Ras GTPase-activating protein SynGAP

Overview
NameRas GTPase-activating protein SynGAP
Smed IDSMED30016327
Length (bp)3522
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Ras GTPase-activating protein SynGAP (SMED30016327) t-SNE clustered cells

Violin plots show distribution of expression levels for Ras GTPase-activating protein SynGAP (SMED30016327) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Ras GTPase-activating protein SynGAP (SMED30016327) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Ras GTPase-activating protein SynGAP (SMED30016327) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016327

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016327SMESG000060891.1 SMESG000060888.1 SMESG000060447.1 dd_Smed_v4_11115_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30016327 dd_Smed_v4_19720_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Match: RASAL2 (RAS protein activator like 2 [Source:HGNC Symbol;Acc:HGNC:9874])

HSP 1 Score: 189.119 bits (479), Expect = 5.802e-48
Identity = 134/429 (31.24%), Postives = 218/429 (50.82%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLL-KLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAV--IKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKD 2778
            I I +++Q I ILP+  Y +  EF+  +Y  L   L+  +S R  EE+A +L+ I +    A  F+T+ + +++D   +   +  R NTI +K++E Y+KL+G  YL   LGEF   +     + EVDPS+     L+   + +++C   +  + KI NS    P ELK VF+S +     +  Q+ +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K +Q LAN     N     KE +M  +++ L +E   M  FL EIS        +N  G   +  +ID+G EL+V H    E+  +  +DK     L PL  +L D+   LT PT      ++      N    + N  G  SS ++K+     +  +  +K+PSQ        G    L ++++     Y   D+++
Sbjct:  432 IRIKSRFQTITILPMEQYKEFAEFVTSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSELIDHQSNLKMC--CELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQNLANFAKFGN-----KEEYMAFMNDFLEHEWGGMKRFLLEISNP---DTISNTPG---FDGYIDLGRELSVLHSLLWEVVSQ--LDKATVAKLGPLPRVLADITKSLTNPTPIQQ--QLRRFTEHNS---SPNVSGSLSSGLQKIFEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDERE 839          

HSP 2 Score: 55.8398 bits (133), Expect = 5.791e-7
Identity = 27/80 (33.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINL 1128
            +RR+ +P  D  RR E  L+  I   +++  KK+Y CEL L++  +ART+S+  +     W E +E  +L P+ S+T+++
Sbjct:  301 LRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKT-KADNIFWGEHFEFFSLPPLHSITVHI 379          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:11497])

HSP 1 Score: 189.119 bits (479), Expect = 6.563e-48
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 1.543e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:11497])

HSP 1 Score: 188.734 bits (478), Expect = 7.134e-48
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 1.621e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:11497])

HSP 1 Score: 188.734 bits (478), Expect = 7.134e-48
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 1.621e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:HGNC Symbol;Acc:HGNC:11497])

HSP 1 Score: 188.734 bits (478), Expect = 7.509e-48
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 1.619e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 229.18 bits (583), Expect = 2.212e-61
Identity = 179/578 (30.97%), Postives = 276/578 (47.75%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E        +K     I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN  + G        KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  219 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE-----SDSKKKKDTLIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-------KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 698          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 228.024 bits (580), Expect = 2.561e-61
Identity = 179/576 (31.08%), Postives = 277/576 (48.09%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E       K+K+    I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN +         KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  119 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE---SDSKKKKDT--LIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-----KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 598          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 228.024 bits (580), Expect = 2.747e-61
Identity = 179/576 (31.08%), Postives = 277/576 (48.09%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E       K+K+    I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN +         KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  127 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE---SDSKKKKDT--LIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-----KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 606          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 229.565 bits (584), Expect = 2.797e-61
Identity = 180/578 (31.14%), Postives = 278/578 (48.10%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E       K+K+    I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN  + G        KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  308 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE---SDSKKKKDT--LIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-------KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 787          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Match: gap-2 (Ras GTPase-activating protein gap-2 [Source:UniProtKB/Swiss-Prot;Acc:Q8MLZ5])

HSP 1 Score: 228.794 bits (582), Expect = 4.219e-61
Identity = 179/578 (30.97%), Postives = 276/578 (47.75%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E        +K     I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN  + G        KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  259 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE-----SDSKKKKDTLIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-------KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 738          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302836)

HSP 1 Score: 159.458 bits (402), Expect = 5.589e-39
Identity = 97/307 (31.60%), Postives = 158/307 (51.47%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSH 2421
            I  ++Q  +ILP+  Y     ++ ++Y+ + + L+  +  +  E+I  +L+ +      A  F+T+ +   L    D Q +  R N++ +K+ME+++KL G  YL+  L     +++      EVDP++    S   L+  Q  L   V+  W  I  S    P +L+  F++ R  L++   Q+ AD L+S  +FLRF+CPAIL+P L+ +  E P   R  RN TL++K+LQTLAN T         KE FM  +++ L  E  RM  FL  IST P H      +    W  +ID G +L++ H
Sbjct:  436 IKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-----KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPA---PDSILDWAGYIDQGKQLSILH 732          

HSP 2 Score: 62.003 bits (149), Expect = 4.011e-9
Identity = 33/112 (29.46%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYER 1224
            +R+S  P  +  RR + SLK  +   +N+  KKRY CEL+L+   Y RTS ++ +     W E ++  ++  +  +T+N+++E V+ K  K+++  Q +  V +P+ ++  R
Sbjct:  289 LRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKL-QTDLLFWGEHFDFPDIPEINVITVNVFRE-VDKK--KKRDKYQFVGSVKIPVHDVTSR 396          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0302833)

HSP 1 Score: 159.458 bits (402), Expect = 5.743e-39
Identity = 105/341 (30.79%), Postives = 170/341 (49.85%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQG----LKPLIPILQDL 2511
            I  ++Q  +ILP+  Y     ++ ++Y+ + + L+  +  +  E+I  +L+ +      A  F+T+ +   L    D Q +  R N++ +K+ME+++KL G  YL+  L     +++      EVDP++    S   L+  Q  L   V+  W  I  S    P +L+  F++ R  L++   Q+ AD L+S  +FLRF+CPAIL+P L+ +  E P   R  RN TL++K+LQTLAN T         KE FM  +++ L  E  RM  FL  IST P H      +    W  +ID G +L++ H    E   +      LP+     L PL  IL ++
Sbjct:  862 IKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-----KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPA---PDSILDWAGYIDQGKQLSILHSLLSESLAK------LPEARQHELDPLQHILDEI 1186          

HSP 2 Score: 62.003 bits (149), Expect = 4.101e-9
Identity = 33/112 (29.46%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYER 1224
            +R+S  P  +  RR + SLK  +   +N+  KKRY CEL+L+   Y RTS ++ +     W E ++  ++  +  +T+N+++E V+ K  K+++  Q +  V +P+ ++  R
Sbjct:  715 LRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKL-QTDLLFWGEHFDFPDIPEINVITVNVFRE-VDKK--KKRDKYQFVGSVKIPVHDVTSR 822          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340632)

HSP 1 Score: 159.458 bits (402), Expect = 5.754e-39
Identity = 105/341 (30.79%), Postives = 170/341 (49.85%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQG----LKPLIPILQDL 2511
            I  ++Q  +ILP+  Y     ++ ++Y+ + + L+  +  +  E+I  +L+ +      A  F+T+ +   L    D Q +  R N++ +K+ME+++KL G  YL+  L     +++      EVDP++    S   L+  Q  L   V+  W  I  S    P +L+  F++ R  L++   Q+ AD L+S  +FLRF+CPAIL+P L+ +  E P   R  RN TL++K+LQTLAN T         KE FM  +++ L  E  RM  FL  IST P H      +    W  +ID G +L++ H    E   +      LP+     L PL  IL ++
Sbjct:  862 IKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-----KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPA---PDSILDWAGYIDQGKQLSILHSLLSESLAK------LPEARQHELDPLQHILDEI 1186          

HSP 2 Score: 62.003 bits (149), Expect = 4.068e-9
Identity = 33/112 (29.46%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYER 1224
            +R+S  P  +  RR + SLK  +   +N+  KKRY CEL+L+   Y RTS ++ +     W E ++  ++  +  +T+N+++E V+ K  K+++  Q +  V +P+ ++  R
Sbjct:  715 LRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKL-QTDLLFWGEHFDFPDIPEINVITVNVFRE-VDKK--KKRDKYQFVGSVKIPVHDVTSR 822          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340629)

HSP 1 Score: 159.073 bits (401), Expect = 6.884e-39
Identity = 97/307 (31.60%), Postives = 158/307 (51.47%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSH 2421
            I  ++Q  +ILP+  Y     ++ ++Y+ + + L+  +  +  E+I  +L+ +      A  F+T+ +   L    D Q +  R N++ +K+ME+++KL G  YL+  L     +++      EVDP++    S   L+  Q  L   V+  W  I  S    P +L+  F++ R  L++   Q+ AD L+S  +FLRF+CPAIL+P L+ +  E P   R  RN TL++K+LQTLAN T         KE FM  +++ L  E  RM  FL  IST P H      +    W  +ID G +L++ H
Sbjct:  436 IKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-----KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPA---PDSILDWAGYIDQGKQLSILH 732          

HSP 2 Score: 62.003 bits (149), Expect = 3.980e-9
Identity = 33/112 (29.46%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYER 1224
            +R+S  P  +  RR + SLK  +   +N+  KKRY CEL+L+   Y RTS ++ +     W E ++  ++  +  +T+N+++E V+ K  K+++  Q +  V +P+ ++  R
Sbjct:  289 LRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKL-QTDLLFWGEHFDFPDIPEINVITVNVFRE-VDKK--KKRDKYQFVGSVKIPVHDVTSR 396          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Match: raskol (gene:FBgn0261570 transcript:FBtr0340630)

HSP 1 Score: 159.073 bits (401), Expect = 7.661e-39
Identity = 97/307 (31.60%), Postives = 158/307 (51.47%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSH 2421
            I  ++Q  +ILP+  Y     ++ ++Y+ + + L+  +  +  E+I  +L+ +      A  F+T+ +   L    D Q +  R N++ +K+ME+++KL G  YL+  L     +++      EVDP++    S   L+  Q  L   V+  W  I  S    P +L+  F++ R  L++   Q+ AD L+S  +FLRF+CPAIL+P L+ +  E P   R  RN TL++K+LQTLAN T         KE FM  +++ L  E  RM  FL  IST P H      +    W  +ID G +L++ H
Sbjct:  418 IKCRFQSTDILPINVYGNFLTYLKENYKRVCETLEPVIGVKAKEDIGQALVLLMHAQGLAGAFLTDVVALDLLRVGD-QRLTFRGNSLATKSMEAFLKLTGEQYLQDTLSAPINELIQSERDCEVDPTKTSGSSAGSLQRQQAALRGAVRGAWQCIFESHKHFPAQLRNCFATFRERLQQLGRQDMADNLISASIFLRFLCPAILSPSLFNITSELP-SARATRNLTLVAKTLQTLANFTRFQG-----KENFMEFLNDFLEQEAARMQQFLEIISTRPEHPA---PDSILDWAGYIDQGKQLSILH 714          

HSP 2 Score: 62.003 bits (149), Expect = 3.772e-9
Identity = 33/112 (29.46%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYER 1224
            +R+S  P  +  RR + SLK  +   +N+  KKRY CEL+L+   Y RTS ++ +     W E ++  ++  +  +T+N+++E V+ K  K+++  Q +  V +P+ ++  R
Sbjct:  271 LRKSIAPNAEHTRRTDNSLKMWVYEAKNLPPKKRYFCELQLDKTLYGRTSVKL-QTDLLFWGEHFDFPDIPEINVITVNVFRE-VDKK--KKRDKYQFVGSVKIPVHDVTSR 378          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 215.312 bits (547), Expect = 1.703e-56
Identity = 168/553 (30.38%), Postives = 264/553 (47.74%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQT--GSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            +RR+  P  D  RR E  LK  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V S+T++LYKE  + K   + N      +V L                    +N+PI+   G  F     S S  + NK K       S   + RM                                        ++YQ + ILP+  Y +  E+I ++Y  +   L+  LS +  EE+A +L+ I +    A  F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN T  GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  ++D+G EL+  H    E   +  +D+     L PL  IL+D+ + LT PT 
Sbjct:  153 LRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKL-KTDNVFWGEHFEFNNLPSVKSITVHLYKETDKKKKKDKNN------YVGL--------------------VNIPIATVTGRQFVEKWYSVSTPNPNKGK-------SPGPMVRMK---------------------------------------SRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLHEHQSNLKMC--CELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYVDLGRELSSLHSLLSEAVSQ--LDQTTITKLGPLARILRDVNSALTNPTG 614          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 215.312 bits (547), Expect = 1.782e-56
Identity = 168/553 (30.38%), Postives = 264/553 (47.74%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQT--GSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            +RR+  P  D  RR E  LK  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V S+T++LYKE  + K   + N      +V L                    +N+PI+   G  F     S S  + NK K       S   + RM                                        ++YQ + ILP+  Y +  E+I ++Y  +   L+  LS +  EE+A +L+ I +    A  F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN T  GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  ++D+G EL+  H    E   +  +D+     L PL  IL+D+ + LT PT 
Sbjct:  141 LRRAVHPNKDNTRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKL-KTDNVFWGEHFEFNNLPSVKSITVHLYKETDKKKKKDKNN------YVGL--------------------VNIPIATVTGRQFVEKWYSVSTPNPNKGK-------SPGPMVRMK---------------------------------------SRYQSMSILPMELYKEFAEYITNNYMLMCSVLEPALSVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLHEHQSNLKMC--CELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTARTLTLIAKVTQNLANFTKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYVDLGRELSSLHSLLSEAVSQ--LDQTTITKLGPLARILRDVNSALTNPTG 602          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 188.348 bits (477), Expect = 4.697e-48
Identity = 121/355 (34.08%), Postives = 191/355 (53.80%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K  A    + I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI  S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L  E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D++    L PL  IL+D+   LT PTN
Sbjct:  291 KGKAAGPMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLPEHQSNLRMC--CELAFCKIIESYRVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEQEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVLSQ--MDQSAASKLGPLPRILRDVHGALTNPTN 629          

