y     Y  N +C+W I   +   I Y F  F LES    C +DY++L      +      +CGN    +G T    L + F SD+ ++  GF M +Y       C       +G   +P    K  ++  C + I+      I I I         D S   +   G   L     A        +C T     ++ ++ N  T+ +    Y +   FN   ++  +   CG    +  G I SPNYP   P    C W I   PG R+L     +    +  + L +          +   +  VC +         + +++V F++  S  +R F   +++ C   F    + G I S      Y     CSW + + L  + + +    FDL  L        V I D  N    ++ + CG  + +   + SN  + +   +D S  S   RA         T  C           D   ++G   S  +P++   N++C W   + PG  ++L F + ++  S +C++  +      EI + N       R   G S+    ++   H  ++KF S    +G   +   ++ + N     +++G+ G I SP YP  YP+N    W + V  +  + IH  ++D E +   C YD ++IF   N     L   CG     +    +S  + + ++F++D  +  RGF  ++                CGG+ M  +  +FL SP +P+ Y  PD  C W + +  S + L +    +  EG    P C  D SL I +G  N S + + +C + P  PI S G   +L+    S+     F A+Y  G   CGG  ++D G+  SP YP +    LDC + +  +PG  + ++ +     + +  +    D++++RNGP+ ++  LG     + + + T     N  + I+  S   +  +  K   + H          +     G + SP +   Y Q+ +  W +   + E +Q  F+ +F +       +     L  Y    D        +      T P T   +          +R+    D +    G   +Y I         Q+  + SP +P        C W +       L +   +F L+SS +C  +   + E+  S          +    CG+      +   ++ +    I + +D     PGF LS+  +   C  +   P  G++ +  YPN    ++ C + I  +      L +  L L   +   C   ++++L      A  + + LCG+ +P   Q   + ++  +V     F ++S  S  GF   YS  +D  CGG        D    +  S   ++T ++ E   C+W   +P    + + +  E+L I S   C   FL F  G ++         FCG+T     +   ++ L+      + + D   F+ K     CGG      G I+SP+YP  YP  S C W +       I LTF   +L+ +  C   ++T+         +I   C S S   I +  + + ++F  +    ++GF   +  +   CGG        + S NYP+     + C+W I       I  +   L+MN              QG + ++ A        LL   C S+     I   +++   F S  T    +++   + CG+N       +G +   N      + S C Y I   P+    L  F S +     + ++   K+  G         T C        F+TLG  +VNF       ++ S +  E  Y+   CGG+  ++ G + SP   + Y  N +C + I+   N II L   T HLE    C YD++ +       +P   + CG     N  L    N+M + F +D SVS  G+   Y+  + PA  C G +        SP  N    Y   L C WTI +P    V+LTF   F+LE +S  TC YD + I D + +   L+   CG      P  S+ N +++ F +D + +  GF+A Y++   ICGG  +    G+ +++ +    Y   T C +++  P  E+    LQ   + P+        N   + L D   G+Y    + C          + +++ IV+ +  F   N       L  +       +++ Y  LK+P +P  Y HN +   I  AP     S+   S ++E ++  C++D++     S+ S+  +  +CGN T  +P    TN L + F+SD S   +  GF      +P    GCGG +    G +G + S +    G Y N   C+W I AP G  V V F   SI   G      C+ +++ +YDG D++ P I   CG +  +   T  S+ +Y++F+  +++  SGF+LT+++
