Dmd-1 splice form 1

Overview
NameDmd-1 splice form 1 (AGL61623.1)
Smed IDSMED30016325
Length (bp)1012
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Dmd-1 splice form 1 (SMED30016325) t-SNE clustered cells

Violin plots show distribution of expression levels for Dmd-1 splice form 1 (SMED30016325) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Dmd-1 splice form 1 (SMED30016325) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Dmd-1 splice form 1 (SMED30016325) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016325

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 57

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
prepharyngeal regionSMED30016325SMESG000080385.1 SmedASXL_003739SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
X1 cellSMED30016325SMESG000080385.1 SmedASXL_003739SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016325SMESG000080385.1 SmedASXL_003739SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
penis papillaSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
seminal vesicleSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cholinergic neuronSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic ganglia neuronSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
testis somatic gonadal cellSMED30016325SMESG000080385.1 KC736557smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
penis papillaSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
seminal vesicleSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cholinergic neuronSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic ganglia neuronSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
testis somatic gonadal cellSMED30016325SMESG000080385.1 KC736558smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
penis papillaSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
seminal vesicleSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cholinergic neuronSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic ganglia neuronSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
testis somatic gonadal cellSMED30016325SMESG000080385.1 KC736555smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cephalic gangliaSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
penis papillaSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
sperm ductSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testisSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
seminal vesicleSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
cholinergic neuronSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
cephalic ganglia neuronSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism asexual adult colorimetric in situ hybridization evidence
testis primordiumSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism juvenile colorimetric in situ hybridization evidence
testis somatic gonadal cellSMED30016325SMESG000080385.1 KC736556smed_ncbi_20200123PMID:23652002
Chong et al., 2013
whole organism adult hermaphrodite fluorescence in situ hybridization evidence
neuronSMED30016325SMESG000080385.1 Contig55528newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30016325SMESG000080385.1 Contig55528uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Match: DMRTA1 (DMRT like family A1 [Source:HGNC Symbol;Acc:HGNC:13826])

HSP 1 Score: 53.1434 bits (126), Expect = 4.066e-7
Identity = 24/60 (40.00%), Postives = 36/60 (60.00%), Query Frame = 3
Query:  360 PQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKS 539
            P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +   + ++  +E+S
Sbjct:   92 PRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEES 151          
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Match: DMRTA2 (DMRT like family A2 [Source:HGNC Symbol;Acc:HGNC:13908])

HSP 1 Score: 53.1434 bits (126), Expect = 4.491e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   61 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 129          
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Match: DMRTA2 (DMRT like family A2 [Source:HGNC Symbol;Acc:HGNC:13908])

HSP 1 Score: 53.1434 bits (126), Expect = 4.491e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   61 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 129          
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Match: DMRT1 (doublesex and mab-3 related transcription factor 1 [Source:HGNC Symbol;Acc:HGNC:2934])

HSP 1 Score: 52.373 bits (124), Expect = 5.542e-7
Identity = 24/46 (52.17%), Postives = 30/46 (65.22%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            SK+SP+ P C RCRNHG  +  KGHK+ C   +C CK C LI  R+
Sbjct:   67 SKKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQ 112          
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Match: DMRT3 (doublesex and mab-3 related transcription factor 3 [Source:HGNC Symbol;Acc:HGNC:13909])

HSP 1 Score: 50.0618 bits (118), Expect = 3.147e-6
Identity = 20/41 (48.78%), Postives = 28/41 (68.29%), Query Frame = 3
Query:  363 QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            ++P C RCRNHG  +  KGHK+ CR  +C C+ C+LI  R+
Sbjct:   25 RTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQ 65          
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Match: mab-3 (Protein male abnormal 3 [Source:UniProtKB/Swiss-Prot;Acc:O18214])

HSP 1 Score: 58.151 bits (139), Expect = 1.784e-9
Identity = 32/98 (32.65%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  207 HGQLLPVKNHRRNCPFKLCPCPLCTVVSHGRE----IVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKK-CRHSNCPCKLCLLITMRK 485
            HG+L P K H+ +C +  CPC  CT+V   R+    +  ++I      +    +  + PHC RC  HG     +GHK+  C+   C C LC L+  R+
Sbjct:   34 HGELKPRKGHKPDCRYLKCPCRECTMVEQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRR 131          

HSP 2 Score: 51.2174 bits (121), Expect = 3.207e-7
Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 3
Query:  204 AHGQLLPVKNHRRN-CPFKLCPCPLCTVVSHGREIVARQIRLYRNQK 341
            AHG L+P++ H+R  C F  C C LCT+V H R ++A QI+L R+Q+
Sbjct:   99 AHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRRNLMAAQIKLRRSQQ 145          

HSP 3 Score: 46.9802 bits (110), Expect = 8.327e-6
Identity = 18/38 (47.37%), Postives = 25/38 (65.79%), Query Frame = 3
Query:  372 HCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +C+RC NHGE    KGHK  CR+  CPC+ C ++  R+
Sbjct:   27 YCQRCLNHGELKPRKGHKPDCRYLKCPCRECTMVEQRR 64          
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Match: dmd-5 (DM (Doublesex/MAB-3) Domain family [Source:UniProtKB/TrEMBL;Acc:Q19291])