HSP 2 Score: 62.7734 bits (151), Expect = 2.410e-9
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTN 1287
            +RR+  P  D  RR E  L+  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V S+T+++Y++  + K   + N    +  V++P+  +  R  V+K          P+SQ N
Sbjct:  168 LRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKM-KTDNVFWGEHFEFNNLPAVQSITVHVYRDSDKKKKKDKNNY---VGLVSIPVVTVTSRQLVEKW--------YPVSQPN 288          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 188.348 bits (477), Expect = 5.585e-48
Identity = 121/355 (34.08%), Postives = 191/355 (53.80%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K  A    + I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI  S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L  E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D++    L PL  IL+D+   LT PTN
Sbjct:  319 KGKAAGPMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLPEHQSNLRMC--CELAFCKIIESYRVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEQEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVLSQ--MDQSAASKLGPLPRILRDVHGALTNPTN 657          

HSP 2 Score: 62.7734 bits (151), Expect = 2.530e-9
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTN 1287
            +RR+  P  D  RR E  L+  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V S+T+++Y++  + K   + N    +  V++P+  +  R  V+K          P+SQ N
Sbjct:  196 LRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKM-KTDNVFWGEHFEFNNLPAVQSITVHVYRDSDKKKKKDKNNY---VGLVSIPVVTVTSRQLVEKW--------YPVSQPN 316          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Match: dab2ipb (DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GENE-030131-2449])

HSP 1 Score: 188.348 bits (477), Expect = 5.607e-48
Identity = 121/355 (34.08%), Postives = 191/355 (53.80%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K  A    + I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI  S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L  E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D++    L PL  IL+D+   LT PTN
Sbjct:  319 KGKAAGPMVRIKARYQSMNILPMELYKEFAEYTTNNYMLLCSVLEPVISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLPEHQSNLRMC--CELAFCKIIESYRVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEQEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVLSQ--MDQSAASKLGPLPRILRDVHGALTNPTN 657          

HSP 2 Score: 62.7734 bits (151), Expect = 2.510e-9
Identity = 40/133 (30.08%), Postives = 70/133 (52.63%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTN 1287
            +RR+  P  D  RR E  L+  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V S+T+++Y++  + K   + N    +  V++P+  +  R  V+K          P+SQ N
Sbjct:  196 LRRAIHPNKDNSRRVENMLRLWIIEAKDLPAKKKYFCELCLDDSLYARTTCKM-KTDNVFWGEHFEFNNLPAVQSITVHVYRDSDKKKKKDKNNY---VGLVSIPVVTVTSRQLVEKW--------YPVSQPN 316          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:NCBI gene;Acc:100038210])

HSP 1 Score: 211.846 bits (538), Expect = 3.030e-55
Identity = 168/560 (30.00%), Postives = 256/560 (45.71%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAEL 2568
            ++R+ KP  D  RR +  LK  I    ++  KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LYK+        +K  ++K  +V +                    +N+PI+  +G  F       S  +  K K                     SS P                          I + ++YQ + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + + LR NT+ +KA+E Y+KLIG  YLK  +GEF   +       EVDP R    S L   Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN     N   S KE +M  ++E L  E   M NFL EIS         +   S  +  +ID+G EL+  H    E+   P + K+    L PL  +L D+   L  P  Q   +    L
Sbjct:  232 LQRAVKPNKDNSRRVDNVLKLWIIEARDLPPKKRYYCELCLDDILYARTTSK-PRNDTVFWGEHFEFNNLPAVRNLRLHLYKDT------DKKRRKEKSNYVGM--------------------VNVPIASISGRHFVEQWYPVSQPTSYKGK---------------------SSCP-------------------------SIRLKSRYQTMSILPMELYKEFAEYVTNNYRMLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDRFLDREHLILRENTLATKAIEEYLKLIGQRYLKEAIGEFIRALYESEEDCEVDPMRCP-PSALPDHQANLRMCCELALCKVFNSHCVFPRELKEVFASWRMRCAERGREDIADRLISASLFLRFLCPAIMSPSLFSLMQEYP-DEQTSRTLTLIAKVIQNLAN----FNYKFSSKEEYMSFMNEFLETELANMQNFLYEISN------LDSLTNSINFEGYIDLGRELSTLHALLWEVI--PQLSKDALIKLGPLPRLLNDISLALRNPHIQRQPSHQERL 704          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:NCBI gene;Acc:100038210])

HSP 1 Score: 211.846 bits (538), Expect = 3.178e-55
Identity = 168/560 (30.00%), Postives = 256/560 (45.71%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAEL 2568
            ++R+ KP  D  RR +  LK  I    ++  KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LYK+        +K  ++K  +V +                    +N+PI+  +G  F       S  +  K K                     SS P                          I + ++YQ + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + + LR NT+ +KA+E Y+KLIG  YLK  +GEF   +       EVDP R    S L   Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN     N   S KE +M  ++E L  E   M NFL EIS         +   S  +  +ID+G EL+  H    E+   P + K+    L PL  +L D+   L  P  Q   +    L
Sbjct:  227 LQRAVKPNKDNSRRVDNVLKLWIIEARDLPPKKRYYCELCLDDILYARTTSK-PRNDTVFWGEHFEFNNLPAVRNLRLHLYKDT------DKKRRKEKSNYVGM--------------------VNVPIASISGRHFVEQWYPVSQPTSYKGK---------------------SSCP-------------------------SIRLKSRYQTMSILPMELYKEFAEYVTNNYRMLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDRFLDREHLILRENTLATKAIEEYLKLIGQRYLKEAIGEFIRALYESEEDCEVDPMRCP-PSALPDHQANLRMCCELALCKVFNSHCVFPRELKEVFASWRMRCAERGREDIADRLISASLFLRFLCPAIMSPSLFSLMQEYP-DEQTSRTLTLIAKVIQNLAN----FNYKFSSKEEYMSFMNEFLETELANMQNFLYEISN------LDSLTNSINFEGYIDLGRELSTLHALLWEVI--PQLSKDALIKLGPLPRLLNDISLALRNPHIQRQPSHQERL 699          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:NCBI gene;Acc:100038210])

HSP 1 Score: 211.846 bits (538), Expect = 3.240e-55
Identity = 168/560 (30.00%), Postives = 256/560 (45.71%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAEL 2568
            ++R+ KP  D  RR +  LK  I    ++  KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LYK+        +K  ++K  +V +                    +N+PI+  +G  F       S  +  K K                     SS P                          I + ++YQ + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + + LR NT+ +KA+E Y+KLIG  YLK  +GEF   +       EVDP R    S L   Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN     N   S KE +M  ++E L  E   M NFL EIS         +   S  +  +ID+G EL+  H    E+   P + K+    L PL  +L D+   L  P  Q   +    L
Sbjct:  232 LQRAVKPNKDNSRRVDNVLKLWIIEARDLPPKKRYYCELCLDDILYARTTSK-PRNDTVFWGEHFEFNNLPAVRNLRLHLYKDT------DKKRRKEKSNYVGM--------------------VNVPIASISGRHFVEQWYPVSQPTSYKGK---------------------SSCP-------------------------SIRLKSRYQTMSILPMELYKEFAEYVTNNYRMLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDRFLDREHLILRENTLATKAIEEYLKLIGQRYLKEAIGEFIRALYESEEDCEVDPMRCP-PSALPDHQANLRMCCELALCKVFNSHCVFPRELKEVFASWRMRCAERGREDIADRLISASLFLRFLCPAIMSPSLFSLMQEYP-DEQTSRTLTLIAKVIQNLAN----FNYKFSSKEEYMSFMNEFLETELANMQNFLYEISN------LDSLTNSINFEGYIDLGRELSTLHALLWEVI--PQLSKDALIKLGPLPRLLNDISLALRNPHIQRQPSHQERL 704          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:NCBI gene;Acc:100038210])

HSP 1 Score: 211.075 bits (536), Expect = 5.385e-55
Identity = 168/560 (30.00%), Postives = 255/560 (45.54%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAEL 2568
            ++R+ KP  D  RR +  LK  I    ++  KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LY      K   +K  ++K  +V +                    +N+PI+  +G  F       S  +  K K                     SS P                          I + ++YQ + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + + LR NT+ +KA+E Y+KLIG  YLK  +GEF   +       EVDP R    S L   Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN     N   S KE +M  ++E L  E   M NFL EIS         +   S  +  +ID+G EL+  H    E+   P + K+    L PL  +L D+   L  P  Q   +    L
Sbjct:  164 LQRAVKPNKDNSRRVDNVLKLWIIEARDLPPKKRYYCELCLDDILYARTTSK-PRNDTVFWGEHFEFNNLPAVRNLRLHLY------KDTDKKRRKEKSNYVGM--------------------VNVPIASISGRHFVEQWYPVSQPTSYKGK---------------------SSCP-------------------------SIRLKSRYQTMSILPMELYKEFAEYVTNNYRMLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDRFLDREHLILRENTLATKAIEEYLKLIGQRYLKEAIGEFIRALYESEEDCEVDPMRCP-PSALPDHQANLRMCCELALCKVFNSHCVFPRELKEVFASWRMRCAERGREDIADRLISASLFLRFLCPAIMSPSLFSLMQEYP-DEQTSRTLTLIAKVIQNLAN----FNYKFSSKEEYMSFMNEFLETELANMQNFLYEISN------LDSLTNSINFEGYIDLGRELSTLHALLWEVI--PQLSKDALIKLGPLPRLLNDISLALRNPHIQRQPSHQERL 636          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Match: SYNGAP1 (synaptic Ras GTPase activating protein 1 [Source:NCBI gene;Acc:100038210])

HSP 1 Score: 211.075 bits (536), Expect = 6.626e-55
Identity = 168/560 (30.00%), Postives = 255/560 (45.54%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAEL 2568
            ++R+ KP  D  RR +  LK  I    ++  KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LY      K   +K  ++K  +V +                    +N+PI+  +G  F       S  +  K K                     SS P                          I + ++YQ + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + + LR NT+ +KA+E Y+KLIG  YLK  +GEF   +       EVDP R    S L   Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN     N   S KE +M  ++E L  E   M NFL EIS         +   S  +  +ID+G EL+  H    E+   P + K+    L PL  +L D+   L  P  Q   +    L
Sbjct:  227 LQRAVKPNKDNSRRVDNVLKLWIIEARDLPPKKRYYCELCLDDILYARTTSK-PRNDTVFWGEHFEFNNLPAVRNLRLHLY------KDTDKKRRKEKSNYVGM--------------------VNVPIASISGRHFVEQWYPVSQPTSYKGK---------------------SSCP-------------------------SIRLKSRYQTMSILPMELYKEFAEYVTNNYRMLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMTEVDRFLDREHLILRENTLATKAIEEYLKLIGQRYLKEAIGEFIRALYESEEDCEVDPMRCP-PSALPDHQANLRMCCELALCKVFNSHCVFPRELKEVFASWRMRCAERGREDIADRLISASLFLRFLCPAIMSPSLFSLMQEYP-DEQTSRTLTLIAKVIQNLAN----FNYKFSSKEEYMSFMNEFLETELANMQNFLYEISN------LDSLTNSINFEGYIDLGRELSTLHALLWEVI--PQLSKDALIKLGPLPRLLNDISLALRNPHIQRQPSHQERL 699          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Match: Rasal2 (RAS protein activator like 2 [Source:MGI Symbol;Acc:MGI:2443881])