Sbjct:  819 VGCGGTLSGTGQIR----------SPYHPNSYPHNKECEWVI---NQPQGYVVTLNFLTFDVEGGSCLFDFVEVRDGS--TVSSPLIGKYC--GTTMPSMVESTQRSMYVRFKTDSSIS-NNGFTAEY---DSAIE---------GCGATLTAPSGSLNSPGHPNNYPHGANCTWYISVAPGHLVR--LSFTSFNM-EYHTSC-NYDYVEVYDNGTVATGTKLGRYCGQSVPPTLTSTDHMMTVLFVSDAS--LATEGFSASYVSINATTDCSQSFT-SPTGELSSPNFPNNYPNDRQCVYEILVGVNMQIMLNFTHFSLEGSPPSCFFDYVEIRDGGYETSP---LIGKFCSTSRPPML----VSHSNRLWLKFHSDSSVTSPGFRAHWDGTQTGCGGTMTT---SSGSFASPNYPLPYHPNAECYWLIRINPGSKITLSFDNFNLESSSNCVYDYLAVYDGNSTNAPQLANLC-GNQ---VPAPIDSRGNHLYVKLRTDSVISAGGFVATYTS-NCQG------VVIANQTRGHIESQNY--PNNYPDNSLCSWTIQASMGNTINYTFINFDLESGLSTCYFDYVKLFSGPNDQAPLIGTYCGNTPPPAGSTTGSSLHMVFRSDSVIAMSGFQMLWY----QNGCGGDLSGPTGSFNSPGYPNKYPDNRECLWYIQTAAGSSITITIYEFDVEYHPDCSFDLLEVYGGPDLSAPRLA-------QLCTTTSSPLQVSSTGNWVTVRFKSDPYISGRGFN--ASWVEVQGGCGGPIKAPSGEIHSPNYPANYPNMVDCSWTISVDPGHRVLFNFTDLDI-ELHSSCLWDHVAIYDGPGMSSPLMGQVCGQTRPAPFTSTQNTIYVRFRSDISQSHRGFAATFSEACGATFVTDDTGGAIASPRYPAVYPNNQNCSWIIRAMLPFNHVTLSFTDFDLEMLNTNCSEDSVEILDGDNYMAPVIGRYCGKDVPHPVTSFSNA-LVVNFVSDSSVSSKGFRA----TFTGSTSSC---------GGDMIMESGAFNSPNYPDAYPPNVECVWTITSSPGNRLQLSFIMFQLPQSSDCNDDYL------EIREGNSTGTLVGRFC-GNSLPSNYTSLIGHILWVKFHSDLTVSGAGFRATFSHLYGN-----DITGTSGQIASPLYPRTYPNNADYRWTITVPGTDYIQIHFLVIDIE-DLYDCYYDQLKIFDGPNVHAYSLGTFCGLS---LPASVTSSGSTVTLEFQSDSMIGGRGFLIEWSAIESSGPLPTIAPGACGGVLMPGDIPRFLFSPGWPNSYD-PDLECTWVIRSPDSIVELNLLS--LDIEG--YTPTCYFD-SLVIRDGETNLSPLLSTMCGRDPPGPIHSTGDSMFLRFTTDSSVSGMGFNASYSKG---CGGLLHMDRGVLFSPRYPQNYPPGLDCRWHVMVTPGFRVSVNFQSPFQVQGSGTACSSGDYLELRNGPDASAPSLGGRLCGTSLPSITQTTDNN--LHIQFVSDANNEGHGFKLTFEAHSLACGGVIELQDSDPPGYITSPNYPQNYPQNVDCVWVIIVPNGESVQIDFEGEFYI-------ETTSNCLYDYIEVRDGATSDADPIAKLCGNTRPSTQHSTGTN-----MYLRFR--TDASITHTGFKAKYSIATCGGTYVGQSGTIRSPGFPANYPDNSACEWYLEGPTGHYLTLSYDNFTLQSSTQCSGDYVEIREYNASGR--------LLGKHCGNSIPGPMDTGDSFAY----IRFSSDSGGNAPGFSLSFVASVEVCGGELNAP-SGTISSPNYPNLYPHSRTCRWEITVTSGRRVTLTIDDLRLEG-SESSCYADYVEVLNGFGATAPRLQR-LCGT-VPAGYQVRSSGNTMTVV-----FQTDSSVSNGGFTASYSSSEDALCGGI-----LSDPAGGNFTSPG-YLTSNYSENLSCEWLIQNPTHINSSIVVIIEDLHIESHQRCEYDFLEFRLGDSSGDLLT---KFCGQTTPSIPLVVSMSGLWVHFQTNQAVGDLG-FKAKYLFSECGGWQTGEGGAISSPSYPNTYPSPSRCAWLLEAPVGHTITLTFSYFNLENHISCGWDSVTIFNGGSPGAPIIGQYCGSTSPGSIQSGSNKLTVVFMADHSVGKEGFLATWSTDSSGCGGVIHADSGIIKSPNYPQNFPSNIECSWTI-------IAHEGNHLEMNFNPDFQIPDTSGECQGSYIKMWAGDRENADRLLATGCGSSAPAPIIAPHNTITARFQSIGTQGRGFSASYITRCGANF---TASTGRVVSPNYPANYPDSSNCNYLIDFGPQTV-ILLEFKSFHVEAHSTCLFDGVKVYKGSEPTGTPLATVCGSTIPG-PFNTLGPMLVNFYSD--SIISESGFLAE--YRTIPCGGVFNDTSGTVSSPAGIDNYHHNMNCTYHIVVSPNTIISLKWNTFHLEASSSCYYDYVAVYDGPNTMAPVMGQFCGTALPPN--LRSTTNQMFIVFKTDTSVSGLGWRATYSETLGPAQGCGGYLSTPMAMFGSPDSNGDGKYEFGLDCLWTIAMPINKVVNLTFS-SFELEGSSTTTCRYDYVNIFDGDNMNFPLVGTYCGRDVIPGPFVSASNFLTVQFVSDSSISYRGFNATYRAQEQICGGTLNATAAGQTITSPMYPNAYPPFTQCRWVLDAPAQESVKVALQQFNLQPS-----QSCNANFLQLSDWPVGDYGQSHKFCPADHIPDFYSYGRTMHIVFKSDAFMAGN----GMSLTYQVAGCSRTYEQAYGYLKSPGWPDIYPHNMDCIIILQAPQNNTISLFFDSFNLE-THSTCSFDYLEVRNGSTASAPLLGKYCGN-TLPNPIFPGTNQLYLNFKSDFSGARD--GFEITWTSSP---EGCGGQL---YGDHGSVTSPNYP--GTYANGTHCEWGIRAPSGRVVTVTFAQISIDDPGD-----CQNNYLKLYDGKDASTPPIGPYCGAETNIAPFTASSHNVYIVFNAQYSVLPSGFRLTWSS 3624          

HSP 3 Score: 288.5 bits (737), Expect = 1.264e-73
Identity = 398/1604 (24.81%), Postives = 638/1604 (39.78%), Query Frame = 2
Query: 6635 LEGSLQNVEYPNKIFENK-----NCTFILRSHFLNYILNLTALDLPPPTNGKCVNGFLKI------LAMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMT-PHFIECKWHFTSPPGTRMQIDFEELVI-SRIICNESFLAFFDGSTTFTQKIGGQNFCGKTNS--IFTIGNVLTILFKNMDDFS--------YFRLKVKIGSCGGLLHRRQGYIASPNYPLNYPPISSCIWQISGYSYSNIRLTFMDRDLDEN--CSKSNLTVIPVKESENAVIWSNCNSS-TWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGC----FRIRARGVGYRSVLLYIICASNLENFEIDTKSSMIEVFGSGATIS---FSYNSDQP-SLCGSNI-----------YPNNNESGVITIENVNISLCQYNIHNYPEDEGTLSMFMSDNTGIPCS-NVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNMSNYRVEIGY----KFSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHL-DCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDSNAVTL--LSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQ--GEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNF------FGCRYHDNQIQIDLEDQN---GNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPY-VLKTPNFPSPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAIFCGNLTNISPFMIDT--NVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSPYDLRFMGELIAANETDHITITVKDLKIRS-SVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYT--CNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMI-FVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNIKLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALKY-----CGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWSPV*L**PVP 11218