HSP 1 Score: 51.6026 bits (122), Expect = 2.379e-7
Identity = 25/57 (43.86%), Postives = 33/57 (57.89%), Query Frame = 3
Query:  315 QIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +IR  RNQ+        +P C RCRNHG  +A KGHK+ C+  +C C  C LI  R+
Sbjct:   21 RIRAERNQR--------TPKCARCRNHGTTSALKGHKRYCQWKDCMCAKCTLIAERQ 69          
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Match: dmd-8 (DM (Doublesex/MAB-3) Domain family [Source:UniProtKB/TrEMBL;Acc:Q9TXN8])

HSP 1 Score: 49.6766 bits (117), Expect = 1.463e-6
Identity = 34/123 (27.64%), Postives = 54/123 (43.90%), Query Frame = 3
Query:  207 HGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPH--------------------------CRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEK 497
            HG  +  + H   C ++ C C  C +V   REI++ QIRL R Q    +R+                               C++C+NH      K HKK+C++S+C C+ C LI  R+  ++
Sbjct:   57 HGVFVETRGH--TCEYRSCECEQCDLVRKRREIMSTQIRLRREQDKKFQRTNDISEANVFPGFTGGEADEKAVMENMNMCYFCQKCKNHNVLVWKKNHKKECQYSSCECQQCNLIDSRRALDR 177          
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Match: dmd-8 (DM (Doublesex/MAB-3) Domain family [Source:UniProtKB/TrEMBL;Acc:Q9TXN8])

HSP 1 Score: 49.6766 bits (117), Expect = 1.463e-6
Identity = 34/123 (27.64%), Postives = 54/123 (43.90%), Query Frame = 3
Query:  207 HGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPH--------------------------CRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEK 497
            HG  +  + H   C ++ C C  C +V   REI++ QIRL R Q    +R+                               C++C+NH      K HKK+C++S+C C+ C LI  R+  ++
Sbjct:   57 HGVFVETRGH--TCEYRSCECEQCDLVRKRREIMSTQIRLRREQDKKFQRTNDISEANVFPGFTGGEADEKAVMENMNMCYFCQKCKNHNVLVWKKNHKKECQYSSCECQQCNLIDSRRALDR 177          
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Match: dmd-10 (DM (Doublesex/MAB-3) Domain family [Source:UniProtKB/TrEMBL;Acc:G5EEJ1])

HSP 1 Score: 48.9062 bits (115), Expect = 2.076e-6
Identity = 20/45 (44.44%), Postives = 32/45 (71.11%), Query Frame = 3
Query:  207 HGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQK 341
            HG+   +K H+R+CPF+ CPC  C VVS  ++++A QI++ R Q+
Sbjct:   46 HGRKSRLKGHKRSCPFRECPCAKCAVVSERQKLMADQIKIRRRQR 90          
BLAST of Dmd-1 splice form 1 vs. Ensembl Fly
Match: dmrt99B (gene:FBgn0039683 transcript:FBtr0085454)

HSP 1 Score: 51.6026 bits (122), Expect = 5.406e-7
Identity = 27/72 (37.50%), Postives = 40/72 (55.56%), Query Frame = 3
Query:  339 KDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +  S+R  ++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   29 RAASERYQRTPKCARCRNHGVVSALKGHKRYCRWRDCVCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 100          
BLAST of Dmd-1 splice form 1 vs. Ensembl Fly
Match: dmrt93B (gene:FBgn0038851 transcript:FBtr0084007)

HSP 1 Score: 48.521 bits (114), Expect = 4.477e-6
Identity = 26/69 (37.68%), Postives = 35/69 (50.72%), Query Frame = 3
Query:  300 EIVARQIRLYRNQKDISKRSP-------QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            E+  ++ RL  N K      P       + P C RCRNHG  +  +GHKK C + NC C  C+LI  R+
Sbjct:   11 EVANKRPRLVANPKATKIVEPTPAKVTNRVPKCARCRNHGIISELRGHKKLCTYKNCKCAKCVLIFERQ 79          
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Match: dmrta2 (DMRT-like family A2 [Source:NCBI gene;Acc:474350])

HSP 1 Score: 53.1434 bits (126), Expect = 2.065e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   50 TEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 118          
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Match: dmrt2b (doublesex and mab-3 related transcription factor 2b [Source:ZFIN;Acc:ZDB-GENE-080813-1])

HSP 1 Score: 51.2174 bits (121), Expect = 7.265e-7
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 3
Query:  294 GREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            GRE++        ++   ++R  +SP C RCRNHG  +  KGHK+ CR  +C C  CLL+  R+
Sbjct:   29 GREVMGT------DEAPAARRLSRSPKCARCRNHGVVSRLKGHKRLCRWRDCQCANCLLVVERQ 86          
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Match: dmrt2b (doublesex and mab-3 related transcription factor 2b [Source:ZFIN;Acc:ZDB-GENE-080813-1])

HSP 1 Score: 51.2174 bits (121), Expect = 7.265e-7
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 3
Query:  294 GREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            GRE++        ++   ++R  +SP C RCRNHG  +  KGHK+ CR  +C C  CLL+  R+
Sbjct:   29 GREVMGT------DEAPAARRLSRSPKCARCRNHGVVSRLKGHKRLCRWRDCQCANCLLVVERQ 86          
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Match: dmrt2b (doublesex and mab-3 related transcription factor 2b [Source:ZFIN;Acc:ZDB-GENE-080813-1])