HSP 1 Score: 192.971 bits (489), Expect = 2.160e-49
Identity = 145/466 (31.12%), Postives = 233/466 (50.00%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLL-KLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN-QNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAV--IKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDLNRVTTRHTINVDEINHLWKCLVEKSESHLANHEQA 2886
            I I +++Q I ILP+  Y +  EFI  +Y  L   L+  +S R  EE+A +L+ I +    A  F+T+ + +++D   +   +  R NTI +K++E Y+KL+G  YL   LGEF   +     + EVDPS+     L+   + +++C   +  + KI NS    P ELK VF+S +     +  Q+ +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K +Q LAN     N     KE +M  +++ L +E   M  FL EIS        +N  G   +  +ID+G EL+V H    E+  +  +DK     L PL  +L D+   LT PT  Q      AE  S      + N  G  SS ++++     +  +  +K+PSQ        G    L ++++     Y   D+K+ N +    +I+          L++  ++H A  E A
Sbjct:  413 IRIKSRFQTITILPMEQYKEFAEFITSNYTMLCSVLEPVISVRNKEELACALVHILQSTGRAKDFLTDLVMSEVDRCGEHDVLIFRENTIATKSIEEYLKLVGQQYLHDALGEFIKALYESDENCEVDPSKCSSSELMDHQSNLKMC--CELAFCKIINSYCVFPRELKEVFASWKQQCLNRGKQDISERLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQNLANFAKFGN-----KEEYMAFMNDFLEHEWGGMKRFLLEISNP---DTISNTPG---FDGYIDLGRELSVLHSLLWEVVSQ--LDKATVAKLGPLPRVLADITKSLTNPTPIQQQLRRFAEHSS------SPNVSGSLSSGLQRICEDPTDSDLHKLKSPSQDNTDSYFRGKTLLLVQQASSQSMTYSEKDEKE-NSLPNGRSIS----------LMDLQDTHAAQAEHA 845          

HSP 2 Score: 55.4546 bits (132), Expect = 4.897e-7
Identity = 27/80 (33.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINL 1128
            +RR+ +P  D  RR E  L+  I   +++  KK+Y CEL L++  +ART+S+  +     W E +E  +L P+ S+T+++
Sbjct:  282 LRRTVQPNKDNCRRAENVLRLWIIEAKDLAPKKKYFCELCLDDTLFARTTSKT-KADNIFWGEHFEFYSLPPLHSITVHI 360          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 189.889 bits (481), Expect = 1.828e-48
Identity = 123/346 (35.55%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ + ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  328 IRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSVVSKLGPLPRILRDVHTALSTP 656          

HSP 2 Score: 72.0182 bits (175), Expect = 3.792e-12
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+S++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:  197 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 309          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 189.504 bits (480), Expect = 2.374e-48
Identity = 123/346 (35.55%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ + ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  328 IRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSVVSKLGPLPRILRDVHTALSTP 656          

HSP 2 Score: 72.4034 bits (176), Expect = 3.659e-12
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+S++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:  197 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 309          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 189.504 bits (480), Expect = 2.552e-48
Identity = 123/346 (35.55%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ + ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  271 IRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSVVSKLGPLPRILRDVHTALSTP 599          

HSP 2 Score: 72.4034 bits (176), Expect = 3.418e-12
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+S++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:  140 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 252          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Match: Dab2ip (disabled 2 interacting protein [Source:MGI Symbol;Acc:MGI:1916851])

HSP 1 Score: 189.119 bits (479), Expect = 2.925e-48
Identity = 123/346 (35.55%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ + ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  204 IRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSVVSKLGPLPRILRDVHTALSTP 532          

HSP 2 Score: 72.4034 bits (176), Expect = 3.257e-12
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+S++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:   73 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 185          
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Match: sp|Q8MLZ5|GAP2_CAEEL (Ras GTPase-activating protein gap-2 OS=Caenorhabditis elegans OX=6239 GN=gap-2 PE=2 SV=2)

HSP 1 Score: 228.409 bits (581), Expect = 1.165e-59
Identity = 178/576 (30.90%), Postives = 275/576 (47.74%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED--KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNST-TEMAELLSRNCKILADNAI 2607
            +R++  P  D+QRR E S+   I   + + +K++Y+CE+ L+   YA+TSS+ A      W E +E   L  +  V ++L++E        +K     I +VT+ I++L  R+ V++  T+                        N SH           SDS   R+       S                        +S  + I A++Q + ILPL  Y  L E +  +Y  L + L+  L+ R  E++A+SL+ +    N A +F+ + I  +++   D   +  R NT+ +KAMES+MKL+  DYL S L +F   VL    S EVDP +L +   S L+  +  L   V+  W KI N++ Q+P  L+ VFS+LR  LE +  +  AD L+S  +FLRF+CPAIL+P L+ L+ EYP  P   RN TLI+K+LQ LAN +         KEP M  ++E +  E +RM +FL  IS+E   K    KN  +     +D G EL++   Y  E +                 P+LQ+      P +N  S  +E+AE     CK  +DN +
Sbjct:  378 LRKTMNPRRDQQRRTENSMLIWILEAKGLPAKRKYYCEMTLDKTLYAKTSSK-ARTDNVFWGENFEFMMLPKIDEVCVSLFRE-----SDSKKKKDTLIGYVTIGIDQLSSRSPVERWYTV------------------------NTSH-----------SDSGTSRIASALGGKS---------------------SSQESPSLRIKARWQSVHILPLRAYDNLLETLCYNYLPLCEQLEPVLNVRDKEDLATSLVRVMYKHNLAKEFLCDLIMKEVEKL-DNDHLMFRGNTLATKAMESFMKLVADDYLDSTLSDFIKTVLQCEDSCEVDPQKLGNVSNSSLEKNRALLMRYVEVAWTKILNNVHQLPKNLRDVFSALRCRLEAQNREALADTLISSSIFLRFLCPAILSPSLFNLVSEYPS-PTNARNLTLIAKTLQNLANFSKFGG-----KEPHMEFMNEFVDREWHRMKDFLLRISSE--SKSGPEKNADA----IVDAGKELSLIATYLEEAW----------------TPLLQEKNGNKHPLSNVKSVLSELAE-----CKRRSDNGV 857          
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Match: sp|Q6P730|DAB2P_RAT (Disabled homolog 2-interacting protein OS=Rattus norvegicus OX=10116 GN=Dab2ip PE=1 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 1.383e-47
Identity = 124/346 (35.84%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ I ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  135 IRIKARYQTITILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSAADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSIVSKLGPLPRILRDVHTALSTP 463          

HSP 2 Score: 70.8626 bits (172), Expect = 5.787e-11
Identity = 39/117 (33.33%), Postives = 67/117 (57.26%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:    4 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTGKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 116          
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Match: sp|Q3UHC7|DAB2P_MOUSE (Disabled homolog 2-interacting protein OS=Mus musculus OX=10090 GN=Dab2ip PE=1 SV=1)

HSP 1 Score: 189.504 bits (480), Expect = 1.660e-47
Identity = 123/346 (35.55%), Postives = 188/346 (54.34%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLAN--QTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPP 2532
            I I A+YQ + ILP+  Y +  E I +HY  L   L+  LS +  EE+AS+L+ I +       F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K  Q LAN  + GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D+++   L PL  IL+D+ T L+ P
Sbjct:  328 IRIKARYQTVSILPMEMYKEFAEHITNHYLGLCAALEPILSAKTKEEMASALVHILQSTGKVKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSADLPE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECSSRGRPDISERLISASLFLRFLCPAIMSPSLFNLLQEYPDD-RTARTLTLIAKVTQNLANFAKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETLSNTAG---FEGYIDLGRELSSLHSLLWEAVSQ--LDQSVVSKLGPLPRILRDVHTALSTP 656          

HSP 2 Score: 72.4034 bits (176), Expect = 2.559e-11
Identity = 40/117 (34.19%), Postives = 68/117 (58.12%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E+ LK  +   +++ +KK+Y CEL L++  YART+S++ +     W E +E  NL P+ +VT++LY+E  + K  +R +    +  V+LP   +  R  V+K
Sbjct:  197 LRRAVHPNKDNSRRVEHILKLWVIEAKDLPAKKKYLCELCLDDVLYARTTSKL-KTDNVFWGEHFEFHNLPPLRTVTVHLYRETDKKKKKERNSY---LGLVSLPAASVAGRQFVEK 309          
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Match: sp|Q9QUH6|SYGP1_RAT (Ras/Rap GTPase-activating protein SynGAP OS=Rattus norvegicus OX=10116 GN=Syngap1 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 3.526e-47
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLSDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 7.996e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Match: sp|F6SEU4|SYGP1_MOUSE (Ras/Rap GTPase-activating protein SynGAP OS=Mus musculus OX=10090 GN=Syngap1 PE=1 SV=2)

HSP 1 Score: 188.734 bits (478), Expect = 3.860e-47
Identity = 120/355 (33.80%), Postives = 187/355 (52.68%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAE 2565
            + + A+YQ + ILP+  Y +  E++ +HY  L   L+  L+ +  EE+AS+L+ I +    A  F+++   +++D   + + +  R NT+ +KA+E YM+LIG  YLK  +GEF   +     + EVDP +    SL +  Q  L    +    K+ NS    P ELK VF+S R    ++  ++ AD+L+S  +FLRF+CPAI++P L+ L+QEYP D +  R  TLI+K +Q LAN +   +     KE F+  ++E L  E   M  FL EIS             SS +  +ID+G EL+  H    E+   P + K     L PL  +L D+ T L  P  Q   +  +E
Sbjct:  400 VRLKARYQTMSILPMELYKEFAEYVTNHYRMLCAVLEPALNVKGKEEVASALVHILQSTGKAKDFLSDMAMSEVDRFMEREHLIFRENTLATKAIEEYMRLIGQKYLKDAIGEFIRALYESEENCEVDPIKCTASSLAE-HQANLRMCCELALCKVVNSHCVFPRELKEVFASWRLRCAERGREDIADRLISASLFLRFLCPAIMSPSLFGLMQEYP-DEQTSRTLTLIAKVIQNLANFSKFTS-----KEDFLGFMNEFLELEWGSMQQFLYEISN------LDTLTNSSSFEGYIDLGRELSTLHALLWEVL--PQLSKEALLKLGPLPRLLNDISTALRNPNIQRQPSRQSE 739          

HSP 2 Score: 60.8474 bits (146), Expect = 7.514e-8
Identity = 37/115 (32.17%), Postives = 60/115 (52.17%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSS--RVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERN 1227
            ++R+ KP  D  RR +  LK  I     +  KKRY+CEL L++  YART+S  R A      W E +E  NL  V ++ ++LY++  + +   +      +  VT+P+  L  R+
Sbjct:  246 LQRAVKPNKDNSRRVDNVLKLWIIEARELPPKKRYYCELCLDDMLYARTTSKPRSASGDTVFWGEHFEFNNLPAVRALRLHLYRDSDKKRKKDKAGY---VGLVTVPVATLAGRH 357          
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Match: A0A4S2LFD1 (Ras-GAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007602 PE=4 SV=1)

HSP 1 Score: 270.781 bits (691), Expect = 1.216e-70
Identity = 198/611 (32.41%), Postives = 307/611 (50.25%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVE-------------GKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRS-EGSDSDIPRMNGEY-CSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTN-DPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--------------------------------LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQ-FIDIGYELAVSHLYYLEIFIEP--SIDKNLPQGLKPL-----IPILQD-----LQTYLTPPTN 2538
            +RR+AKP L+ +R RE SLK  I    N++SK+RY+C++ L+   YART+S+ A      W E ++L NL  V+ VTI+LYKE                G    RK+  Q + FVT+P+ E+  RN+V+  L +Q                 P+E    +S       + + +GS S +   NG   C SS           S+           D  +I I A+YQ ++ILP+  Y  L++F+L+H   L  +L++ L  +  EE+ASSLI +HE      +F+T+ +  + D  N + +S+A RSNT+ +KA+E ++K+ G  YL  +L     KVL   ++ EV+P +L   ++                                L   Q+ L   + ++W  I +S+ Q P+ L RVF S R +LE  +  EF D L+S C+FLR ICPA+L+P L+ L+  +P +P   RN TL++KSLQ+LAN + + +D    KEP+M  ++  ++++ + M +F+R IST P     T+   + K  Q  ID  +ELA  HL  L    +P       +P G  PL     +P L D     L+  LTP T+
Sbjct:  113 LRRTAKPNLENERHRENSLKLSILEARNLSSKRRYYCDICLDRTLYARTTSKTATNG-IFWAEDFDLNNLPNVSVVTISLYKEADSSNKESRRFGTTRLGSKKYRKSQNQLVGFVTIPMSEISGRNDVQAWLNLQP----------------PTEPGPRDSATVLMPVFSAHQGSLSGLAASNGLVRCGSSSVLSPTYNPQASATQLDHLVTDQRDLPQIRIRARYQSVDILPIRNYWALKKFVLEHSIELTTWLEHVLPVKAKEEVASSLIGLHECNGTLVEFLTDLV--RRDVANLENESMAFRSNTMATKAVECFLKMAGSTYLHDLLYRLVQKVLACLTAWEVNPEKLSSSAIASGSLTVGDTATFAKTGSIGFSPPGGRPLPGSLLGNQILLLHHLNAVWRAIQSSLPQFPSSLMRVFCSFRATLEPTHGPEFCDNLISACIFLRLICPALLSPSLFGLVSAFPSEPSCQRNLTLLAKSLQSLANFS-AFDD----KEPYMRFLNGFVSSQMSAMRSFIRNISTWPTLTGRTDDPDTVKGFQDVIDEAFELANLHL-LLSGLPKPCNGEASKIPGGTLPLGELTQLPQLLDNLSEKLREALTPSTH 698          
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Match: A0A068WSU4 (Synaptic ras gtpase activating protein syngap OS=Echinococcus granulosus OX=6210 GN=EgrG_001098100 PE=4 SV=1)