            L G      YPN    ++     +C ++LR+   N IL +T        +  C   FL+I       A  + K  CG+++PP+L      SS   +  +          GF + ++ +   CGG  +LT +      ++NS       P   +C W     PG  +   F  L +     CN  FL   DG       +G   +C   +   + T G    + F +  DF+         +        CGG     +G I SPN+P NY     CI+ I   +   I L F D DL+ +  C    L V       + +I   C S+    I +  +++ I FK++    + GF+ +Y   +  CGG  S    ++ S  +P +      C W IN      + +      +  G     F     G    S L+   C + + +    T+ SM   F + ++IS   F+   D     CG+ +           +PNN   G         + C + I   P     LS F S N     S N  +V    NG        G  C + +   + ++   ++  +F    + +++       Y      + C    T   G + SP +P  YP++  C + I+   NM I L      LE     C +D++ IR      SP   K C  +      L  H NR+ L FHSD SV+  GF   ++       C G +  + GS  SPNYP PY  N  C W I +  G K++L+F   F+LE +S   C YD L + D N+     L+ LCGN  P+ PI+S  N + +   TD   +  GF A Y S C GV    Q  G I S N       +  C + I     +  + Y + NF        C +   ++     DQ    G Y      CG +          S+ +V+ + +  +    F+  +  +       D   P     +P +P+ Y  N    W      G   +I +   D+E   D C++D +        S+  +     T  SP  + +  N + VRF+SD   Y +  GF A      G   GCGG + A  G    I S +   N  Y N + C W I+   GH  +V+F    + +E  S    C +DH+ IYDGP  + P++  +CG  +    T+  N +Y+ F +D +    GF  TF+       +     +    + SPRYP   P +      + A    +H+T++  D  +   + NCS D   I D        I ++C       V  S  + +++ +      + +S + + F+ ++   T  C       SG   N  N+    Y  N+ C  T IT +P  R Q  F  F L +SS C  DY++   G       ++ + CG+S+P ++ +    +  + F +D +++  G+  T+      S   G +I   SG I SP +   Y  + +  W I +    YI+  F  + + +       CY   D +K+  G     Y     CG + L        S+ T+E++S +   G GF I WS +    P+P
Sbjct:  476 LSGPAGTFSYPNTPGSDQYDHQVSCAWVLRTDN-NKILRITFPHFDLEQSSNCNFDFLQIHDGESASAFQLGK-YCGTSVPPELF-----SSHNALYFWFRSDHSVSAGGFTVAWTSQTPVCGG--DLTEFYG----NINSPGYPGNYPPNRDCYWTVNVAPGLLITFAFGTLNLEDHPDCNYDFLEIRDGLVAEDVVLG--KYCSNVSPAPLRTTGPAAWVHFHS--DFTNSGGGFHITYTTSPSDPGCGGTFTESEGIIISPNWPNNYAHNRQCIYIIRQPANEIISLNFTDMDLETHTGCMFDYLEVHDGPSETDPLIGKYCGSTLPAPILSSSNSLWIRFKSDGSIGKTGFRARY---EVGCGGTLSG-TGQIRSPYHPNSYPHNKECEWVINQPQGYVVTLNFLTFDVEGGSCLFDFVEVRDGSTVSSPLIGKYCGTTMPSMVESTQRSMYVRFKTDSSISNNGFTAEYDSAIEGCGATLTAPSGSLNSPGHPNNYPHG---------ANCTWYISVAPGHLVRLS-FTSFNMEYHTSCNYDYVEVYDNGTVATGTKLGRYCGQ-SVPPTLTSTDHMMTVLFV--SDASLATEGFSASYVSINATTDCSQSFTSPTGELSSPNFPNNYPNDRQCVYEILVGVNMQIMLNFTHFSLEGSPPSCFFDYVEIRDGGYETSPLIGKFCSTS--RPPMLVSHSNRLWLKFHSDSSVTSPGFRAHWDGTQTG--CGGTMTTSSGSFASPNYPLPYHPNAECYWLIRINPGSKITLSFDN-FNLESSS--NCVYDYLAVYDGNSTNAPQLANLCGNQVPA-PIDSRGNHLYVKLRTDSVISAGGFVATYTSNCQGVVIANQTRGHIESQNYPNNYPDNSLCSWTIQASMGN-TINYTFINFDLESGLSTCYFDYVKLFSGPNDQAPLIGTY------CGNTPPPAGSTTGSSLHMVFRSDSV-IAMSGFQMLWYQN---GCGGDLSGPTGSFNSPGYPNKYPDNRECLWYIQTAAGSSITITIYEFDVEYHPD-CSFDLLEVYGGPDLSAPRLAQLCTTTSSPLQVSSTGNWVTVRFKSD--PYISGRGFNASWVEVQG---GCGGPIKAPSGE---IHSPNYPAN--YPNMVDCSWTISVDPGH--RVLFNFTDLDIELHSS---CLWDHVAIYDGPGMSSPLMGQVCGQTRPAPFTSTQNTIYVRFRSDISQSHRGFAATFSEACGATFVTD---DTGGAIASPRYPAVYPNNQNCSWIIRAMLPFNHVTLSFTDFDLEMLNTNCSEDSVEILDGDNYMAPVIGRYCGKDVPHPV-TSFSNALVVNFV-----SDSSVSSKGFRATFTGSTSSCGGDMIMESGAF-NSPNYPDA-YPPNVECVWT-ITSSPGNRLQLSFIMFQLPQSSDCNDDYLEIREGN--STGTLVGRFCGNSLPSNYTSLIGHILWVKFHSDLTVSGAGFRATF------SHLYGNDITGTSGQIASPLYPRTYPNNADYRWTITVPGTDYIQIHFLVIDIEDLYD----CY--YDQLKIFDGPNVHAYSLGTFCG-LSLPASVTSSGSTVTLEFQSDSMIGGRGFLIEWSAIESSGPLP 1983          
BLAST of Cubilin (intrinsic factor-cobalamin receptor) vs. TrEMBL
Match: A0A484C7S3 (Uncharacterized protein OS=Perca flavescens OX=8167 GN=EPR50_G00221020 PE=4 SV=1)

HSP 1 Score: 1045.03 bits (2701), Expect = 0.000e+0
Identity = 982/3818 (25.72%), Postives = 1633/3818 (42.77%), Query Frame = 2
Query:  155 DDSPRLISDNGNIIFQTASSKSISFHTQNGGQIRLNDIDLSALSDEXXXXXXXXXXXXDLKKCNCELINSKLEIYSRKIESLETSLTTSNHKISALENENHQIKEKLTYDDCANNPCHNGAQCIDGYNSFKCICPQNFKGKHCTEDVNECLQISGTIHGCQNGARCENTIGSFRCVCSGKWSGVLCNIPINSCSNASNTDICGHGTCYPDHS--PTNPKPFKCLCDSGWSLDPVTKTCIADIDECRVGKYPCSIHPFVACVNTPGDVRCEDCPIGFEGNGFTCLDINECA---NAYTCGPNEECVNGFGTYQCKCVQGMKRRANNMCQLENVCETNNGGCSTNAACSANNFRIEGRICTCNPGYSGDGVGENGCVIVSTNVTNRAYRRCVRRQLCRNGGTCQKSLTGFTCQCLPGFGGARCRTVINNQCLSNPCLNGGNCEFLFPNHYRCHCQPLFSGVNCENEHIVCGGTYAVSNEYREISLFTSLLPSPSRSLHFP-------------CIWTIISSNDQFLQI-IP-INLQLLGDCSEEYVQLHEKSPFEEATNLIGKYCQQSNSTPTRYNTTGSILIIKAALKTNIQQNHGFKIKIIPTNMAIENLDCCHCANGSTEMTQLTNGLFQSPNFPLKYQQNINCAMKFQAEYGTRFRVELQIKTLDLGDLQSNCSDSDYLQIN---FVDREIKITACNQNMYFNKKFIVNRFMVHFHSDSRSDVNSTRFQFRWKKAISQEPCGATITMNPNAIIESPAIPADVE--AFCTWKIKQTNSSRLIRLKGTFENWFDGDCSVQLSVFEITTSGRIQNHFITCQTREMLSENHLKVENEFYIFFKKLKGISTPEFQISAEYACGNSVNMDEMSTYEFQSDNYPQNYSGNSHCVYQF-YAETRKIAISFLDFDINDDSECKFDFIKI--SGSNSGHLDQRYCNGNKNELITLNSNDETKKIIITFKSNSTFAGTGFRAKV--SVFDCGGSFFLTNKLII--GYPESHLNESTYDEETQYERNKVCTWEITTFLDTDIFYVFDQFHLESHPNCAYDYLELIHDNQT-------KRFCGNHAKSGPTVTHK-LVIRFVSDNSVSGEGFIMRFYTVKRDQYCYESFESSSGLITNPTLEK-LSNSFTCFYSIKVPQFKKILINITVSESDGSCFAIPCLGQATLKXXXXXXXXXXXXNVCPTCPQREEIKTSSNTATITYMVPQYQNAGEFNYTINYSSLDEECGSIHLSTMGHIASPNYPLFAPANTYCRWEIRSTPGKRILIKIN--HIRSG---SVDETKLCNDKNPVLKFVTAKKEINIVCSEQITKMHVFEEQSVHVIFQ-NLASTKYRFRLYYTQDCEFPITSS--SGRIESKNEMLRY-----CSWKLSSLRGSKILIQIDKFDLPPLQNGQCYSFVRISDRSNT---LLKKSCGNQLLNRTFTSSNYPIRIEHYTDRSTHSNVIRAHEGIVLEYQTQGCMETFYYDPHESDYSTKNGVIQSAQFPNSIA-NIDCQWNFQTIPGFSVKLKFDIIEMESSINCSEGPILRAWENEIVDENYVFQACNRIDDGKSIIIQSSTHNFYLKFFSANDPNGGMRKFQGTYEFTNYSCEHEMSGSEGIIQSPNYPNFYPHNLRCSWNLKVKESMSIHLKILDFETE-ESLCRYDYVEIFSPINNDLVKLQHLCGKMANFIQTGFSSLNNEMLIKFRTDHTVSSRGFKAKYFETCGGLRMAMESNQFLLSPNYPHVYTLPDGICEWNLVANTSEIGLRIFFYFMGFEGGSNNPNCSSDNSLTIIEGIGNNSSVKAVLCTKSPYHPI--ISNGHYLKVILKSTSGNAIFKAAYGVGSSTCGGDFYLDDGLFTSPFYPNSVNMDLDCVYVIRNSPGSSIDLSIEEFSRENAISYILHDFIDIRNGPNETSSLLGRFYTLSEIRNYTYNYKFNDSVWIRLRSQGGDFTNHIKFLAKYHINYNTEFRSDYGVLASPQFGHVYNQDTEITWTVFAESSEKLQFTFDQFSVGRRLDNGQCNRGNLIIYDSN----YDAKVFCGSGVIDSAIFTPPVTLIL-----SAEGYRYPGFLIRWNPPVDENFKKI---GDCEYIIKATNQTQILTSPNYPNFDITRRFCTWTILTDRTEALDIQMLSFDLESSYECKYENFTV-EFTGSKNPIFSFIEYVAMVKCGSLNNSEFNVFQTYLFNSIKITYKADEFDPFPGFKLSYKKACYKDFRNPLEGSLQNVEYPNKIFENKNCTF--ILRSHFLNYILNLTALDLPPPTNGKCVNGFLKIL------AMNINKTLCGSNIPPDLQPIITNSSWIIVNLFGNFSSESRYSGFQIMYSKKDEECGGRHELTRYQDSRIVDMNSNRLHMTPHFIECKWHFTSPPGTRMQIDFEE--LVISRIICNESFLAFFDGSTTFTQKIGGQNFCGKT--NSIFTIGNVLTILFKNMDDFSY--FRLKVKIGSCGGLLHRRQGYIASPNYP-LNYPPISSCIWQISGYSYSNIRLTFMDRDLDENCSKSNLTVIPVKE--SENAVIWSNCNS---STWDIYTEYSTVRIIFKTNTVTTRKGFKLKYFFEDFMCGGEYSDPERELNSTNYPKTLSWFLRCTWKINVDVSKRIIVKVKKLKMNQGCFRIR------ARGVGYRSVLLYIICASNLENFEI-DTKSSMIEVFGSGATIS-----FSYNSDQPSLCGSNIYPNNNESGVIT-----IENVNISL-CQYNIHNYPEDEGTLSMFMSD---NTGIPCSNVYFVSKIGNGLREPVEDFGTGCNERNRMYSFSTLGKVVNFIFQPGREVNM--SNYRVEIGYK----FSRCGGLLTESFGYIKSPGYPEKYPDNTDCEWLIIAPENMIIQLTIQTLHLEHHLDCNYDHLFIRYAEEFDSPPFRKLCGLNPISNETLSFHRNRMRLSFHSDFSVSKNGFVIEYNFINPADTCNGIIFNTEGSIKSPNYPKPYPSNLRCNWTIHVPEGYKVSLTFKLPFDLERTSLHTCHYDSLRIIDS---NAVTLLSELCGNIPPSNPINSSLNQMSLVFSTDFNHNLEGFHAQYKSICGGVYDLRQGEIVSANVALINYGSITCEYLIPGWENHLQVVYIYPNFFGCRYHD----NQIQIDLEDQNGNYLPGQRICGKSREKITIMHSKSIKIVYTARNFHLKNYNFRARYLHDENVKVFSDFKRPYVLKTPNFP-SPYHHNANLTWIFNAPVGYIFSINLRSVDIERSYDGCNYDFVXXXXXXXXXXDAI--FCGNLTNISP-FMIDTNVLIVRFQSDISHYENHTGFVAFINPTPGPMLGCGGYMNATVGTYGVIKSLDLDNNGLYENNLLCKWQIAAPYGHAVKVIFENNSISLEGRSRVGGCRYDHITIYDGPDSARPVIQTLCGDDQVDSITTQSNVMYLIFSTDFNIQKSGFKLTFTAVPSQNHLIKTVTNFSQLLESPRYPNNSP--YDLRFMGELIAANETDHITITVKDLKIRSSVNCSLDQFIIQDASLKHENKIEKFCESLSTERVFISSHDKVIIQYQVGPMENINSATDRRFQISYELYTCNRTEKAYSGRIVNVENFKQKKYSHNLICNLTLITPAPNLRYQFYFKYFNLERSSTCAYDYIQFILGEPGEQQYVLPKICGSSIPPSFVTNSSRVSMIFVTDQSINYDGYDITYVVNRDPSIKCGGEIYLDSGVITSPGFGTNYYESGECSWNI-----KLVSNSYIKWRFTDMQLGNNTSLEPTCYSNTDFVKVSYGNQALKYCGYILLDEEFQIPSSSFTVEYKSLTGGVGAGFRISWS 11191
