Septin

Overview
NameSeptin
Smed IDSMED30016322
Length (bp)1705
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin (SMED30016322) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin (SMED30016322) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin (SMED30016322) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin (SMED30016322) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016322

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 19

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig27686uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig27686newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig4862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig4862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig54319newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig54319uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig22937uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0004112 Contig22937newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
protonephridiaSMED30016322h1SMcG0004112 dd_Smed_v4_1198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016322h1SMcG0004112 dd_Smed_v4_1198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016322h1SMcG0004112 dd_Smed_v4_1198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016322h1SMcG0004112 dd_Smed_v4_1198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0011682 Contig4862uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016322h1SMcG0011682 Contig4862newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parenchymal cellSMED30016322h1SMcG0004112 dd_Smed_v6_1198_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
testisSMED30016322h1SMcG0004112 Contig4862uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016322h1SMcG0004112 Contig4862newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016322h1SMcG0011682 Contig4862uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
testisSMED30016322h1SMcG0011682 Contig4862newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 382.104 bits (980), Expect = 2.051e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 416          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 380.948 bits (977), Expect = 2.758e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 396          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 347.051 bits (889), Expect = 1.550e-114
Identity = 185/378 (48.94%), Postives = 257/378 (67.99%), Query Frame = 1
Query:  400 MVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            MVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:    1 MVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 363          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 343.199 bits (879), Expect = 7.496e-113
Identity = 183/380 (48.16%), Postives = 256/380 (67.37%), Query Frame = 1
Query:  394 NLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            N   +G SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   16 NSSTMGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 380          
BLAST of Septin vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 301.597 bits (771), Expect = 5.687e-96
Identity = 169/415 (40.72%), Postives = 248/415 (59.76%), Query Frame = 1
Query:  172 RPYERKGSNVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNID--NSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENL-PPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAK---------------DSQF---GVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQ 1353
            RP  R  S+ N      P    P         S +P++P G +D  +S     + +GF  LP+Q++R+S+  GF+F LMV G SGLGKST VN+LFL++LY +  L    +R  +TV I    V+I E  V L+LT++DTPGFGD+V+N+ECW PV +YI+ ++ +Y   ++ ++R  I DNRVH CLYFI P GHGL+ LD+EFMK +H +VNI+PI+AKADTL P E    K+ I  +I+  GIKIY FP+            +  +   +D  +K +  PFAV+ SN V+E  G +VRGR YPWG+VEV+N  H DF  LRT+L+ +H+QD+KD T +  +ENYR + + +  +                + F    V  G DP  + ++  RE + ++R+M+E +H + +Q
Sbjct:   60 RPPSRPQSSDNQQYFCAPAPLSP---------SARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPD--------CDSDEDEDFKLQDQALK-ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP--ETEKLIREKDEELRRMQEMLHKIQKQ 454          
BLAST of Septin vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 315.079 bits (806), Expect = 1.315e-101
Identity = 163/377 (43.24%), Postives = 238/377 (63.13%), Query Frame = 1
Query:  334 GFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSEL--YNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRN-RIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEI 1455