HSP 1 Score: 268.47 bits (685), Expect = 1.395e-69
Identity = 198/655 (30.23%), Postives = 324/655 (49.47%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGG--KRKNIR---QKIAFVTLPIEELYERNEVKKKLTMQKNINLP---------------ISQTNGTSF-------CLPSES------------------------RSNESHNKHKRYYR-SEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELV--NNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRL-------------------EDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREIST--------EPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIG 2610
            ++R  +P L+++R R+ SL+  I   +N+ S +RY C++ L+ + YART+S+++ K    W E ++L NL+ +  +TINLY+E    K    +RK+ +   Q IAF+T+ I +L  + E ++  TM     LP               I Q+ G SF       C P  S                        R    HN      R + G +SD+   +G  CS+ LP                         +I ++ KYQ I++LPL CY  LR+ +++     V+YL+  L  +R EEIA  L++IHE    +N   F+ + + ++LD T+D  S+  RSN+IGSKA+E Y+KL+G++YL+ +L  F   +L     LEVD +RL                    D  +L+  ++ L + V+++  ++  S++  P +L+   +S+R ++E+++ QE  DQL+SGC+FLR+ICPAI  P L+ L    P DPR+ RN TL++K LQT+AN +         KE +M  ++  + + +  M  FLR +ST        E + +  TN    S  H  ID+GYEL V + +   I  E      +P  L  L  IL  ++  L+ P+ + S + +A  +        ++A+ 
Sbjct:  579 LKRVVRPDLEQERHRDTSLRITIHESKNLPSHRRYFCDICLDRKLYARTTSKLS-KETVFWGECFDLNNLAELNFITINLYREAESTKDASKRRKSSKAQNQLIAFLTIAISDLSSKYETQQWHTMTPGSMLPSSENLHTNPISPRSSIRQSIG-SFNNPDSPQCNPDTSTGCSAKRSISLVGPPPTTILTGRIRRLSKHNLGGSESRMNAGQNSDVSNGSGA-CSALLP-------------------------QIRLAVKYQSIDVLPLHCYDNLRKLVVEKSAEFVRYLEPLLPTKRKEEIARCLVNIHEKTPESNIAAFLASLVDHELD-TSDNLSLLFRSNSIGSKAVECYIKLVGVEYLRKLLQGFIENLLTSSEDLEVDATRLTTHSWSPASESGDVSAVTDADARILQRNRIALTTCVKTVLQRLQASLAYFPADLRETLASIRRTVEQRHGQEVGDQLVSGCLFLRYICPAIHGPTLFGLTNAVPDDPRVSRNLTLLAKVLQTIANFSHF-----EAKENYMRFLNSFVQSMQEEMHQFLRAVSTLDDDDDSSEIWKRQNTN---VSNCHSNIDLGYELTVLYGHLSAILKE---HPKVPDCLAELPDILAGIEHMLSKPSLRRSLSNLANSIRSGTSASLEDAVA 1193          
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Match: A0A4S2LF42 (Ras-GAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007602 PE=4 SV=1)

HSP 1 Score: 265.388 bits (677), Expect = 1.210e-68
Identity = 196/608 (32.24%), Postives = 304/608 (50.00%), Query Frame = 1
Query:  898 SAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVE-------------GKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRS-EGSDSDIPRMNGEY-CSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTN-DPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--------------------------------LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQ-FIDIGYELAVSHLYYLEIFIEP--SIDKNLPQGLKPL-----IPILQD-----LQTYLTPPTN 2538
            +AKP L+ +R RE SLK  I    N++SK+RY+C++ L+   YART+S+ A      W E ++L NL  V+ VTI+LYKE                G    RK+  Q + FVT+P+ E+  RN+V+  L +Q                 P+E    +S       + + +GS S +   NG   C SS           S+           D  +I I A+YQ ++ILP+  Y  L++F+L+H   L  +L++ L  +  EE+ASSLI +HE      +F+T+ +  + D  N + +S+A RSNT+ +KA+E ++K+ G  YL  +L     KVL   ++ EV+P +L   ++                                L   Q+ L   + ++W  I +S+ Q P+ L RVF S R +LE  +  EF D L+S C+FLR ICPA+L+P L+ L+  +P +P   RN TL++KSLQ+LAN + + +D    KEP+M  ++  ++++ + M +F+R IST P     T+   + K  Q  ID  +ELA  HL  L    +P       +P G  PL     +P L D     L+  LTP T+
Sbjct:  410 TAKPNLENERHRENSLKLSILEARNLSSKRRYYCDICLDRTLYARTTSKTATNG-IFWAEDFDLNNLPNVSVVTISLYKEADSSNKESRRFGTTRLGSKKYRKSQNQLVGFVTIPMSEISGRNDVQAWLNLQP----------------PTEPGPRDSATVLMPVFSAHQGSLSGLAASNGLVRCGSSSVLSPTYNPQASATQLDHLVTDQRDLPQIRIRARYQSVDILPIRNYWALKKFVLEHSIELTTWLEHVLPVKAKEEVASSLIGLHECNGTLVEFLTDLV--RRDVANLENESMAFRSNTMATKAVECFLKMAGSTYLHDLLYRLVQKVLACLTAWEVNPEKLSSSAIASGSLTVGDTATFAKTGSIGFSPPGGRPLPGSLLGNQILLLHHLNAVWRAIQSSLPQFPSSLMRVFCSFRATLEPTHGPEFCDNLISACIFLRLICPALLSPSLFGLVSAFPSEPSCQRNLTLLAKSLQSLANFS-AFDD----KEPYMRFLNGFVSSQMSAMRSFIRNISTWPTLTGRTDDPDTVKGFQDVIDEAFELANLHL-LLSGLPKPCNGEASKIPGGTLPLGELTQLPQLLDNLSEKLREALTPSTH 992          
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Match: A0A4S2LFR0 (Ras-GAP domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007602 PE=4 SV=1)

HSP 1 Score: 264.618 bits (675), Expect = 2.176e-68
Identity = 196/608 (32.24%), Postives = 305/608 (50.16%), Query Frame = 1
Query:  898 SAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVE-------------GKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRS-EGSDSDIPRMNGEY-CSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTN-DPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL--------------------------------LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQ-FIDIGYELAVSHLYYLEIFIEPSIDK--NLPQGLKPL-----IPILQD-----LQTYLTPPTN 2538
            +AKP L+ +R RE SLK  I    N++SK+RY+C++ L+   YART+S+ A      W E ++L NL  V+ VTI+LYKE                G    RK+  Q + FVT+P+ E+  RN+V+  L +Q                 P+E    +S       + + +GS S +   NG   C SS           S+           D  +I I A+YQ ++ILP+  Y  L++F+L+H   L  +L++ L  +  EE+ASSLI +HE      +F+T+ +  + D  N + +S+A RSNT+ +KA+E ++K+ G  YL  +L     KVL   ++ EV+P +L   ++                                L   Q+ L   + ++W  I +S+ Q P+ L RVF S R +LE  +  EF D L+S C+FLR ICPA+L+P L+ L+  +P +P   RN TL++KSLQ+LAN + + +D    KEP+M  ++  ++++ + M +F+R IST P     T+   + K  Q  ID  +ELA  HL  L    +P   +   +P G  PL     +P L D     L+  LTP T+
Sbjct:  514 TAKPNLENERHRENSLKLSILEARNLSSKRRYYCDICLDRTLYARTTSKTATNG-IFWAEDFDLNNLPNVSVVTISLYKEADSSNKESRRFGTTRLGSKKYRKSQNQLVGFVTIPMSEISGRNDVQAWLNLQP----------------PTEPGPRDSATVLMPVFSAHQGSLSGLAASNGLVRCGSSSVLSPTYNPQASATQLDHLVTDQRDLPQIRIRARYQSVDILPIRNYWALKKFVLEHSIELTTWLEHVLPVKAKEEVASSLIGLHECNGTLVEFLTDLV--RRDVANLENESMAFRSNTMATKAVECFLKMAGSTYLHDLLYRLVQKVLACLTAWEVNPEKLSSSAIASGSLTVGDTATFAKTGSIGFSPPGGRPLPGSLLGNQILLLHHLNAVWRAIQSSLPQFPSSLMRVFCSFRATLEPTHGPEFCDNLISACIFLRLICPALLSPSLFGLVSAFPSEPSCQRNLTLLAKSLQSLANFS-AFDD----KEPYMRFLNGFVSSQMSAMRSFIRNISTWPTLTGRTDDPDTVKGFQDVIDEAFELANLHL-LLSGLPKPCNGEASKIPGGTLPLGELTQLPQLLDNLSEKLREALTPSTH 1096          
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Match: A0A5K3EYC6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 260.381 bits (664), Expect = 1.093e-67
Identity = 192/630 (30.48%), Postives = 311/630 (49.37%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGK--GGKRKNIR---QKIAFVTLPIEELYERNEVKKKLTMQKNINLP----------------------ISQTNGTSFCLPSESRSNES--HNKHKRYYRSEGS---------------DSDIPRMNGE-YCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELV--NNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL----------------------LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNG--SSKW----------HQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQ-TYLTPP 2532
            ++R A+P L+ +R R+ SL+  I   +N+ S +RY C++ L+ + YART+S+++ K    W E ++L NL+ +  +TINLY+E    K    +RK+ +   Q +AF+TL + +L  ++E ++   M     LP                       S T+  S     +S +N +      KR     GS                SD  +MNG  + S+S    DC                     +I ++ +YQ I++LPL  Y  LR+ ++D     VQ+L+  L  +R EEIA  L++IHE    +N   F+ + +  +LDS  D  S+  RSN+IGSKA+ESY+KL+G +YL+ +   F   ++  P  LEVDPSRL  ++                       L+  Q  L ++V+++W ++  S+   P +L+   +S+R ++E ++ +E  DQL+SGC+FLR++CPAI  P L+ L    P DPR+ RN TL++K LQT+AN +         KE +M  ++  + + +  M +FLR +ST      Y +  G  S  W          H  ID+GYEL + + + + I  E      +P+ L  L  IL  +   + TPP
Sbjct:   85 LKRVARPDLENERHRDTSLRITIHESKNLPSHQRYFCDICLDRKLYARTTSKLS-KETVFWGEFFDLNNLAELNFITINLYREADSTKEPSKRRKSNKGQNQLVAFLTLAVADLTAKHETQRWHAMTPASMLPSNESLSTAPLAQIPSSRQSAGFFSLTDAVSTLSSPDSSANMAVTSTAAKRSISVAGSTPFARMRKLSRQTLGGSDT-KMNGSSFGSASAGNMDCLP-------------------QIRLAVQYQSIDVLPLGYYDDLRKLVVDKSLPFVQHLEPLLQTKRKEEIARCLVNIHEKAPESNIATFLASLVDRELDSY-DNLSLLFRSNSIGSKAVESYIKLVGTEYLQRLFRGFIESLIASPEDLEVDPSRLAHQTTTTTSLSTSDGSSSSASGDVDSTLQRNQTALTNLVKAVWQRLQASLEYFPADLRETLASIRRTVELRHGKEVGDQLVSGCLFLRYLCPAIHGPTLFGLTNAIPDDPRVSRNLTLLAKVLQTIANFSHF-----EAKENYMRFLNGFVQSMQEEMHHFLRAVST------YDDGPGAESDIWKKRKANTYNCHGNIDLGYELTILYRHLVSILEE---HPKVPEVLSELPEILTSISLMFSTPP 678          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Match: dab2ipa (DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GENE-081104-516])

HSP 1 Score: 189.889 bits (481), Expect = 1.388e-48
Identity = 123/356 (34.55%), Postives = 191/356 (53.65%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQT--GSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K  A    + +  +YQ + ILP+  Y +  E+I ++Y  L   L+  LS +  EE+AS+L+ I +    A  F+T+ + +++D   D + +  R NT+ +KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     LL+  Q  L    +  + KI NS    P ELK VF+S R     +   + +++L+S  +FLRF+CP+I++P L+ L+QEYP D R  R  TLI+K  Q LAN T  GS       KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E   +  +D++    L PL+ IL+D+   LT P  
Sbjct:  271 KGKAPGPMLRMKCRYQSMSILPMELYKEFAEYITNNYMLLCSVLEPALSVKSKEEMASALVHILQSTGKAKDFLTDLMMSEVDRCGDNEHLIFRENTLATKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSSSDLLE-HQGNLKMCCELAFCKIINSYCVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPSIMSPSLFDLMQEYPDD-RTARTLTLIAKVTQNLANFTKFGS-------KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLSEAITQ--LDQSTAAKLGPLVRILRDVNVALTNPAG 609          