HSP 1 Score: 51.2174 bits (121), Expect = 7.397e-7
Identity = 25/64 (39.06%), Postives = 37/64 (57.81%), Query Frame = 3
Query:  294 GREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            GRE++        ++   ++R  +SP C RCRNHG  +  KGHK+ CR  +C C  CLL+  R+
Sbjct:   29 GREVMGT------DEAPAARRLSRSPKCARCRNHGVVSRLKGHKRLCRWRDCQCANCLLVVERQ 86          
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Match: dmrt3a (doublesex and mab-3 related transcription factor 3a [Source:NCBI gene;Acc:450035])

HSP 1 Score: 50.8322 bits (120), Expect = 1.245e-6
Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 3
Query:  324 LYRNQKDISKRSP--QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            LY        R+P  ++P C RCRNHG  +  KGHK+ CR  +C C+ C+LI  R+
Sbjct:    9 LYMGGPVSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQ 64          
BLAST of Dmd-1 splice form 1 vs. Ensembl Xenopus
Match: dynll1 (dynein light chain LC8-type 1 [Source:Xenbase;Acc:XB-GENE-854521])

HSP 1 Score: 53.9138 bits (128), Expect = 1.760e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   40 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 108          
BLAST of Dmd-1 splice form 1 vs. Ensembl Xenopus
Match: dmrta1 (DMRT like family A1 [Source:NCBI gene;Acc:779901])

HSP 1 Score: 51.9878 bits (123), Expect = 8.389e-7
Identity = 22/42 (52.38%), Postives = 28/42 (66.67%), Query Frame = 3
Query:  360 PQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+
Sbjct:   78 PRTPKCARCRNHGVVSALKGHKRFCRWRDCSCAKCTLIAERQ 119          
BLAST of Dmd-1 splice form 1 vs. Ensembl Xenopus
Match: DMRT1 (doublesex and mab-3 related transcription factor 1 [Source:NCBI gene;Acc:100488257])

HSP 1 Score: 51.6026 bits (122), Expect = 9.183e-7
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            K+SP+ P C RCRNHG  +  KGHK+ C   +C CK C LI  R+
Sbjct:   24 KKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQ 68          
BLAST of Dmd-1 splice form 1 vs. Ensembl Xenopus
Match: st3gal4 (ST3 beta-galactoside alpha-2,3-sialyltransferase 4 [Source:Xenbase;Acc:XB-GENE-963280])

HSP 1 Score: 51.2174 bits (121), Expect = 1.384e-6
Identity = 24/56 (42.86%), Postives = 33/56 (58.93%), Query Frame = 3
Query:  324 LYRNQKDISKRSP--QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            LY        R+P  ++P C RCRNHG  +  KGHK+ CR  +C C+ C+LI  R+
Sbjct:    9 LYMGGPVSQPRAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQ 64          
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Match: Dmrta1 (doublesex and mab-3 related transcription factor like family A1 [Source:MGI Symbol;Acc:MGI:2653627])

HSP 1 Score: 55.0694 bits (131), Expect = 6.591e-8
Identity = 31/89 (34.83%), Postives = 45/89 (50.56%), Query Frame = 3
Query:  273 LCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKS 539
            L +  S GR   A    L R    +    P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +   + ++  +E+S
Sbjct:   52 LRSTASSGRAGCAPGPGLDRALGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEES 140          
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Match: Dmrta2 (doublesex and mab-3 related transcription factor like family A2 [Source:MGI Symbol;Acc:MGI:2653629])

HSP 1 Score: 52.7582 bits (125), Expect = 3.583e-7
Identity = 26/68 (38.24%), Postives = 39/68 (57.35%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            ++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   61 EKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCLCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 128          
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Match: Dmrt1 (doublesex and mab-3 related transcription factor 1 [Source:MGI Symbol;Acc:MGI:1354733])

HSP 1 Score: 51.9878 bits (123), Expect = 4.730e-7
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            K+SP+ P C RCRNHG  +  KGHK+ C   +C CK C LI  R+
Sbjct:   66 KKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQ 110          
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Match: Dmrt1 (doublesex and mab-3 related transcription factor 1 [Source:MGI Symbol;Acc:MGI:1354733])

HSP 1 Score: 50.447 bits (119), Expect = 9.483e-7
Identity = 24/66 (36.36%), Postives = 38/66 (57.58%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILV 548
            K+SP+ P C RCRNHG  +  KGHK+ C   +C CK C LI  R+    +   + ++  +E+ + +
Sbjct:   66 KKSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCSLIAERQRVMAAQVALRRQQAQEEELGI 131          
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Match: Dmrt3 (doublesex and mab-3 related transcription factor 3 [Source:MGI Symbol;Acc:MGI:2449470])

HSP 1 Score: 50.447 bits (119), Expect = 2.040e-6
Identity = 20/41 (48.78%), Postives = 28/41 (68.29%), Query Frame = 3
Query:  363 QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            ++P C RCRNHG  +  KGHK+ CR  +C C+ C+LI  R+
Sbjct:   25 RTPKCARCRNHGVLSWLKGHKRYCRFKDCTCEKCILIIERQ 65          
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Match: sp|O18214|MAB3_CAEEL (Protein male abnormal 3 OS=Caenorhabditis elegans OX=6239 GN=mab-3 PE=1 SV=1)