            GF N P+Q++RR++ NGF+F LMVVG SGLGKSTF+NTLFL+E+   N +   PT     TV +    V + ENSVSL LTL+DTPGFGD+V+NS+CW P++ Y+ESK+ E    + R+ R  +IVD  VH CLYFIEP+GHGLK +D+E MK +H +VNI+P+I+KAD L  +E   FKK I+   +T  IK+Y FPE     +  V + K            RK  PFA++ SN++ EK G K+R R YPWG VEV+N++HNDF  LR +++ ++L D+ D T  V +EN+R  QM    K+ +      +DP + ++EE+R+ E  + +    +  +F +K S + ++ +E    +E  E+   Q+++    EI
Sbjct:   29 GFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRGEKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFPELEDPYTDKVAIEKL-----------RKALPFAIIGSNMLKEKDGKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKNEK-----NRDPFTHLEEERRQKEQDLDEKRNTLEKVFTEKTSARKKRSDERMSALEELEQQNKQKIDAKRAEI 389          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 221.861 bits (564), Expect = 7.848e-66
Identity = 149/426 (34.98%), Postives = 232/426 (54.46%), Query Frame = 1
Query:  259 EPKSVKPKTPS-----GNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHR--NRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCS-NIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKL-EEFQQTIERTERDMVQQLENDI--KEIEYKRN-NFEAQRLAWE 1500
            +P    P  PS      +     M+L  ++GF++LP Q+ ++++  GF+FNLM VG +G GK+T + +LF  +L    +  P     KTV + T T ++ E  + +KL L++T GFGD +D  +    ++ Y+ES++  Y+  + +  R      D+R+HACLYFI PTGHGLK LDL  ++ +  +VN+IP+IAK+DT   +E   FK  IL+++K+  I IY FP +   +S          T  K++    K  PFAVV S + V ++ G  VR R YPWG+VEV+N  H DF  LR  LL +++ +++  T + L+ENYR +++       Q  + DG            E   KI +     H   Q + S +   L EEFQ+ ++ TE DM +++E  +  +E E   N N EA +L  E
Sbjct:   51 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKL----DFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVS----------TTNKEMN---KSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRL------RQMKIGDG------------ETGPKIIEKLAQKHREHQDEFSRRELTLREEFQKKLDVTEGDM-RKVEEGLAAREREVHENYNREASKLDME 440          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 221.861 bits (564), Expect = 1.045e-65
Identity = 148/426 (34.74%), Postives = 233/426 (54.69%), Query Frame = 1
Query:  259 EPKSVKPKTPS-----GNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHR--NRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCS-NIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKL-EEFQQTIERTERDMVQQLENDI--KEIEYKRN-NFEAQRLAWE 1500
            +P    P  PS      +     M+L  ++GF++LP Q+ ++++  GF+FNLM VG +G GK+T + +LF  +L    +  P     KTV + T T ++ E  + +KL L++T GFGD +D  +    ++ Y+ES++  Y+  + +  R      D+R+HACLYFI PTGHGLK LDL  ++ +  +VN+IP+IAK+DT   +E   FK  IL+++K+  I IY FP +   +S          T  K++    K  PFAVV S + V ++ G  VR R YPWG+VEV+N  H DF  LR  LL +++ +++  T + L+ENYR +++       Q  + DG        E   +   K+ +     H   Q + S +   L EEFQ+ ++ TE DM +++E  +  +E E   N N EA +L  E
Sbjct:   51 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKL----DFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVS----------TTNKEMN---KSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRL------RQMKIGDG--------ETGPKIIEKLAQRRLQKHREHQDEFSRRELTLREEFQKKLDVTEGDM-RKVEEGLAAREREVHENYNREASKLDME 444          
BLAST of Septin vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 222.246 bits (565), Expect = 2.639e-65
Identity = 149/426 (34.98%), Postives = 232/426 (54.46%), Query Frame = 1
Query:  259 EPKSVKPKTPS-----GNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHR--NRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCS-NIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKL-EEFQQTIERTERDMVQQLENDI--KEIEYKRN-NFEAQRLAWE 1500
            +P    P  PS      +     M+L  ++GF++LP Q+ ++++  GF+FNLM VG +G GK+T + +LF  +L    +  P     KTV + T T ++ E  + +KL L++T GFGD +D  +    ++ Y+ES++  Y+  + +  R      D+R+HACLYFI PTGHGLK LDL  ++ +  +VN+IP+IAK+DT   +E   FK  IL+++K+  I IY FP +   +S          T  K++    K  PFAVV S + V ++ G  VR R YPWG+VEV+N  H DF  LR  LL +++ +++  T + L+ENYR +++       Q  + DG            E   KI +     H   Q + S +   L EEFQ+ ++ TE DM +++E  +  +E E   N N EA +L  E
Sbjct:  120 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKL----DFEPCNHELKTVELRTCTKDVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPTDDETVS----------TTNKEMN---KSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYRRDRL------RQMKIGDG------------ETGPKIIEKLAQKHREHQDEFSRRELTLREEFQKKLDVTEGDM-RKVEEGLAAREREVHENYNREASKLDME 509          
BLAST of Septin vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088792)