HSP 2 Score: 65.4698 bits (158), Expect = 3.100e-10
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTM 1251
            +RR+  P  D  RR E  LK  I   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL    S+T++LYKE  + K   + N    +  V +PI  +  R  V+K  T+
Sbjct:  148 LRRAVHPNKDNSRRVENMLKCWIIEAKDLPAKKKYFCELCLDDTLYARTTCKL-KTDNVFWGEHFEFNNLPSAKSITVHLYKETDKKKKKDKNNY---VGLVNVPIMAVSGRQFVEKWYTV 264          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 186.422 bits (472), Expect = 1.438e-47
Identity = 122/354 (34.46%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1480 KDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K A  M I I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI +S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D+     L PL  IL+D+ T LT P++
Sbjct:  291 KTAGPM-IRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSPNDLPEHQSNLKMC--CELAFCKIISSYCVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVVSQ--MDQTAASKLGPLPRILRDVHTALTNPSS 627          

HSP 2 Score: 65.855 bits (159), Expect = 2.946e-10
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E  L+  +   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V ++T++LY++  + K   + N    +  V++P+E +  R  V+K
Sbjct:  166 LRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKL-KADNIFWGEHFEFSNLPAVQNITVHLYRDSEKKKKKDKNNY---VGLVSIPVETVTSRQLVEK 278          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 186.808 bits (473), Expect = 1.503e-47
Identity = 122/354 (34.46%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1480 KDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K A  M I I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI +S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D+     L PL  IL+D+ T LT P++
Sbjct:  291 KTAGPM-IRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSPNDLPEHQSNLKMC--CELAFCKIISSYCVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVVSQ--MDQTAASKLGPLPRILRDVHTALTNPSS 627          

HSP 2 Score: 65.855 bits (159), Expect = 2.739e-10
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E  L+  +   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V ++T++LY++  + K   + N    +  V++P+E +  R  V+K
Sbjct:  166 LRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKL-KADNIFWGEHFEFSNLPAVQNITVHLYRDSEKKKKKDKNNY---VGLVSIPVETVTSRQLVEK 278          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Match: dab2ipb (DAB2 interacting protein [Source:NCBI gene;Acc:103023248])

HSP 1 Score: 186.422 bits (472), Expect = 1.630e-47
Identity = 122/354 (34.46%), Postives = 194/354 (54.80%), Query Frame = 1
Query: 1480 KDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTN 2538
            K A  M I I A+YQ + ILP+  Y +  E+  ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   + + +  R NT+G+KA+E Y+KL+G  YL+  LGEF   +     + EVDPS+     L +  + +++C   +  + KI +S    P ELK VF+S R     +   + +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K  Q LAN T   N     KE +M  +++ L +E   M  FL EIS     +  +N  G   +  +ID+G EL+  H    E+  +  +D+     L PL  IL+D+ T LT P++
Sbjct:  319 KTAGPM-IRIKARYQSMNILPMEMYKEFAEYTTNNYMLLCSVLEPAISVKNKEEMACALVHILQSTGKAKDFLTDLMMSEVDRCGENEHLIFRENTLGTKAIEEYLKLVGQKYLQDALGEFIKALYESDENCEVDPSKCSPNDLPEHQSNLKMC--CELAFCKIISSYCVFPRELKEVFASWRQECGNRGRPDISERLISASLFLRFLCPAIMSPSLFNLTQEYPDD-RTARTLTLIAKVTQNLANFTKFGN-----KEEYMSFMNQFLEHEWTNMQRFLLEISNP---ETISNTAG---FEGYIDLGRELSTLHSLLAEVVSQ--MDQTAASKLGPLPRILRDVHTALTNPSS 655          

HSP 2 Score: 65.4698 bits (158), Expect = 3.410e-10
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+  P  D  RR E  L+  +   +++ +KK+Y CEL L++  YART+ ++ +     W E +E  NL  V ++T++LY++  + K   + N    +  V++P+E +  R  V+K
Sbjct:  194 LRRAVHPNKDNSRRVENMLRLWVIEAKDLPAKKKYFCELCLDDSLYARTTCKL-KADNIFWGEHFEFSNLPAVQNITVHLYRDSEKKKKKDKNNY---VGLVSIPVETVTSRQLVEK 306          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Match: rasal2 (ras GTPase-activating protein nGAP [Source:NCBI gene;Acc:103044896])

HSP 1 Score: 186.037 bits (471), Expect = 2.297e-47
Identity = 119/364 (32.69%), Postives = 192/364 (52.75%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSL-LKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEI----------FIEPSIDKNLPQGLKPLIPILQDLQTYLTPPT 2535
            K    S  I +  ++Q + ILP+  Y +  EF+  +Y  L   L+  +S R  EE+AS+L+ I +    A  F+T+ + +++D   D   +  R NT+ +KA+E Y+KL+G  YL   LGEF   +     + EVDPS+     L  + + +++C   +  + KI NS    P ELK VF++ +   + +  Q+ + +L+S  +FLRF+CPAI++P L+ L+QEYP D R  R  TLI+K +Q+LAN T   N     KE +M  +++ L +E   M  FL EIS           + +  +  +ID+G EL++ H    E+          F++ ++ K     L PL  IL D+   L+ PT
Sbjct:  280 KAKGGSPSIRLKTRFQTMSILPMEQYKEFAEFVTSNYTMLCSILEPVISVRNKEEMASALVHILQSTGKAKDFLTDLVMSEIDRCADHDVLIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDENCEVDPSKCSSSELPEQQSNLKMC--CELAFCKIINSYCVFPRELKEVFAAWKQQCQSRGKQDISQRLISASLFLRFLCPAIMSPSLFNLMQEYPDD-RTSRTLTLIAKVIQSLANFTKFGN-----KEEYMAFMNDFLEHEWAGMTRFLLEISN------LETISSTPGFEGYIDLGRELSLLHALLWEVVSQLDKGDNSFLQATVAK-----LGPLPRILGDITRSLSSPT 624          

HSP 2 Score: 61.6178 bits (148), Expect = 4.765e-9
Identity = 36/118 (30.51%), Postives = 67/118 (56.78%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAV-WNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+ +P  D  RR E  L+  I   +++  KK+Y CEL L++  YART+S+  ++S+ + W E +E   L  V S+T+++Y++  + K   + N    +  V +P+  +  R  ++K
Sbjct:  157 LRRTVQPNKDNCRRAENVLRLWIIEAKDLPPKKKYFCELCLDDVLYARTTSK--QRSDCLFWGEQFEFAGLPTVNSITVHIYRDADKKKKKDKNNY---VGLVNIPVHSVSGRQFMEK 269          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000945.1 (pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1 gene:ENSPMAG00000000852.1 transcript:ENSPMAT00000000945.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 144.05 bits (362), Expect = 5.069e-35
Identity = 108/341 (31.67%), Postives = 173/341 (50.73%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSIL-GEFSMKVLFYPSSLEVDPSRLEDKSLL-KLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYL 2523
            I  ++Q + ILP+  Y +  EF+      L   L+  L  +  EE+A +L+          +F+   +  ++   ++ + +  R NT+ +KA+E Y+K++G  YL   L GEF   +     + EV+ S+     L      +++C   +  + KI +S    P EL+ VFSS R   E +   E +++L+S  +FLRF+CPAI++P L+ L QEYP D R  R  TLI+K +Q LAN T   N     KE +M  ++  L  E  RM  FL EIS+        +   ++ +  FID+G EL+  H    EI + P  D+     L+PL  IL+++   L
Sbjct:  163 IKWRHQQLSILPMERYKEFAEFLSASCLPLCLLLEPVLGVKSKEELARALVRFLHTTGRVKEFLAELVIAEVTRCSENEHLLFRENTLATKAIEEYLKMVGQWYLHDALEGEFVRALYDSDENCEVELSKCSSAELADHRNNLRMC--CELAFCKILSSCCVFPAELRDVFSSWRRLCEARGRAEISERLISASLFLRFLCPAIMSPSLFGLSQEYP-DERTARTLTLIAKVVQNLANFTKFGN-----KEDYMTFMNGFLEQEWGRMKQFLGEISS------EESSPSAATFEGFIDLGRELSTLHSLLSEILL-PEKDREARAQLEPLPRILREINEAL 488          

HSP 2 Score: 53.5286 bits (127), Expect = 3.097e-7
Identity = 29/81 (35.80%), Postives = 46/81 (56.79%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLY 1131
            +RR  +P  D  +R E  LK  I   + + +KK+Y CE+ L++  YART+S+ A+     W E +E  NL  V  + ++LY
Sbjct:   29 LRRIVQPNKDNIQRVENDLKVWIIEAKELPAKKKYFCEICLDDTLYARTASK-AKVDNLFWGEHFEFSNLPAVKHIMVHLY 108          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Yeast
Match: BUD2 (GTPase activating factor for Rsr1p/Bud1p; plays a role in spindle position checkpoint distinct from its role in bud site selection; required for both axial and bipolar budding patterns; mutants exhibit random budding in all cell types; contains two PH-like domains [Source:SGD;Acc:S000001575])

HSP 1 Score: 88.5817 bits (218), Expect = 4.114e-18
Identity = 82/306 (26.80%), Postives = 146/306 (47.71%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYL----------DNKLSGRRL--EEIASSLISI----HELVNNAPQFITNSIC----NKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQV------QLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLL---SGCVFLRFICPAILNPYLYQLI-QEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREIS 2328
            ICI        ILP   + +L + +++    +V  L          DNKL+   +   +I  SL  I    H L++     I  ++       LDS +   S+  R N+I +K++E Y   +G +YL   L     +++    S E+DP+R+++K  +K  ++      +L S V  +W ++  + + +P E++ V    R  LE     +    +L   SG +FLRF CP ILNP L++ + Q   +  R  RN TLISK L  L+  T   N     KEP+++ ++  +    N +++++ +++
Sbjct:  457 ICIKISSNLNFILPSTNFVKLEKLLMNANLSMVSNLIYKSSSSMENDNKLTQTSIIFLDIFQSLSRIEEWFHVLIDKELAKIDGTVSRINQKNLDSKHVFNSL-FRGNSILTKSIEQYFFRVGNEYLSKALSAILKEIIESNKSCELDPARVKEKDEVKKRKIIADNYKRLYSWVTKIWKRLYATSNDLPIEIRNVLKIFRQKLEIICIDDTLQIILNGISGLLFLRFFCPVILNPKLFKYVSQNLNETAR--RNLTLISKVLLNLSTLTQFAN-----KEPWLMKMNNFIDKRHNDLLDYIDKMT 754          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Yeast
Match: IRA1 (GTPase-activating protein; negatively regulates RAS by converting it from GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions, mediates membrane association of adenylate cyclase; mutations cause catalase T deficiency, defective glycogen synthesis and defective trehalose accumulation; IRA1 has a paralog, IRA2, that arose from the whole genome duplication; defects in human homolog NF1 are associated with neurofibromatosis [Source:SGD;Acc:S000000344])

HSP 1 Score: 49.2914 bits (116), Expect = 4.665e-6
Identity = 49/198 (24.75%), Postives = 89/198 (44.95%), Query Frame = 1
Query: 1753 LRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVD---PSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEP 2337
            LR N+  ++A+  Y +  G  YL   L      ++    S E+D   P     + +L L +  +  ++ +    I +SI   P EL  +  ++ Y+       E+A   +   VFLRFI PA+++P    +I       R  + F  ++K +Q+LAN   ++      K+  ++   E L    +++ NFL E+   P
Sbjct: 1749 LRRNSCATRALSLYTRSRGNKYLIKTLRPVLQGIVDNKESFEIDKMKPGSENSEKMLDLFEKYMTRLIDA----ITSSIDDFPIELVDICKTI-YNAASVNFPEYAYIAVGSFVFLRFIGPALVSPDSENIIIVTHAHDR--KPFITLAKVIQSLANGRENI-----FKKDILVSKEEFLKTCSDKIFNFLSELCKIP 1934          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Yeast
Match: IRA2 (GTPase-activating protein; negatively regulates RAS by converting it from the GTP- to the GDP-bound inactive form, required for reducing cAMP levels under nutrient limiting conditions; IRA2 has a paralog, IRA1, that arose from the whole genome duplication; defects in human homolog NF1 are associated with neurofibromatosis [Source:SGD;Acc:S000005441])

HSP 1 Score: 48.9062 bits (115), Expect = 6.210e-6
Identity = 49/209 (23.44%), Postives = 97/209 (46.41%), Query Frame = 1
Query: 1633 LEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQL-CSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGC---VFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSI 2247
            ++  A+ LI+  E  N     +   I N+++ ++ P  I LR N+  ++++    +  G +YL   L     K++      E++  + ED    +  Q++L    +  L   I+NS+S  P  L  +  ++     K   ++F D  +      VFLRF CPA+++P    +I       +  R F  ++K +Q +AN + + +  P++
Sbjct: 1702 IDAYAAGLINAFETRNATHIVVAQLIKNEIEKSSRPTDI-LRRNSCATRSLSMLARSKGNEYLIRTLQPLLKKIIQNRDFFEIEKLKPEDSDAER--QIELFVKYMNELLESISNSVSYFPPPLFYICQNIY----KVACEKFPDHAIIAAGSFVFLRFFCPALVSPDSENIIDISHLSEK--RTFISLAKVIQNIANGSENFSRWPAL 1901          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Nematostella
Match: EDO35799 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKG2])