HSP 1 Score: 58.151 bits (139), Expect = 2.269e-8
Identity = 32/98 (32.65%), Postives = 49/98 (50.00%), Query Frame = 3
Query:  207 HGQLLPVKNHRRNCPFKLCPCPLCTVVSHGRE----IVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKK-CRHSNCPCKLCLLITMRK 485
            HG+L P K H+ +C +  CPC  CT+V   R+    +  ++I      +    +  + PHC RC  HG     +GHK+  C+   C C LC L+  R+
Sbjct:   34 HGELKPRKGHKPDCRYLKCPCRECTMVEQRRQLNNLLSKKKIHCTPATQTRDGKRVRDPHCARCSAHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRR 131          

HSP 2 Score: 51.2174 bits (121), Expect = 4.079e-6
Identity = 23/47 (48.94%), Postives = 33/47 (70.21%), Query Frame = 3
Query:  204 AHGQLLPVKNHRRN-CPFKLCPCPLCTVVSHGREIVARQIRLYRNQK 341
            AHG L+P++ H+R  C F  C C LCT+V H R ++A QI+L R+Q+
Sbjct:   99 AHGVLVPLRGHKRTMCQFVTCECTLCTLVEHRRNLMAAQIKLRRSQQ 145          
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Match: sp|Q8CFG4|DMRTA_MOUSE (Doublesex- and mab-3-related transcription factor A1 OS=Mus musculus OX=10090 GN=Dmrta1 PE=2 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 4.610e-7
Identity = 31/89 (34.83%), Postives = 45/89 (50.56%), Query Frame = 3
Query:  273 LCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKS 539
            L +  S GR   A    L R    +    P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +   + ++  +E+S
Sbjct:   52 LRSTASSGRAGCAPGPGLDRALGAVGCGYPRTPKCARCRNHGVVSALKGHKRFCRWRDCACAKCTLIAERQRVMAAQVALRRQQAQEES 140          
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Match: sp|A4QNP7|DMTA2_XENTR (Doublesex- and mab-3-related transcription factor A2 OS=Xenopus tropicalis OX=8364 GN=dmrta2 PE=2 SV=1)

HSP 1 Score: 53.9138 bits (128), Expect = 9.322e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   40 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 108          
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Match: sp|Q2MJB4|DMTA2_XENLA (Doublesex- and mab-3-related transcription factor A2 OS=Xenopus laevis OX=8355 GN=dmrta2 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.155e-6
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   40 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 108          
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Match: sp|Q4AE28|DMTA2_TAKRU (Doublesex- and mab-3-related transcription factor A2 OS=Takifugu rubripes OX=31033 GN=dmrta2 PE=2 SV=1)

HSP 1 Score: 53.5286 bits (127), Expect = 1.156e-6
Identity = 23/46 (50.00%), Postives = 30/46 (65.22%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            S + P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+
Sbjct:   16 SDKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQ 61          
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Match: R4PJJ9 (Dmd-1 splice form 1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 581.637 bits (1498), Expect = 0.000e+0
Identity = 323/324 (99.69%), Postives = 323/324 (99.69%), Query Frame = 3
Query:   15 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLXXXXXXXXXXXXXXXXXXXXXXAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVXXXXXXXXXXXXXXAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY 986
            MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNV QHNSVEYLPTATPSWYSNFY
Sbjct:    1 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVSQHNSVEYLPTATPSWYSNFY 324          
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Match: R4PWS7 (Dmd-1 splice form 4 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 574.318 bits (1479), Expect = 0.000e+0
Identity = 324/341 (95.01%), Postives = 324/341 (95.01%), Query Frame = 3
Query:   15 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLXXXXXXXXXXXXXXXXXXXXXXAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVXXXXXXXXXXXXXXAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLY-----------------AQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY 986
            MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLY                 AQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY
Sbjct:    1 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYGYFQLIVWALVLIAFLLAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY 341          
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Match: R4PLD6 (Dmd-1 splice form 2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 498.049 bits (1281), Expect = 7.127e-176
Identity = 283/283 (100.00%), Postives = 283/283 (100.00%), Query Frame = 3
Query:   15 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLXXXXXXXXXXXXXXXXXXXXXXAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVXXXXXXXXXXXXXXAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHN 863
            MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHN
Sbjct:    1 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHN 283          
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Match: R4PU10 (Dmd-1 splice form 3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 286.96 bits (733), Expect = 4.138e-94
Identity = 163/163 (100.00%), Postives = 163/163 (100.00%), Query Frame = 3
Query:   15 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLXXXXXXXXXXXXXXXXXXXXXXAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY 503
            MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY
Sbjct:    1 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY 163          
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Match: A0A0R3U081 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS13504 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.182e-32
Identity = 64/132 (48.48%), Postives = 86/132 (65.15%), Query Frame = 3
Query:  204 AHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQK----------------------DISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEE 533
            AHG+L+ V+ H+RNCP+K C C +C++V++GR IVARQI LYR+QK                      D      + PHCRRCRNHG+ N WKGHKK C    C C+ C+LIT+RK+NEK+ RE+VQE+++E
Sbjct:  106 AHGRLIAVRQHKRNCPYKHCSCSVCSLVNYGRHIVARQIALYRDQKNNHNDEGGNLGRGSRGDKTRGADKIDSEDEGPHCRRCRNHGKTNPWKGHKKVCPFYYCICQQCILITLRKSNEKNLREVVQESYKE 237          
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Match: DMRTA1 (doublesex- and mab-3-related transcription factor A2 [Source:NCBI gene;Acc:103021351])