HSP 1 Score: 396.356 bits (1017), Expect = 6.148e-132
Identity = 217/483 (44.93%), Postives = 308/483 (63.77%), Query Frame = 1
Query:  109 NGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIE------PKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLP-PTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG------KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRET 1518
            NG +G E+++      +PP + P     ++     +    +    N+LT +       ++ KP+ P   +    M +   +GF NLP+Q+YR+++  GFEF LMVVG SGLGKST +N++FLS++YN E  P P+ R +KTV +  T V + EN V+L LT++DTPGFGD+VDNS CW P+L+Y++SKY EY+ A++RV+R  I D+RVH CLYFI P+GHGL  LD+  M+ +  KVN++P+IAKADT+ P+E   FKK ILN+I  + IKIYDFP          T+  A E   K     R R PFAVV +N +IE+ G KVRGR YPWGLVEV+NL H DF ALR +++ +HLQD+KD T+ V +ENYRC ++      S+ G+ DG      K+P++QM+EEKRE E K++KME +M  +F  KV EK +KL + +  + R   +  + LE  I+E+E KR  FE ++  WE+ N  T
Sbjct:   45 NGSSGSESLVGVG--GRPPNQPPSVPVAASGKLDTSGGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFP---------ATLEDAAE-EAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKL------SELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVNHVT 509          
BLAST of Septin vs. Ensembl Fly
Match: pnut (gene:FBgn0013726 transcript:FBtr0088793)

HSP 1 Score: 396.356 bits (1017), Expect = 6.148e-132
Identity = 217/483 (44.93%), Postives = 308/483 (63.77%), Query Frame = 1
Query:  109 NGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIE------PKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLP-PTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG------KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRET 1518
            NG +G E+++      +PP + P     ++     +    +    N+LT +       ++ KP+ P   +    M +   +GF NLP+Q+YR+++  GFEF LMVVG SGLGKST +N++FLS++YN E  P P+ R +KTV +  T V + EN V+L LT++DTPGFGD+VDNS CW P+L+Y++SKY EY+ A++RV+R  I D+RVH CLYFI P+GHGL  LD+  M+ +  KVN++P+IAKADT+ P+E   FKK ILN+I  + IKIYDFP          T+  A E   K     R R PFAVV +N +IE+ G KVRGR YPWGLVEV+NL H DF ALR +++ +HLQD+KD T+ V +ENYRC ++      S+ G+ DG      K+P++QM+EEKRE E K++KME +M  +F  KV EK +KL + +  + R   +  + LE  I+E+E KR  FE ++  WE+ N  T
Sbjct:   45 NGSSGSESLVGVG--GRPPNQPPSVPVAASGKLDTSGGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFP---------ATLEDAAE-EAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKL------SELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVNHVT 509          
BLAST of Septin vs. Ensembl Fly
Match: Sep1 (gene:FBgn0011710 transcript:FBtr0077198)

HSP 1 Score: 291.197 bits (744), Expect = 1.677e-93
Identity = 147/344 (42.73%), Postives = 221/344 (64.24%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXX-XENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQ-PFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD---------PMSQMDEEKREFEAKIRKMEE 1329
            +GF NLP+Q++R+S+  GFEF LMVVG SGLGKST VN+LFL++LY    +P     QK       +     E  V L+LT++DTPGFGD++DNS  +  +L+YI+ +Y  ++  ++ ++R  IVDNR+H C YFI P GHGLK LD+EFMK++H+KVNI+P+IAKAD L  +E    K  I+ +I+++GIKIY  P+               + ++K+   + K   PFAV  +N ++E  G KVRGR YPWG+VEV+N +H DF  LRT+L+ +H+QD+++ T +V +ENYR ++++   K  + GV   +D          + + D   +E EA++R+M+E
Sbjct:   16 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLVNSLFLTDLYPERIIPDAIEKQKQTVKLEASTVEIEERGVKLRLTVVDTPGFGDAIDNSNSFGAILEYIDEQYERFLRDESGLNRRNIVDNRIHCCFYFISPFGHGLKPLDVEFMKKLHSKVNIVPVIAKADCLTKKEILRLKCRIMQEIESHGIKIYPLPD----------CDSDEDEDYKEQVKQLKEAVPFAVCGANTLLEVKGKKVRGRLYPWGVVEVENPDHCDFIKLRTMLI-THMQDLQEVTQEVHYENYRSDRLAKGIKGKENGVKAERDSSSQVVSNSVLGEKDRILQEKEAELRRMQE 348          
BLAST of Septin vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074368)