HSP 1 Score: 154.836 bits (390), Expect = 3.552e-38
Identity = 100/318 (31.45%), Postives = 175/318 (55.03%), Query Frame = 1
Query: 1477 KKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSI---CNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYN--QEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAV 2415
            K +ADS  I +  KYQ I ILPL  Y+++  ++ ++Y  L   L++ +S +  +EIA  ++ + + V  A +F+ + +    N+L S +  +++  R N+  +KAM++YMK++G       LG+F   V       EVDP++  + S ++  Q  L +  +  WN I  S    P +L+  F   R   ++  N  ++ +++L+S  +FLRF+CPAI++P L+ L+QEYP + RI+R  TLI+K +Q LAN T         KE +M  +++ + NE ++M  F+  IS+    +        +++   ID G ELA+
Sbjct:  172 KGNADSGSIRLKIKYQKIHILPLTTYNEMLSYLSNNYMHLCGTLESAVSSKVKDEIAGVILRVLQPVGKAQEFLVDIVMDEVNRLGSAD--ENLVFRGNSFATKAMDTYMKMVGE---SETLGDFVQSVYAMSEDCEVDPAKSVNGS-IQSNQENLKAFAEKAWNHILCSSCIFPCDLQDTFHEFR---QRSINGSRDLSNKLISASIFLRFLCPAIMSPSLFHLVQEYPNE-RILRTLTLIAKVIQNLANFTKFGG-----KEDYMGFMNDFVQNEFDKMREFVATISSPSVGR-------ENRFEGSIDHGRELAL 467          

HSP 2 Score: 67.0106 bits (162), Expect = 4.002e-11
Identity = 41/119 (34.45%), Postives = 68/119 (57.14%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENV--TSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            I++S +PA D+Q R + SL   +   +    T KKRY CEL L+   YART+S+    +   W E +   +L  ++++T+N+YK++ E K  K K  R+ +  V +P+ +L    EV+K
Sbjct:   49 IKKSIQPARDQQNRMDISLSVWVCEAKGAMTTPKKRYFCELLLDKMLYARTTSKTKVDT-LFWGENFSFDDLLDLSTITVNIYKDL-EAKNKKEK--RKLVGTVNIPVRDLDSSQEVEK 163          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Nematostella
Match: EDO43446 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYE3])

HSP 1 Score: 122.865 bits (307), Expect = 2.180e-28
Identity = 86/268 (32.09%), Postives = 135/268 (50.37%), Query Frame = 1
Query: 1495 MKICISAKYQCIEILPLVCYSQLREFILD---HYEC-------LVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQE--FADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFM 2262
            +K+C +  Y    + P   Y  LRE IL+   H +        L + + +KL+  R      +L+ +    N    FI   + +++++T D  ++  R N++G+KA++ +MK  GM YL   +     ++       E+DPSRL D   L      L   V  L   I  S    PT + +VF ++R S  ++++ E       +SG VFLRF  PAILNP L+Q+  E+P DP + R  TL SK++Q+L N   SV  G  +KEP+M
Sbjct:  278 LKVCYTEDY----VFPSSYYEPLREAILEIEGHKDVTTTPAYILSEIVKDKLTAAR------ALVRVFTHHNKVVDFIKAVVDHEVNTTADCNTL-FRGNSLGTKAIDEFMKHAGMQYLHETIKTLVDEIYEERKCCEIDPSRLRDGDSLPQNLANLQGYVNKLCAAITCSAMACPTAMSKVFVTIRESAVQRFSDEPDVRYTAVSGFVFLRFFAPAILNPKLFQMRNEHP-DPLVARTLTLASKAIQSLGNLVSSVICG-QVKEPYM 532          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Nematostella
Match: EDO36190 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJB4])

HSP 1 Score: 108.997 bits (271), Expect = 3.357e-24
Identity = 81/285 (28.42%), Postives = 141/285 (49.47%), Query Frame = 1
Query: 1486 ADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISI--HELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKY--NQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREIS 2328
            A+   + I  K+    I+P+  Y  L+E +LD     V  L      R +  +AS+L+ I  HE       F+  ++  +     D Q+   R  ++ +  M+ YMK++ + YL+  + +  +K+L    S E++P+++E  +   +   QL   +    + I  S  + P  L+ +F  L+ +++ K+  NQ    +++SG +FLR  CPAI+NP    L+ E P      R  TL++K LQ LAN    V  G   KE  M P++  +   R RM++F+ E+S
Sbjct:  342 AEVGNVRIRVKFTHEIIMPVEEYEALKEILLDEDLVAVTALGQVCKDRVV--LASTLLKIFRHE---KQEIFLLKTMNAREIEKQDEQATLFRGASLATSLMDQYMKMVAIPYLQHTIKDVILKILECKQSCELNPAKMEKGADTVVNLKQLLEFLFEAIDAIFTSAEECPKTLRYLFGCLQQNVKDKWADNQTVRTRVVSGFLFLRLFCPAIMNPKTCNLMSELP-SATAARTLTLVAKCLQKLANL---VEFGA--KESCMTPVNPFMQKNRERMVSFMDELS 615          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Nematostella
Match: EDO40933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5U4])

HSP 1 Score: 59.6918 bits (143), Expect = 6.762e-9
Identity = 62/228 (27.19%), Postives = 116/228 (50.88%), Query Frame = 1
Query: 1753 LRSNTIGSKAMESYMKLI-GMDYLKSILGE-------------------FSMKVLFYP---SSLEVDPSRLEDKSLLKLTQVQLCSM--VQSLW-NKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQ---LLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEP-FHK 2346
            LR+NT  S+ M +Y +   G +YLK  L E                     +++  +P   SSL ++ + ++D  ++  T++++  +  + SL+   I +S+SQ+P  ++ +  +++    +K+ +   +Q   ++ G   LRFI PAI+ P  Y L+ + P    + RN TLI+K LQ++AN+          KE +M P+     N  + M +FL ++S+ P FH+
Sbjct:  158 LRANTAISRMMTTYTRRGPGQEYLKCTLEEPLNDLMSQEDLVLEINPIKVYIELYGHPMDESSLTLERA-MDDPEVMFRTKLRIKKLQDISSLFLGIIISSLSQVPYGIQWLCRAIKELAMEKFPEATPEQINAMIGGFFLLRFINPAIVTPTAYMLVNKQPTYT-MRRNLTLIAKILQSMANKNVV---SSHFKEEYMQPLQPFAINHVDLMQSFLSDLSSVPDFHE 380          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Match: ENSORLT00000022035.2 (disabled homolog 2-interacting protein-like [Source:NCBI gene;Acc:101175325])

HSP 1 Score: 218.779 bits (556), Expect = 6.875e-58
Identity = 162/558 (29.03%), Postives = 261/558 (46.77%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMA 2562
            +RR+  P  D  RR E  L   +   +++ +KKRY CEL L++  YARTS ++ +     W E ++ C+L  V S+T++LYK+        RK  + K ++V L                    +N+P+S   G        S S  S  + K                     SS+P                          + + A+YQ I ILP+  Y +  E+I  +Y  L   L+  +S R  EE+A++L+ I      A  F+T+ + +++D   D   +  R NT+ +K++E Y+KLIG  YL+  LGEF   +     + EVDP+R     L +  Q  L    +  + KI +S    P ELK VF+S R     +   + +++L+S  +FLRF+CPA+++P L+ L+QEYP D R  R  TLI+K +Q LAN +         KE +M+ +++ +  + + M  FL+EIS           N ++ +  +ID+G EL+  H    E      +D++    L PL  IL+D+   L  P    ST  ++
Sbjct:   71 LRRAVHPNKDNSRRLENVLTVWVIEAKDLPAKKRYFCELCLDDSLYARTSCKL-KTDNIFWGEHFDFCSLPSVNSITLHLYKDT------DRKRKKDKSSYVGL--------------------VNIPVSTVTGRQLVEKWYSVSTPSTIRGK---------------------SSIP-------------------------NVRVKARYQSIIILPMEQYKEFAEYISSNYLLLCSTLEASISLRAKEELAAALVHILHSTGKAKDFLTDLMMSEVDRCRDNDQLIFRENTLATKSIEEYLKLIGQKYLQDALGEFIKALYESDENCEVDPARCSTSDLAE-HQANLRMCCELAFCKILDSYRVFPRELKEVFASWRQECSNRGRPDISERLISASLFLRFLCPAVMSPSLFDLMQEYP-DERTARTLTLIAKVIQNLANFSKF-----GTKEEYMLFMNDFVERQWSSMQRFLQEISNP------DGLNHTAGFDGYIDLGRELSSLHTLLTE------LDQSCLSKLSPLPRILRDVSAALANPGGLASTGAVS 536          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Match: syngap1b (ras/Rap GTPase-activating protein SynGAP [Source:NCBI gene;Acc:101163690])

HSP 1 Score: 188.734 bits (478), Expect = 4.453e-48
Identity = 122/345 (35.36%), Postives = 186/345 (53.91%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQ 2541
            + +++Q + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + +  R NT+ +KA+E Y+KLIG  YLK  +GEF   +     + EVDP R+   S+L   Q  L    +    KI NS    P ELK VF+S R    ++  ++ AD+L+SG +FLRF+CPAI++P L+ L QEYP D +  R  TLI+K +Q LAN + SVN     KE +M  ++E L  E   M  FL EIS        +N  G   +  +ID+G EL++ H    E+  + S D  +  G  PL  +L D+   L  P  Q
Sbjct:  364 LKSRFQTMNILPMELYKEFAEYVTNNYRTLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMCEVDRFIDREHLIFRENTLATKAIEEYLKLIGHKYLKDAIGEFIRALYESEENCEVDPMRI-SPSILPDHQANLRMCCELALCKIVNSHCVFPRELKEVFASWRVRCAERGREDIADRLISGSLFLRFLCPAIMSPSLFNLTQEYP-DEQTSRTLTLIAKVVQNLANFSKSVN-----KEEYMCFMNEFLEMEWGSMQQFLYEISN---LDSVSNAGG---FEGYIDLGRELSILHSLLWEVMAQLSKDAIIKLG--PLPRLLNDISMALRNPHLQ 693          

HSP 2 Score: 65.4698 bits (158), Expect = 3.198e-10
Identity = 39/117 (33.33%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            ++R+ KP  D  RR +  LK  I     + +KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LYKE       +RK     +  V++PI  +  R  V++
Sbjct:  224 LQRAVKPNKDNSRRVDNVLKLWIIEARELPAKKRYYCELCLDDMLYARTTSK-PRTDTVFWGEHFEFNNLPAVRNLRLHLYKET---DKKRRKEKSTYLGLVSIPISSITGRQFVEQ 336          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Match: rasal2 (RAS protein activator like 2 [Source:NCBI gene;Acc:101155962])

HSP 1 Score: 188.348 bits (477), Expect = 5.048e-48
Identity = 133/422 (31.52%), Postives = 216/422 (51.18%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYS-LEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEI----------FIEPSIDKNLP---------QGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILAD-NAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYET 2700
            I I +++Q I ILP+  Y +  EFI ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   D   +  R NT+ +KA+E Y+KL+G  YL   LGEF   +       EVDPSR     L +  + +++C   +  + KI NS    P ELK VF+S +   + + + Q+ + +L+S  +FLRF+CPAI++P L+ L+QEYP D R  RN TLI+K +Q LAN T   N     KE +M  +++ L +E   M+ FL EIS     +  +N  G   +  +ID+G EL+V H    ++          F++ ++ K  P         Q L    P+ Q LQ +    +  N T  M+  + R  +  AD +++    S +E +    +    I    Q QQ ++
Sbjct:  405 IRIKSRFQTISILPMEQYKEFAEFITNNYSMLCTVLEPVISVKNKEEMACALVHILQSTGRAKDFLTDLVMSEVDRCADHDVLIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDEDCEVDPSRCSGSDLTEHRSNLKMC--CELAFCKIINSYCVFPRELKEVFASWKQQCVARGHVQDISKRLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTSRNLTLIAKVIQNLANFTKFGN-----KEEYMAFMNDFLEHEWAGMMRFLSEISNP---ETLSNTPG---FEGYIDLGRELSVLHTLLWDVVSQLDKGENSFLQATVAKLGPLPRILGEITQSLAAPTPLPQQLQRFQHHSSAHNITGSMSSGIQRMFEGAADSHSVHSLQSAVEMMEGPPQRPLPIPNGGQGQQRDS 812          

HSP 2 Score: 63.929 bits (154), Expect = 1.174e-9
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+ +P  D +RR E  L+  I   +++  KK+Y CEL L++  YART+S+    S   W E ++  +L  V S+T+++Y+++ + K   + N    +  V +P+  +  R  V+K
Sbjct:  274 LRRTIQPNKDNRRRAENLLRLWIIEAKDLPPKKKYFCELCLDDILYARTTSKTRHDS-LFWGEYFDFSSLPSVHSITVHIYRDVDKKKKKDKNNY---VGLVNIPVSSMTGRQFVEK 386          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Match: syngap1b (ras/Rap GTPase-activating protein SynGAP [Source:NCBI gene;Acc:101163690])