HSP 1 Score: 56.6102 bits (135), Expect = 1.338e-8
Identity = 26/79 (32.91%), Postives = 39/79 (49.37%), Query Frame = 3
Query:  312 RQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILV 548
            R   L R    + +  P++P C RCRNHG  +A KGHK+ CR   C C  C LI  R+    +   + ++  +E    +
Sbjct:   27 RAPLLLRAPAGLERAFPRTPKCARCRNHGVLSALKGHKRACRWRECACARCALIAERQRVMAAQVALRRQQEQESKTFI 105          
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Match: DMRTA1 (doublesex- and mab-3-related transcription factor A2 [Source:NCBI gene;Acc:103021351])

HSP 1 Score: 55.8398 bits (133), Expect = 1.890e-8
Identity = 25/58 (43.10%), Postives = 32/58 (55.17%), Query Frame = 3
Query:  312 RQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            R   L R    + +  P++P C RCRNHG  +A KGHK+ CR   C C  C LI  R+
Sbjct:   13 RAPLLLRAPAGLERAFPRTPKCARCRNHGVLSALKGHKRACRWRECACARCALIAERQ 70          
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Match: dmrta2 (DMRT like family A2 [Source:NCBI gene;Acc:103023395])

HSP 1 Score: 53.5286 bits (127), Expect = 1.392e-7
Identity = 26/69 (37.68%), Postives = 40/69 (57.97%), Query Frame = 3
Query:  348 SKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            +++ P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   54 AEKYPRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 122          
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Match: dmrt3a (doublesex and mab-3 related transcription factor 3 [Source:NCBI gene;Acc:103040280])

HSP 1 Score: 50.0618 bits (118), Expect = 1.605e-6
Identity = 24/56 (42.86%), Postives = 32/56 (57.14%), Query Frame = 3
Query:  324 LYRNQKDISKRSP--QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            LY        R+P  ++P C RCRNHG  +  KGHK+ CR  +C C  C+LI  R+
Sbjct:    9 LYVGGPVAQARAPLQRTPKCARCRNHGVLSWLKGHKRYCRFKDCTCDKCILIIERQ 64          
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Match: dmrt1 (doublesex- and mab-3-related transcription factor 1 [Source:NCBI gene;Acc:103041212])

HSP 1 Score: 49.2914 bits (116), Expect = 2.005e-6
Identity = 21/45 (46.67%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +R P+ P C RCRNHG  +  KGHK+ C   +C C+ C LI+ R+
Sbjct:   26 RRQPRMPKCSRCRNHGFVSPLKGHKRFCNWRDCQCQKCKLISERQ 70          
BLAST of Dmd-1 splice form 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004009.1 (pep scaffold:Pmarinus_7.0:GL483432:15080:15595:1 gene:ENSPMAG00000003668.1 transcript:ENSPMAT00000004009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 50.0618 bits (118), Expect = 5.750e-8
Identity = 23/59 (38.98%), Postives = 35/59 (59.32%), Query Frame = 3
Query:  363 QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKS 539
            ++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +   + ++  +E+S
Sbjct:   50 RTPKCARCRNHGVVSALKGHKRYCRWRDCLCAKCTLIAERQRVMAAQVALRRQQAQEES 108          
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Match: EDO45848 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRL3])

HSP 1 Score: 46.2098 bits (108), Expect = 3.252e-7
Identity = 22/43 (51.16%), Postives = 28/43 (65.12%), Query Frame = 3
Query:  357 SPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            S ++P C RCRNHG  ++ KGHK  CR  +C C  CLLI  R+
Sbjct:    8 SQRTPKCARCRNHGVCSSLKGHKYYCRWRDCLCTKCLLIAERQ 50          
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Match: EDO41281 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4Z8])

HSP 1 Score: 44.2838 bits (103), Expect = 1.265e-6
Identity = 20/39 (51.28%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  369 PHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            P C RCRNHG  +  KGHK+ CR  +C C  C LI  R+
Sbjct:    2 PKCARCRNHGVVSWLKGHKRYCRWRDCNCAQCTLIAERQ 40          
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Match: EDO37386 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFT8])

HSP 1 Score: 43.5134 bits (101), Expect = 2.630e-6
Identity = 21/39 (53.85%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  369 PHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            P C RCRNHG  +  KGHK  CR  +C C  CLLI  R+
Sbjct:    3 PKCARCRNHGALSWLKGHKHYCRWRDCTCSKCLLIAERQ 41          
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Match: EDO35744 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKL0])

HSP 1 Score: 43.5134 bits (101), Expect = 2.931e-6
Identity = 20/39 (51.28%), Postives = 24/39 (61.54%), Query Frame = 3
Query:  369 PHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            P C RCR+HG  +  KGHK  CR  +C C  C LIT R+
Sbjct:    3 PKCARCRSHGTVSWLKGHKHYCRWRDCTCSKCQLITERQ 41          
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Match: EDO36073 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJN2])

HSP 1 Score: 43.8986 bits (102), Expect = 3.437e-6
Identity = 20/41 (48.78%), Postives = 26/41 (63.41%), Query Frame = 3
Query:  363 QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            ++P C RCRNHG  +  KGHK  CR  +C C  C+LI  R+
Sbjct:   19 RTPKCARCRNHGFDSILKGHKGFCRWRDCMCPKCMLIAERQ 59          
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Match: dmrta2 (DMRT like family A2 [Source:NCBI gene;Acc:111947399])