HSP 1 Score: 288.5 bits (737), Expect = 1.295e-91
Identity = 164/431 (38.05%), Postives = 250/431 (58.00%), Query Frame = 1
Query:  196 NVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTK-RTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQ-PFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKE---IEYKRNN 1473
            N ++S  +E    +P       P   KPKTPS + D         IGF  LP+Q++R+S+  GFEF LMVVG SGLGKST +N+LFL +LY N  +P  + R +KT  +   T++I E  V L+LT++DTPGFGD+++  + W    +YI+ ++ +Y   ++ ++R  I DNRVH CLYF+ P GH L+Q+DL+ ++R+H KVNI+ +I KAD L  +E  + K+ IL  ++ N I++Y FPE               + ++K    + K   PFAVV SN ++E  G KVRGR YPWG+V V++ EH+DF  LRT L+S+H+QD+KDTT  V +EN+R +                   +SQ+ +       K+++      N F   +SE  R L +  + I R + DM+ Q++  +K+   +E K+N+
Sbjct:   34 NGSSSSGIEAVKCRP-------PIYPKPKTPSFDKDRD------YIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPE----------CDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQ------------------CISQISQHALRERGKLKRDSISSTNGFDAAISETDRLLLQKDEEIRRMQ-DMLTQMQEKLKQTHLMEMKKND 422          
BLAST of Septin vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074366)

HSP 1 Score: 288.5 bits (737), Expect = 1.295e-91
Identity = 164/431 (38.05%), Postives = 250/431 (58.00%), Query Frame = 1
Query:  196 NVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTK-RTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQ-PFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKE---IEYKRNN 1473
            N ++S  +E    +P       P   KPKTPS + D         IGF  LP+Q++R+S+  GFEF LMVVG SGLGKST +N+LFL +LY N  +P  + R +KT  +   T++I E  V L+LT++DTPGFGD+++  + W    +YI+ ++ +Y   ++ ++R  I DNRVH CLYF+ P GH L+Q+DL+ ++R+H KVNI+ +I KAD L  +E  + K+ IL  ++ N I++Y FPE               + ++K    + K   PFAVV SN ++E  G KVRGR YPWG+V V++ EH+DF  LRT L+S+H+QD+KDTT  V +EN+R +                   +SQ+ +       K+++      N F   +SE  R L +  + I R + DM+ Q++  +K+   +E K+N+
Sbjct:   34 NGSSSSGIEAVKCRP-------PIYPKPKTPSFDKDRD------YIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPE----------CDSDEDDDFKQQDRELKASIPFAVVGSNTILEVAGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQ------------------CISQISQHALRERGKLKRDSISSTNGFDAAISETDRLLLQKDEEIRRMQ-DMLTQMQEKLKQTHLMEMKKND 422          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 384.415 bits (986), Expect = 1.023e-128
Identity = 196/413 (47.46%), Postives = 280/413 (67.80%), Query Frame = 1
Query:  286 PSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG----KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            P   + +    L   +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ ++++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+               + + K I   +++ P AVV SN+VIE  G KVRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR ++++    +      +     K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:    5 PDSAVSSVARNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTED------------DEDSKLIRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQQR 405          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept15 (septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265])