            +D PR++SDNG+++F+T  +K I F T   G++++++ DL+ L  +I              K N E IN            +   L   + K+S LEN+   ++  +    C++NPC NG  C++  N++ C+CP N+ G +C  DVNEC   +GT   CQNGA C NT GSF C CS +WSG LC +  + C NA   D+C HGTC       P  PK ++C+C+ GW       +C+AD++EC +   PCS +P V C NT G   C  CP G++GNG++C D++EC       +  P   C+N  G++ C             C   N+C +NNGGC   A CS++        CTC PGYSG+G G +GC  +S N+  +    CV  Q          S  G+ C C PG+ G  C   I N+CLSNPC NGG C     N   C C   ++G  C+    VCGG                 L  P+ S  +P             C W I    ++ L+I  P   L+   +C+ +++Q+H+      ++ +IGKYC  +N     Y++  S+           + +H             +N  C        E+T    G   SP +P  Y  + +C  +   E G    +     TL L +   +C + D+L+I      +  +    C+       +       +HFHSD    V+   F   +  + S   CG T T +   II SP  P +      C + I+     + + L  T  +  +   S      E+       +  I       L    L   N  +I FK    I+   F+      CG +++     T +F+S  +P  Y  N  C +     E   + ++FL FD+   S C +D +++    ++S  L   +C       I        + + I FK++S+ +  GF A    ++  CG +    +  I   G+P              Y     CTW I+      +   FD F+LE H NC +DYLE ++DN T        R+CG       T T   L + FVSD+S+  EGF  R+ ++     C E+F S +G  ++P       N+  C + I V    +I++N +  + +GS     C          G   S  I   C +  Q   +  S +          + +A    +T ++      CG +  +  G  +SPNYPL    N  C W IR++ G R+L+  +  H+ S    S D   + +  +      ++  E+  +C  Q+          ++V  + +++ +   F   YT +C   + S    G +ES N    Y     CSW + +  G+ +      F L    +   Y ++++ +  N    L+   CG        T+S+  + +   +D S       +  G  + +   GC             S  +G   S  +PN    N +C W   T  G S+ L     ++E   +C+   +L  +    +    + Q C+      S +  SST N     F ++    G R F  ++      C   ++   G I SP+YP+ YP+N+ CSW + V  +  +     D + E  S C +DYV I    +     L H+CG     +    +S  N + ++FR+D ++S RGF A++ E CG    A +    + SP YP  Y  P+  C W + A   E    +   F  FE    N NCS D ++ I++G    +      C     HP+   SN   +  +   +     F+A Y   +S+CGGD  ++ G F SP YP++   +++CV+ IR+SPG+ + LS   F  +   S   +D+++IR G N T  L+GRF   S   NYT        +W++  S      +   F A +   Y  +   D+G +ASP +   Y  +    WT+  E    +Q  F    +   L N  C   +L I+D      +    FCG   +   I +   TL L     S  G R  GFL+ W    D         G C  ++ A      L SP +P      + CTW I +  +  +++ +LS D+E    C +++  + +   S +P+ + +       CG    +  +    ++F    I + +D      GF  SY + C     +   G L +  YP