HSP 1 Score: 53.1434 bits (126), Expect = 2.162e-7
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  360 PQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   52 PRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 116          
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Match: dmrta2 (DMRT like family A2 [Source:NCBI gene;Acc:111947399])

HSP 1 Score: 53.1434 bits (126), Expect = 2.162e-7
Identity = 26/65 (40.00%), Postives = 37/65 (56.92%), Query Frame = 3
Query:  360 PQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSY----REIVQETHEEKSI 542
            P++P C RCRNHG  +A KGHK+ CR  +C C  C LI  R+    +     R+  QE +E + +
Sbjct:   52 PRTPKCARCRNHGVVSALKGHKRYCRWKDCMCAKCTLIAERQRVMAAQVALRRQQAQEENEAREL 116          
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Match: dmy (Oryzias latipes doublesex- and mab-3-related transcription factor 1 (dmy), mRNA. [Source:RefSeq mRNA;Acc:NM_001104680])

HSP 1 Score: 51.9878 bits (123), Expect = 3.048e-7
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +RSP+ P C RCRNHG  +  KGHK+ CR  +C C  C LI  R+
Sbjct:   19 QRSPRMPKCSRCRNHGFVSPLKGHKRFCRWKDCRCAKCKLIAERQ 63          
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Match: dmy (Oryzias latipes doublesex- and mab-3-related transcription factor 1 (dmy), mRNA. [Source:RefSeq mRNA;Acc:NM_001104680])

HSP 1 Score: 51.6026 bits (122), Expect = 3.214e-7
Identity = 24/50 (48.00%), Postives = 30/50 (60.00%), Query Frame = 3
Query:  336 QKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +K    RSP+ P C RCRNHG  +  KGHK+ CR  +C C  C LI  R+
Sbjct:    4 EKQGRPRSPRMPKCSRCRNHGFVSPLKGHKRFCRWKDCRCAKCKLIAERQ 53          
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Match: dmy (Oryzias latipes doublesex- and mab-3-related transcription factor 1 (dmy), mRNA. [Source:RefSeq mRNA;Acc:NM_001104680])

HSP 1 Score: 51.6026 bits (122), Expect = 3.802e-7
Identity = 23/45 (51.11%), Postives = 29/45 (64.44%), Query Frame = 3
Query:  351 KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            +RSP+ P C RCRNHG  +  KGHK+ CR  +C C  C LI  R+
Sbjct:   19 QRSPRMPKCSRCRNHGFVSPLKGHKRFCRWKDCRCAKCKLIAERQ 63          
BLAST of Dmd-1 splice form 1 vs. Planmine SMEST
Match: SMESG000080385.1 (SMESG000080385.1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 324/324 (100.00%), Postives = 324/324 (100.00%), Query Frame = 3
Query:   15 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLXXXXXXXXXXXXXXXXXXXXXXAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVXXXXXXXXXXXXXXAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY 986
            MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY
Sbjct:    1 MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSRKKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRSKDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNSENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGGHNVFQHNSVEYLPTATPSWYSNFY 324          
BLAST of Dmd-1 splice form 1 vs. Planmine SMEST
Match: SMESG000002896.1 (SMESG000002896.1)

HSP 1 Score: 98.2117 bits (243), Expect = 8.752e-23
Identity = 51/138 (36.96%), Postives = 68/138 (49.28%), Query Frame = 3
Query:  204 AHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVARQIRLYRNQKDIS-----------------------------------KRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREI 512
             HG+L+PVK H+R C +  C C  C +V  GR++VA+QI LYR+Q+ I                                    K +   PHCRRCRNH     WK HKK C + +CPC  C LI +RK  EK+ R++
Sbjct:   46 VHGKLVPVKRHKRTCLYLHCKCIKCLLVDQGRKVVAKQIALYRDQRHIGTEDRHSSETQDQRLVSFKEYRLRGTTASVKTNVSDKDAGMGPHCRRCRNHNVTVIWKNHKKSCPYRHCPCDPCRLINVRKDTEKTLRDM 183          
BLAST of Dmd-1 splice form 1 vs. Planmine SMEST
Match: SMESG000075920.1 (SMESG000075920.1)

HSP 1 Score: 47.7506 bits (112), Expect = 5.643e-6
Identity = 20/41 (48.78%), Postives = 26/41 (63.41%), Query Frame = 3
Query:  363 QSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRK 485
            ++P C RCRNHG  +  KGHK+ CR  +C C  C LI  R+
Sbjct:   50 RTPKCARCRNHGYVSPLKGHKRYCRWKDCVCAKCALIAERQ 90          
BLAST of Dmd-1 splice form 1 vs. Planmine SMEST
Match: SMESG000006521.1 (SMESG000006521.1)