HSP 1 Score: 384.03 bits (985), Expect = 1.648e-128
Identity = 194/398 (48.74%), Postives = 276/398 (69.35%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG----KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ ++++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+               + + K I   +++ P AVV SN+VIE  G KVRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR ++++    +      +     K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKFEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTED------------DEDSKLIRKIKEKMPLAVVGSNVVIEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDATKNKGQLTKSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKKNLEAQYKELEEKRRQFEDEKANWEAQQR 406          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 382.874 bits (982), Expect = 5.731e-128
Identity = 201/428 (46.96%), Postives = 288/428 (67.29%), Query Frame = 1
Query:  250 LTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            ++I  +SV     S N    +  L   +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY++E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ D+RVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E   K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+R+  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++ +W+   R
Sbjct:    1 MSIGERSVTEAAGSVNRMEQQKNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDD------------EEESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKIQKLKDSEGELQRRHEQMKKNLEAQHKELEEKRRQFEEEKASWDAQQR 413          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 381.719 bits (979), Expect = 1.693e-127
Identity = 194/405 (47.90%), Postives = 278/405 (68.64%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY++E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ D+RVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E   K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + ++    +G  P++QM+EE+R+  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++ +W+   R
Sbjct:   29 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSSEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPETDD------------EEESKLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKPDTVEGMSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKIQKLKDSEGELQRRHEQMKKNLEAQHKELEEKRRQFEEEKASWDAQQR 421          
BLAST of Septin vs. Ensembl Zebrafish
Match: sept7b (septin 7b [Source:ZFIN;Acc:ZDB-GENE-030131-37])

HSP 1 Score: 327.02 bits (837), Expect = 4.834e-107
Identity = 182/375 (48.53%), Postives = 255/375 (68.00%), Query Frame = 1
Query:  400 MVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            MVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V + E  V L L+++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ D+RVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I  + IKIY+FPE               E N    TIK  R P AVV SN +IE  G KVRGR YPWG+ EV+N +H DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    N   +++      K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E +R  FE +R  WE   R
Sbjct:    1 MVVGESGLGKSTLINSLFLTDLYSGEYPGPSNRIKKTVQVEQSKVLMKEGGVQLLLSIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMREILEHKIKIYEFPE-----------TDDEEENKIVKTIK-DRLPLAVVGSNTIIEANGKKVRGRQYPWGVAEVENGDHCDFTLLRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCNGIDNNKAKGQLTKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEGELQRRHEQMKKNLEAQHKELEERRRQFEEERSTWETQQR 363          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 384.8 bits (987), Expect = 1.075e-128
Identity = 198/405 (48.89%), Postives = 277/405 (68.40%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY  +   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   +   P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + +++   +G  P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++L WE   R
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQR 403          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 383.259 bits (983), Expect = 5.302e-128
Identity = 198/405 (48.89%), Postives = 277/405 (68.40%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY  +   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   +   P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + +++   +G  P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++L WE   R
Sbjct:   18 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQR 410          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 382.874 bits (982), Expect = 5.519e-128
Identity = 201/412 (48.79%), Postives = 281/412 (68.20%), Query Frame = 1
Query:  298 IDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +   K+ L+  +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY  +   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   +   P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++L WE   R
Sbjct:    2 LTGCKISLLSYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQR 398          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 383.645 bits (984), Expect = 5.599e-128
Identity = 198/405 (48.89%), Postives = 277/405 (68.40%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY  +   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   +   P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + +++   +G  P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++L WE   R
Sbjct:   20 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQR 412          
BLAST of Septin vs. Ensembl Xenopus
Match: SEPTIN7 (septin 7 [Source:NCBI gene;Acc:100216295])

HSP 1 Score: 383.259 bits (983), Expect = 5.720e-128
Identity = 198/405 (48.89%), Postives = 277/405 (68.40%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY  +   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   +   P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + +++   +G  P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++L WE   R
Sbjct:   18 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYAPDYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDGLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGVDNNKNKGQLTKYDTVEGMSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKLNWETQQR 410          
BLAST of Septin vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 382.104 bits (980), Expect = 1.278e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQR 416          
BLAST of Septin vs. Ensembl Mouse
Match: Sept7 (septin 7 [Source:MGI Symbol;Acc:MGI:1335094])