HSP 1 Score: 187.963 bits (476), Expect = 6.263e-48
Identity = 122/345 (35.36%), Postives = 186/345 (53.91%), Query Frame = 1
Query: 1507 ISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPILQDLQTYLTPPTNQ 2541
            + +++Q + ILP+  Y +  E++ ++Y  L   L+  LS +  EE+A +L+ I +    A  F+++    ++D   D + +  R NT+ +KA+E Y+KLIG  YLK  +GEF   +     + EVDP R+   S+L   Q  L    +    KI NS    P ELK VF+S R    ++  ++ AD+L+SG +FLRF+CPAI++P L+ L QEYP D +  R  TLI+K +Q LAN + SVN     KE +M  ++E L  E   M  FL EIS        +N  G   +  +ID+G EL++ H    E+  + S D  +  G  PL  +L D+   L  P  Q
Sbjct:  306 LKSRFQTMNILPMELYKEFAEYVTNNYRTLCAVLEPVLSVKSKEEVACALVHILQSTGKAKDFLSDMAMCEVDRFIDREHLIFRENTLATKAIEEYLKLIGHKYLKDAIGEFIRALYESEENCEVDPMRI-SPSILPDHQANLRMCCELALCKIVNSHCVFPRELKEVFASWRVRCAERGREDIADRLISGSLFLRFLCPAIMSPSLFNLTQEYP-DEQTSRTLTLIAKVVQNLANFSKSVN-----KEEYMCFMNEFLEMEWGSMQQFLYEISN---LDSVSNAGG---FEGYIDLGRELSILHSLLWEVMAQLSKDAIIKLG--PLPRLLNDISMALRNPHLQ 635          

HSP 2 Score: 65.4698 bits (158), Expect = 3.527e-10
Identity = 39/117 (33.33%), Postives = 62/117 (52.99%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            ++R+ KP  D  RR +  LK  I     + +KKRY+CEL L++  YART+S+        W E +E  NL  V ++ ++LYKE       +RK     +  V++PI  +  R  V++
Sbjct:  166 LQRAVKPNKDNSRRVDNVLKLWIIEARELPAKKRYYCELCLDDMLYARTTSK-PRTDTVFWGEHFEFNNLPAVRNLRLHLYKET---DKKRRKEKSTYLGLVSIPISSITGRQFVEQ 278          
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Match: rasal2 (RAS protein activator like 2 [Source:NCBI gene;Acc:101155962])

HSP 1 Score: 186.808 bits (473), Expect = 1.341e-47
Identity = 127/387 (32.82%), Postives = 202/387 (52.20%), Query Frame = 1
Query: 1501 ICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLK-LTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYS-LEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEI----------FIEPSIDKNLP---------QGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILAD 2598
            I I +++Q I ILP+  Y +  EFI ++Y  L   L+  +S +  EE+A +L+ I +    A  F+T+ + +++D   D   +  R NT+ +KA+E Y+KL+G  YL   LGEF   +       EVDPSR     L +  + +++C   +  + KI NS    P ELK VF+S +   + + + Q+ + +L+S  +FLRF+CPAI++P L+ L+QEYP D R  RN TLI+K +Q LAN T   N     KE +M  +++ L +E   M+ FL EIS     +  +N  G   +  +ID+G EL+V H    ++          F++ ++ K  P         Q L    P+ Q LQ +    +  N T  M+  + R  +  AD
Sbjct:  271 IRIKSRFQTISILPMEQYKEFAEFITNNYSMLCTVLEPVISVKNKEEMACALVHILQSTGRAKDFLTDLVMSEVDRCADHDVLIFRENTLATKAIEEYLKLVGQKYLHDALGEFIKALYESDEDCEVDPSRCSGSDLTEHRSNLKMC--CELAFCKIINSYCVFPRELKEVFASWKQQCVARGHVQDISKRLISASLFLRFLCPAIMSPSLFSLMQEYPDD-RTSRNLTLIAKVIQNLANFTKFGN-----KEEYMAFMNDFLEHEWAGMMRFLSEISNP---ETLSNTPG---FEGYIDLGRELSVLHTLLWDVVSQLDKGENSFLQATVAKLGPLPRILGEITQSLAAPTPLPQQLQRFQHHSSAHNITGSMSSGIQRMFEGAAD 643          

HSP 2 Score: 63.1586 bits (152), Expect = 1.598e-9
Identity = 36/117 (30.77%), Postives = 66/117 (56.41%), Query Frame = 1
Query:  889 IRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKK 1239
            +RR+ +P  D +RR E  L+  I   +++  KK+Y CEL L++  YART+S+    S   W E ++  +L  V S+T+++Y+++ + K   + N    +  V +P+  +  R  V+K
Sbjct:  140 LRRTIQPNKDNRRRAENLLRLWIIEAKDLPPKKKYFCELCLDDILYARTTSKTRHDS-LFWGEYFDFSSLPSVHSITVHIYRDVDKKKKKDKNNY---VGLVNIPVSSMTGRQFVEK 252          
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Match: SMESG000060447.1 (SMESG000060447.1)

HSP 1 Score: 1484.16 bits (3841), Expect = 0.000e+0
Identity = 770/789 (97.59%), Postives = 773/789 (97.97%), Query Frame = 1
Query:  502 GVSNTPNQFTKNXXXXXXXXXXXXXXXXXXXXXXQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDK---------------NLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDLNRVTTRHTINVDEI 2823
            GVSNTPNQFTKNTLKSSIPTPKSSKSFSTSKTESQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNG+SKWHQFIDIGYELAVSHLYYLEIFIEPSIDK               NLPQGLKPLIPILQDL+TYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKD NRVTTRHTINVDE+
Sbjct:   32 GVSNTPNQFTKNTLKSSIPTPKSSKSFSTSKTESQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGTSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKVWLYILTVLIFNFIQNLPQGLKPLIPILQDLKTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDSNRVTTRHTINVDEV 820          
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Match: SMESG000060447.1 (SMESG000060447.1)

HSP 1 Score: 1483.77 bits (3840), Expect = 0.000e+0
Identity = 770/789 (97.59%), Postives = 773/789 (97.97%), Query Frame = 1
Query:  502 GVSNTPNQFTKNXXXXXXXXXXXXXXXXXXXXXXQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDK---------------NLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDLNRVTTRHTINVDEI 2823
            GVSNTPNQFTKNTLKSSIPTPKSSKSFSTSKTESQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNG+SKWHQFIDIGYELAVSHLYYLEIFIEPSIDK               NLPQGLKPLIPILQDL+TYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKD NRVTTRHTINVDE+
Sbjct:   36 GVSNTPNQFTKNTLKSSIPTPKSSKSFSTSKTESQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFPSKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNEMDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGTSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKVWLYILTVLIFNFIQNLPQGLKPLIPILQDLKTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDSNRVTTRHTINVDEV 824          
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Match: SMESG000060888.1 (SMESG000060888.1)

HSP 1 Score: 1236.09 bits (3197), Expect = 0.000e+0
Identity = 620/639 (97.03%), Postives = 623/639 (97.50%), Query Frame = 1
Query:  952 MIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCXXXXXXXXXXXXXXKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDK---------------NLPQGLKPLIPILQDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDLNRVTTRHTINVDEI 2823
            MIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNG+SKWHQFIDIGYELAVSHLYYLEIFIEPSIDK               NLPQGLKPLIPILQDL+TYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKD NRVTTRHTINVDE+
Sbjct:    1 MIESIENVTSKKRYHCELKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGKGGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFCLPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRSSFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQYLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIALRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLEDKSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQEFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQTLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCYTNKNGTSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKVWLYILTVLIFNFIQNLPQGLKPLIPILQDLKTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKKEDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDSNRVTTRHTINVDEV 639          
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Match: SMESG000060891.1 (SMESG000060891.1)

HSP 1 Score: 380.178 bits (975), Expect = 2.467e-124
Identity = 182/182 (100.00%), Postives = 182/182 (100.00%), Query Frame = 1
Query: 2821 INHLWKCLVEKSESHLANHEQAPQIDVDFDPDFKMEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR 3366
            INHLWKCLVEKSESHLANHEQAPQIDVDFDPDFKMEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR
Sbjct:    9 INHLWKCLVEKSESHLANHEQAPQIDVDFDPDFKMEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR 190          
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Match: SMESG000060891.1 (SMESG000060891.1)