HSP 1 Score: 47.7506 bits (112), Expect = 8.616e-6
Identity = 22/68 (32.35%), Postives = 37/68 (54.41%), Query Frame = 3
Query:  345 ISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLCLLITMRKTNEKSYREIVQETHEEKSILV 548
            I+++  + P C RCRNHG  +  KGHK+ C + +C C  C LI  R+    +   + ++   E +I +
Sbjct:   34 ITEKGARKPKCARCRNHGMVSWLKGHKRHCHYKDCRCAKCNLIAERQRVMAAQVALKRQQAAEDAIAI 101          
The following BLAST results are available for this feature:
BLAST of Dmd-1 splice form 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DMRTA14.066e-740.00DMRT like family A1 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DMRTA24.491e-737.68DMRT like family A2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DMRTA24.491e-737.68DMRT like family A2 [Source:HGNC Symbol;Acc:HGNC:1... [more]
DMRT15.542e-752.17doublesex and mab-3 related transcription factor 1... [more]
DMRT33.147e-648.78doublesex and mab-3 related transcription factor 3... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab-31.784e-932.65Protein male abnormal 3 [Source:UniProtKB/Swiss-P... [more]
dmd-52.379e-743.86DM (Doublesex/MAB-3) Domain family [Source:UniPro... [more]
dmd-81.463e-627.64DM (Doublesex/MAB-3) Domain family [Source:UniPro... [more]
dmd-81.463e-627.64DM (Doublesex/MAB-3) Domain family [Source:UniPro... [more]
dmd-102.076e-644.44DM (Doublesex/MAB-3) Domain family [Source:UniPro... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dmrt99B5.406e-737.50gene:FBgn0039683 transcript:FBtr0085454[more]
dmrt93B4.477e-637.68gene:FBgn0038851 transcript:FBtr0084007[more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmrta22.065e-737.68DMRT-like family A2 [Source:NCBI gene;Acc:474350][more]
dmrt2b7.265e-739.06doublesex and mab-3 related transcription factor 2... [more]
dmrt2b7.265e-739.06doublesex and mab-3 related transcription factor 2... [more]
dmrt2b7.397e-739.06doublesex and mab-3 related transcription factor 2... [more]
dmrt3a1.245e-642.86doublesex and mab-3 related transcription factor 3... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
dynll11.760e-737.68dynein light chain LC8-type 1 [Source:Xenbase;Acc:... [more]
dmrta18.389e-752.38DMRT like family A1 [Source:NCBI gene;Acc:779901][more]
DMRT19.183e-751.11doublesex and mab-3 related transcription factor 1... [more]
st3gal41.384e-642.86ST3 beta-galactoside alpha-2,3-sialyltransferase 4... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dmrta16.591e-834.83doublesex and mab-3 related transcription factor l... [more]
Dmrta23.583e-738.24doublesex and mab-3 related transcription factor l... [more]
Dmrt14.730e-751.11doublesex and mab-3 related transcription factor 1... [more]
Dmrt19.483e-736.36doublesex and mab-3 related transcription factor 1... [more]
Dmrt32.040e-648.78doublesex and mab-3 related transcription factor 3... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O18214|MAB3_CAEEL2.269e-832.65Protein male abnormal 3 OS=Caenorhabditis elegans ... [more]
sp|Q8CFG4|DMRTA_MOUSE4.610e-734.83Doublesex- and mab-3-related transcription factor ... [more]
sp|A4QNP7|DMTA2_XENTR9.322e-737.68Doublesex- and mab-3-related transcription factor ... [more]
sp|Q2MJB4|DMTA2_XENLA1.155e-637.68Doublesex- and mab-3-related transcription factor ... [more]
sp|Q4AE28|DMTA2_TAKRU1.156e-650.00Doublesex- and mab-3-related transcription factor ... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R4PJJ90.000e+099.69Dmd-1 splice form 1 OS=Schmidtea mediterranea OX=7... [more]
R4PWS70.000e+095.01Dmd-1 splice form 4 OS=Schmidtea mediterranea OX=7... [more]
R4PLD67.127e-176100.00Dmd-1 splice form 2 OS=Schmidtea mediterranea OX=7... [more]
R4PU104.138e-94100.00Dmd-1 splice form 3 OS=Schmidtea mediterranea OX=7... [more]
A0A0R3U0814.182e-3248.48Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DMRTA11.338e-832.91doublesex- and mab-3-related transcription factor ... [more]
DMRTA11.890e-843.10doublesex- and mab-3-related transcription factor ... [more]
dmrta21.392e-737.68DMRT like family A2 [Source:NCBI gene;Acc:10302339... [more]
dmrt3a1.605e-642.86doublesex and mab-3 related transcription factor 3... [more]
dmrt12.005e-646.67doublesex- and mab-3-related transcription factor ... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000004009.15.750e-838.98pep scaffold:Pmarinus_7.0:GL483432:15080:15595:1 g... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO458483.252e-751.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412811.265e-651.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO373862.630e-653.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO357442.931e-651.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360733.437e-648.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dmrta22.162e-740.00DMRT like family A2 [Source:NCBI gene;Acc:11194739... [more]
dmrta22.162e-740.00DMRT like family A2 [Source:NCBI gene;Acc:11194739... [more]
dmy3.048e-751.11Oryzias latipes doublesex- and mab-3-related trans... [more]
dmy3.214e-748.00Oryzias latipes doublesex- and mab-3-related trans... [more]
dmy3.802e-751.11Oryzias latipes doublesex- and mab-3-related trans... [more]
back to top
BLAST of Dmd-1 splice form 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000080385.10.000e+0100.00SMESG000080385.1[more]
SMESG000002896.18.752e-2336.96SMESG000002896.1[more]
SMESG000075920.15.643e-648.78SMESG000075920.1[more]
SMESG000006521.18.616e-632.35SMESG000006521.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016325
GenBankAGL61623.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016325 ID=SMED30016325|Name=Dmd-1 splice form 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1012bp
TGTAGCATTAGAACATGAATTTAACTCAATGCCATTCGAAAATTAACGAT
TCTACCGGAAATTATTTGGAATTCAACCATTGCATTGTTGAAGATGATAA
AAGTGAAAATAATGAAGACGTCAAACCGAATTTACTGAAAAAAGAATATT
CTAGCAAATCGAGGAAAAAATCTCGTTCCTCATACATGTGTAGAAAATGT
CGAGCCCATGGCCAGTTGTTGCCGGTGAAAAACCATCGTCGAAATTGTCC
GTTTAAATTGTGTCCCTGTCCATTGTGTACAGTCGTTAGTCATGGTCGAG
AAATTGTCGCTCGTCAAATTAGACTTTATAGAAATCAGAAAGACATCAGC
AAAAGGTCTCCGCAATCACCACATTGTAGACGATGCAGAAATCATGGAGA
ACACAATGCTTGGAAAGGCCACAAAAAGAAATGTCGACATTCAAATTGTC
CCTGTAAATTGTGCCTGTTAATTACCATGAGAAAAACCAATGAAAAAAGT
TACAGAGAAATAGTTCAAGAAACTCACGAAGAGAAATCAATTTTAGTAAA
CAGCAACAATAATAGCAATAATAATAATAACAATAGTTCCGCATTCTGTC
TGTCAAACCGATCAAAAGACAGATCACTGGCAGAAGATCAGTCAGTTTTT
CTACGTAACATCAACCGAACTCCAATATTGCCAACGACAGGTTCGAATAT
CTACGACACCAGTCACAGCAGTTCGCTTTACGCTCAAAACTCAATGCTAA
ACTTTTCGAATTCCGAAAACTGCAACATTCGGCCCTTGAATTGGTCAACA
GCATCAGCCTATAAAGTTGGTTTACAGCCGTGGGACACTAACGGATCGTT
TGATATTCATAACAACGCCTCATATTGCGGCAGCTCACACCTGAACAACA
TGATGATTGGAGGTCATAACGTTTTCCAGCACAATTCCGTGGAATATCTA
CCAACGGCGACTCCATCTTGGTATTCAAATTTTTATTGAGATTGACTGGA
AATCTAACACGG
back to top

protein sequence of SMED30016325-orf-1

>SMED30016325-orf-1 ID=SMED30016325-orf-1|Name=SMED30016325-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=325bp
MNLTQCHSKINDSTGNYLEFNHCIVEDDKSENNEDVKPNLLKKEYSSKSR
KKSRSSYMCRKCRAHGQLLPVKNHRRNCPFKLCPCPLCTVVSHGREIVAR
QIRLYRNQKDISKRSPQSPHCRRCRNHGEHNAWKGHKKKCRHSNCPCKLC
LLITMRKTNEKSYREIVQETHEEKSILVNSNNNSNNNNNNSSAFCLSNRS
KDRSLAEDQSVFLRNINRTPILPTTGSNIYDTSHSSSLYAQNSMLNFSNS
ENCNIRPLNWSTASAYKVGLQPWDTNGSFDIHNNASYCGSSHLNNMMIGG
HNVFQHNSVEYLPTATPSWYSNFY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000206penis papilla
PLANA:0000207sperm duct
PLANA:0000208testis
PLANA:0000234seminal vesicle
PLANA:0000419prepharyngeal region
PLANA:0000463cholinergic neuron
PLANA:0002016cephalic ganglia neuron
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003304testis primordium
PLANA:0004506testis somatic gonadal cell
Vocabulary: INTERPRO
TermDefinition
IPR036407DM_DNA-bd_sf
IPR026607DMRT/dsx/mab-3
IPR001275DM_DNA-bd
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001275DM DNA-binding domainSMARTSM00301DM_3coord: 55..108
e-value: 2.4E-12
score: 57.0
coord: 117..166
e-value: 2.7E-5
score: 33.6
IPR001275DM DNA-binding domainPFAMPF00751DMcoord: 118..158
e-value: 3.0E-12
score: 46.2
coord: 56..101
e-value: 3.5E-14
score: 52.4
IPR001275DM DNA-binding domainPROSITEPS40000DM_1coord: 59..88
IPR001275DM DNA-binding domainPROSITEPS40000DM_1coord: 121..150
IPR001275DM DNA-binding domainPROSITEPS50809DM_2coord: 121..165
score: 10.483
IPR001275DM DNA-binding domainPROSITEPS50809DM_2coord: 59..106
score: 11.278
IPR036407DM DNA-binding domain superfamilyGENE3DG3DSA:4.10.1040.10coord: 111..161
e-value: 3.3E-14
score: 54.3
coord: 51..101
e-value: 1.4E-13
score: 52.3
IPR036407DM DNA-binding domain superfamilySUPERFAMILYSSF82927Cysteine-rich DNA binding domain, (DM domain)coord: 116..158
IPR036407DM DNA-binding domain superfamilySUPERFAMILYSSF82927Cysteine-rich DNA binding domain, (DM domain)coord: 54..99
IPR026607DMRT/protein doublesex/protein male abnormal 3PANTHERPTHR12322DOUBLESEX AND MAB-3 RELATED TRANSCRIPTION FACTOR DMRTcoord: 45..110
coord: 111..217