HSP 1 Score: 306.605 bits (784), Expect = 1.567e-97
Identity = 148/148 (100.00%), Postives = 148/148 (100.00%), Query Frame = 1
Query: 2923 MEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR 3366
            MEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR
Sbjct:    1 MEYQFCFDSIEDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPPSIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEAEIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR 148          
The following BLAST results are available for this feature:
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RASAL25.802e-4831.24RAS protein activator like 2 [Source:HGNC Symbol;A... [more]
SYNGAP16.563e-4833.80synaptic Ras GTPase activating protein 1 [Source:H... [more]
SYNGAP17.134e-4833.80synaptic Ras GTPase activating protein 1 [Source:H... [more]
SYNGAP17.134e-4833.80synaptic Ras GTPase activating protein 1 [Source:H... [more]
SYNGAP17.509e-4833.80synaptic Ras GTPase activating protein 1 [Source:H... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gap-22.212e-6130.97Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-22.561e-6131.08Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-22.747e-6131.08Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-22.797e-6131.14Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
gap-24.219e-6130.97Ras GTPase-activating protein gap-2 [Source:UniPr... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
raskol5.589e-3931.60gene:FBgn0261570 transcript:FBtr0302836[more]
raskol5.743e-3930.79gene:FBgn0261570 transcript:FBtr0302833[more]
raskol5.754e-3930.79gene:FBgn0261570 transcript:FBtr0340632[more]
raskol6.884e-3931.60gene:FBgn0261570 transcript:FBtr0340629[more]
raskol7.661e-3931.60gene:FBgn0261570 transcript:FBtr0340630[more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dab2ipa1.703e-5630.38DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipa1.782e-5630.38DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb4.697e-4834.08DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb5.585e-4834.08DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb5.607e-4834.08DAB2 interacting protein b [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SYNGAP13.030e-5530.00synaptic Ras GTPase activating protein 1 [Source:N... [more]
SYNGAP13.178e-5530.00synaptic Ras GTPase activating protein 1 [Source:N... [more]
SYNGAP13.240e-5530.00synaptic Ras GTPase activating protein 1 [Source:N... [more]
SYNGAP15.385e-5530.00synaptic Ras GTPase activating protein 1 [Source:N... [more]
SYNGAP16.626e-5530.00synaptic Ras GTPase activating protein 1 [Source:N... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rasal22.160e-4931.12RAS protein activator like 2 [Source:MGI Symbol;Ac... [more]
Dab2ip1.828e-4835.55disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.374e-4835.55disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.552e-4835.55disabled 2 interacting protein [Source:MGI Symbol;... [more]
Dab2ip2.925e-4835.55disabled 2 interacting protein [Source:MGI Symbol;... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8MLZ5|GAP2_CAEEL1.165e-5930.90Ras GTPase-activating protein gap-2 OS=Caenorhabdi... [more]
sp|Q6P730|DAB2P_RAT1.383e-4735.84Disabled homolog 2-interacting protein OS=Rattus n... [more]
sp|Q3UHC7|DAB2P_MOUSE1.660e-4735.55Disabled homolog 2-interacting protein OS=Mus musc... [more]
sp|Q9QUH6|SYGP1_RAT3.526e-4733.80Ras/Rap GTPase-activating protein SynGAP OS=Rattus... [more]
sp|F6SEU4|SYGP1_MOUSE3.860e-4733.80Ras/Rap GTPase-activating protein SynGAP OS=Mus mu... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2LFD11.216e-7032.41Ras-GAP domain-containing protein OS=Opisthorchis ... [more]
A0A068WSU41.395e-6930.23Synaptic ras gtpase activating protein syngap OS=E... [more]
A0A4S2LF421.210e-6832.24Ras-GAP domain-containing protein OS=Opisthorchis ... [more]
A0A4S2LFR02.176e-6832.24Ras-GAP domain-containing protein OS=Opisthorchis ... [more]
A0A5K3EYC61.093e-6730.48Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dab2ipa1.388e-4834.55DAB2 interacting protein a [Source:ZFIN;Acc:ZDB-GE... [more]
dab2ipb1.438e-4734.46DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb1.503e-4734.46DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
dab2ipb1.630e-4734.46DAB2 interacting protein [Source:NCBI gene;Acc:103... [more]
rasal22.297e-4732.69ras GTPase-activating protein nGAP [Source:NCBI ge... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000000945.15.069e-3531.67pep scaffold:Pmarinus_7.0:GL477254:323984:383899:1... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 3
Match NameE-valueIdentityDescription
BUD24.114e-1826.80GTPase activating factor for Rsr1p/Bud1p; plays a ... [more]
IRA14.665e-624.75GTPase-activating protein; negatively regulates RA... [more]
IRA26.210e-623.44GTPase-activating protein; negatively regulates RA... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO357993.552e-3831.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO434462.180e-2832.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361903.357e-2428.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409336.762e-927.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000022035.26.875e-5829.03disabled homolog 2-interacting protein-like [Sourc... [more]
syngap1b4.453e-4835.36ras/Rap GTPase-activating protein SynGAP [Source:N... [more]
rasal25.048e-4831.52RAS protein activator like 2 [Source:NCBI gene;Acc... [more]
syngap1b6.263e-4835.36ras/Rap GTPase-activating protein SynGAP [Source:N... [more]
rasal21.341e-4732.82RAS protein activator like 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Ras GTPase-activating protein SynGAP vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060447.10.000e+097.59SMESG000060447.1[more]
SMESG000060447.10.000e+097.59SMESG000060447.1[more]
SMESG000060888.10.000e+097.03SMESG000060888.1[more]
SMESG000060891.12.467e-124100.00SMESG000060891.1[more]
SMESG000060891.11.567e-97100.00SMESG000060891.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016327 ID=SMED30016327|Name=Ras GTPase-activating protein SynGAP|organism=Schmidtea mediterranea sexual|type=transcript|length=3522bp
GTCACACAAATTTAAGCAATTTCATATCCTAAGCCAGTTGTTTATCACTT
GCTAAAGGAAATTGGATACATTACGGTGATGGGATATAAGCACCTCTTTA
ATTGATTGGATCTTCTCCAATTGGTGCAATGCCACCGGGGATAACCATCG
GTTTTATTTATCTAAACACCATTCAATTTCAGTCGTGTGTTCATTTCCGG
GATTTCAAATCATGAATAAAATAAGCTTCCAATTTTCTCAGTTTTGAAGA
ACATGGATCGTAGCTTTGTTAGTGAATCAGGAAAATTTCTGAAAACAAAG
AAGAATTTTTCGAGTTCGGGATTTTTAACATGTTCATCAGACGGAAATTC
GTCCGACAATAGTTTGATGAATGATATTTGTTTGAAATATAAATCGAAAG
AGCATGAATATGAAAATAAATATCCCGTAAAAAGTAATAAATCAAACTAT
TTACTTGATAAAAAGCCACCACAAAGCCCAGGAGATCGGCAACGAGTTCG
AGGAGTGTCAAATACCCCAAATCAATTTACTAAGAATACTTTAAAAAGTA
GCATTCCGACACCCAAATCATCAAAATCATTCTCAACCTCAAAAACAGAA
TCTCAGCCTAAATTACATGATTCTTTGGTGACGCTTTCAGAAATTTCCAA
CAAAAACAAAAAATTCATTCCGAAAAAGTCTCTGTCATTTCAATCATTTC
CATCTAAACTGAATCTCAATCCAACCAAAACAATTCTGAGTGAAGCAAAT
ATTCCGTTCTCAGATTCATGTAATTCTATCAAAAATCCCATTTTTTATTC
TCTTGAAAGACATACACCAAATAAGAATCAAGAAAACCTCTCTGACAACG
AAATGGATCCAAGAACAATGAAGCCAAAAAATGATTTTATTCGTCGATCT
GCCAAACCGGCATTGGACAAACAAAGGCGTAGGGAGTATTCTTTGAAATT
TATGATAGAATCTATAGAAAATGTCACTTCTAAAAAACGATACCATTGTG
AATTGAAGCTTAATAATCGGACTTATGCTCGCACTTCGAGCAGAGTAGCG
GAAAAAAGTGAAGCAGTTTGGAATGAAATTTATGAATTGTGTAATCTGTC
TCCAGTAACATCGGTGACAATTAATCTGTACAAAGAAATGGTTGAAGGTA
AAGGGGGTAAAAGAAAAAACATCCGGCAGAAAATCGCATTTGTAACTTTA
CCAATTGAAGAACTGTACGAAAGAAATGAAGTCAAAAAAAAGTTGACAAT
GCAAAAAAATATTAATCTACCAATTTCACAAACTAATGGCACAAGTTTTT
GTTTGCCAAGCGAATCAAGATCAAACGAATCGCACAATAAGCACAAACGT
TATTATCGCAGTGAAGGTAGTGATTCTGACATACCAAGAATGAATGGTGA
ATATTGTTCATCGTCTTTGCCTAGAGACGACTGCTCTGGATATTCGAGAT
CGAGTTTTCTGAGATATTTAAGATCAAAAAAAGACGCCGATAGTATGAAA
ATTTGTATCAGTGCAAAATATCAATGCATTGAAATTCTGCCTTTGGTTTG
TTATTCTCAGCTAAGAGAATTTATACTAGATCATTATGAGTGTCTAGTTC
AATATCTAGACAACAAACTATCAGGAAGACGTTTAGAGGAAATTGCATCA
TCTCTGATTTCGATTCATGAACTCGTTAATAATGCTCCTCAGTTCATAAC
AAATTCAATTTGTAATAAACTTGATTCAACAAATGATCCGCAATCAATTG
CGTTAAGATCGAATACAATTGGTTCAAAAGCAATGGAAAGTTATATGAAA
CTTATAGGAATGGATTACCTCAAGTCGATTCTTGGTGAATTTTCAATGAA
GGTTTTATTCTATCCTTCATCTCTGGAAGTGGATCCAAGTAGACTAGAGG
ATAAGTCATTATTGAAACTGACTCAAGTTCAACTGTGTAGCATGGTTCAA
TCTCTGTGGAATAAGATTGCGAATAGTATTAGTCAAATGCCAACTGAACT
TAAGCGAGTATTTTCTTCACTTCGATACAGCTTGGAGAAAAAATACAACC
AAGAATTTGCGGATCAGTTGTTGAGTGGTTGCGTTTTCTTAAGATTTATT
TGCCCAGCGATTCTTAATCCTTATTTATATCAGTTAATTCAAGAATATCC
CCAAGATCCAAGAATAATTCGAAATTTTACTCTTATATCAAAATCCTTAC
AAACTTTAGCTAATCAGACAGGGTCGGTCAATGATGGTCCGTCTATAAAA
GAACCTTTCATGATTCCTATTCACGAGTCATTAGCCAATGAACGCAATAG
AATGATTAATTTTTTAAGAGAGATTTCTACGGAGCCATTCCATAAATGCT
ATACAAATAAAAACGGAAGCTCTAAATGGCATCAGTTCATTGATATTGGC
TACGAGTTAGCTGTTTCACATTTATATTATTTAGAAATATTCATTGAGCC
TTCAATTGATAAGAACTTGCCACAGGGTTTAAAACCCTTGATTCCAATTC
TACAAGACCTACAAACATATCTGACGCCACCTACAAATCAAAATAGCACA
ACAGAGATGGCTGAGTTACTATCTAGAAATTGTAAAATTCTTGCCGATAA
TGCCATCGGTGAATTTTCTTCAAACATAGAAAAAGTCACAAACTTTAAGA
AAGAAGATGCCGTAATCAAAACTCCAAGCCAAACCCAACAGTACGAAACA
CACAATGGAAACCGGAACACTTTGCGCAAAAAATCAGCACCATCATTGAC
GGAATATGAGAATTCTGATAAAAAGGATTTAAATCGAGTAACAACTAGGC
ATACTATTAATGTAGATGAGATTAATCATCTTTGGAAATGCCTAGTGGAA
AAATCCGAAAGTCATTTGGCTAATCATGAGCAAGCACCGCAGATTGATGT
AGATTTTGATCCAGATTTCAAAATGGAATATCAGTTTTGTTTCGATTCGA
TAGAAGATACCACAGGAATGGAAAGAGACAATTTTTCACTGCCCAGTTTG
ATTGGTACACCAGTCTCAAACAATACTACGAAATCGTTTTACGTTAATGG
AGACCAGTCTTCAAAAGACTCATCACCAGTGATCAATTATCCTCCACCAC
CTTCAATTGATACTCTTCCTCAAAACTCAGTGGGATTTTGCAAAATATCA
CCAACCAAATCCATAAGAATGGGAACAAAAGCCGTCCAAACTGTTCAAAA
TAAAAAACCAACGAATGACATCGAAACAATGAGACGGCTTGTGACAGAGG
CGGAAATAAAATACCTTCAAGCGCAAAAGGAAATTGCGGACAAAGAAGAA
GAAAACAAAATTCTCAGAGAATTGCTTCGAAATCAAACAAATAAATCTCA
CAAAGAAGACGTTCGATGAAATTGTATGATCAATAATTGTCTTTCAAGAT
TGCTAAATTCGAGAAAAAAAACATGAAATAATGAATTTGAAGAAATTTCT
ATTGTTGAATTTATTGTGTACAGCGAAACTTATAAGCAGATTTTTTTTAA
TTTTGTTAAAAATAGATAGTCG
back to top

protein sequence of SMED30016327-orf-1

>SMED30016327-orf-1 ID=SMED30016327-orf-1|Name=SMED30016327-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1039bp
MDRSFVSESGKFLKTKKNFSSSGFLTCSSDGNSSDNSLMNDICLKYKSKE
HEYENKYPVKSNKSNYLLDKKPPQSPGDRQRVRGVSNTPNQFTKNTLKSS
IPTPKSSKSFSTSKTESQPKLHDSLVTLSEISNKNKKFIPKKSLSFQSFP
SKLNLNPTKTILSEANIPFSDSCNSIKNPIFYSLERHTPNKNQENLSDNE
MDPRTMKPKNDFIRRSAKPALDKQRRREYSLKFMIESIENVTSKKRYHCE
LKLNNRTYARTSSRVAEKSEAVWNEIYELCNLSPVTSVTINLYKEMVEGK
GGKRKNIRQKIAFVTLPIEELYERNEVKKKLTMQKNINLPISQTNGTSFC
LPSESRSNESHNKHKRYYRSEGSDSDIPRMNGEYCSSSLPRDDCSGYSRS
SFLRYLRSKKDADSMKICISAKYQCIEILPLVCYSQLREFILDHYECLVQ
YLDNKLSGRRLEEIASSLISIHELVNNAPQFITNSICNKLDSTNDPQSIA
LRSNTIGSKAMESYMKLIGMDYLKSILGEFSMKVLFYPSSLEVDPSRLED
KSLLKLTQVQLCSMVQSLWNKIANSISQMPTELKRVFSSLRYSLEKKYNQ
EFADQLLSGCVFLRFICPAILNPYLYQLIQEYPQDPRIIRNFTLISKSLQ
TLANQTGSVNDGPSIKEPFMIPIHESLANERNRMINFLREISTEPFHKCY
TNKNGSSKWHQFIDIGYELAVSHLYYLEIFIEPSIDKNLPQGLKPLIPIL
QDLQTYLTPPTNQNSTTEMAELLSRNCKILADNAIGEFSSNIEKVTNFKK
EDAVIKTPSQTQQYETHNGNRNTLRKKSAPSLTEYENSDKKDLNRVTTRH
TINVDEINHLWKCLVEKSESHLANHEQAPQIDVDFDPDFKMEYQFCFDSI
EDTTGMERDNFSLPSLIGTPVSNNTTKSFYVNGDQSSKDSSPVINYPPPP
SIDTLPQNSVGFCKISPTKSIRMGTKAVQTVQNKKPTNDIETMRRLVTEA
EIKYLQAQKEIADKEEENKILRELLRNQTNKSHKEDVR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039360Ras_GTPase
IPR001936RasGAP_dom
IPR023152RasGAP_CS
IPR008936Rho_GTPase_activation_prot
Vocabulary: biological process
TermDefinition
GO:0043087regulation of GTPase activity
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 990..1031
NoneNo IPR availableGENE3DG3DSA:1.10.506.10coord: 479..710
e-value: 1.0E-82
score: 280.0
NoneNo IPR availableGENE3DG3DSA:1.10.506.20coord: 429..758
e-value: 1.0E-82
score: 280.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 806..847
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 352..372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 357..372
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 806..831
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..121
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 832..847
NoneNo IPR availablePANTHERPTHR10194:SF125RAS GTPASE-ACTIVATING PROTEIN-RELATEDcoord: 213..1030
IPR001936Ras GTPase-activating domainSMARTSM00323RasGAP_2coord: 409..768
e-value: 1.6E-46
score: 170.5
IPR001936Ras GTPase-activating domainPFAMPF00616RasGAPcoord: 560..654
e-value: 6.2E-14
score: 52.2
coord: 481..551
e-value: 1.3E-8
score: 34.8
IPR001936Ras GTPase-activating domainPROSITEPS50018RAS_GTPASE_ACTIV_2coord: 460..654
score: 37.803
IPR039360Ras GTPase-activating proteinPANTHERPTHR10194RAS GTPASE-ACTIVATING PROTEINScoord: 213..1030
IPR023152Ras GTPase-activating protein, conserved sitePROSITEPS00509RAS_GTPASE_ACTIV_1coord: 609..623
IPR008936Rho GTPase activation proteinSUPERFAMILYSSF48350GTPase activation domain, GAPcoord: 433..753