HSP 1 Score: 381.719 bits (979), Expect = 2.012e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQR 416          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 297.36 bits (760), Expect = 1.724e-94
Identity = 162/383 (42.30%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  268 SVKPKTPSGNID--NSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENL-PPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAK---------------DSQF---GVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQ 1353
            S +P++P G +D  +S     + +GF  LP+Q++R+S+  GF+F LMV G SGLGKST VN+LFL++LY +  L    +R  +TV I    V+I E  V L+LT++DTPGFGD+V+N+ECW PV +YI+ ++ +Y   ++ ++R  I DNRVH CLYFI P GHGL+ LD+EFMK +H +VNI+PI+AKADTL P E    K  I  +I+  GIKIY FP+            +  +   +D  +K +  PFAV+ SN V+E  G +VRGR YPWG+VEV+N  H DF  LRT+L+ +H+QD+KD T +  +ENYR + + +  +                + F    V  G DP  + ++  RE + ++R+M+E +H + +Q
Sbjct:   83 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPD--------CDSDEDEDFKLQDQALK-ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP--ETEKLIREKDEELRRMQEMLHKIQRQ 454          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 297.36 bits (760), Expect = 3.668e-94
Identity = 162/383 (42.30%), Postives = 239/383 (62.40%), Query Frame = 1
Query:  268 SVKPKTPSGNID--NSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENL-PPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAK---------------DSQF---GVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQ 1353
            S +P++P G +D  +S     + +GF  LP+Q++R+S+  GF+F LMV G SGLGKST VN+LFL++LY +  L    +R  +TV I    V+I E  V L+LT++DTPGFGD+V+N+ECW PV +YI+ ++ +Y   ++ ++R  I DNRVH CLYFI P GHGL+ LD+EFMK +H +VNI+PI+AKADTL P E    K  I  +I+  GIKIY FP+            +  +   +D  +K +  PFAV+ SN V+E  G +VRGR YPWG+VEV+N  H DF  LRT+L+ +H+QD+KD T +  +ENYR + + +  +                + F    V  G DP  + ++  RE + ++R+M+E +H + +Q
Sbjct:  102 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPD--------CDSDEDEDFKLQDQALK-ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP--ETEKLIREKDEELRRMQEMLHKIQRQ 473          
BLAST of Septin vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 291.582 bits (745), Expect = 2.633e-93
Identity = 156/360 (43.33%), Postives = 227/360 (63.06%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENL-PPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAK---------------DSQF---GVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQ 1353
            +GF  LP+Q++R+S+  GF+F LMV G SGLGKST VN+LFL++LY +  L    +R  +TV I    V+I E  V L+LT++DTPGFGD+V+N+ECW PV +YI+ ++ +Y   ++ ++R  I DNRVH CLYFI P GHGL+ LD+EFMK +H +VNI+PI+AKADTL P E    K  I  +I+  GIKIY FP+            +  +   +D  +K +  PFAV+ SN V+E  G +VRGR YPWG+VEV+N  H DF  LRT+L+ +H+QD+KD T +  +ENYR + + +  +                + F    V  G DP  + ++  RE + ++R+M+E +H + +Q
Sbjct:   26 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPD--------CDSDEDEDFKLQDQALK-ESIPFAVIGSNTVVEARGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRLVVKERNRNKLTRESGTDFPIPAVPPGTDP--ETEKLIREKDEELRRMQEMLHKIQRQ 374          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|P40797|PNUT_DROME (Protein peanut OS=Drosophila melanogaster OX=7227 GN=pnut PE=1 SV=2)

HSP 1 Score: 396.356 bits (1017), Expect = 6.162e-131
Identity = 217/483 (44.93%), Postives = 308/483 (63.77%), Query Frame = 1
Query:  109 NGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIE------PKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLP-PTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG------KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRET 1518
            NG +G E+++      +PP + P     ++     +    +    N+LT +       ++ KP+ P   +    M +   +GF NLP+Q+YR+++  GFEF LMVVG SGLGKST +N++FLS++YN E  P P+ R +KTV +  T V + EN V+L LT++DTPGFGD+VDNS CW P+L+Y++SKY EY+ A++RV+R  I D+RVH CLYFI P+GHGL  LD+  M+ +  KVN++P+IAKADT+ P+E   FKK ILN+I  + IKIYDFP          T+  A E   K     R R PFAVV +N +IE+ G KVRGR YPWGLVEV+NL H DF ALR +++ +HLQD+KD T+ V +ENYRC ++      S+ G+ DG      K+P++QM+EEKRE E K++KME +M  +F  KV EK +KL + +  + R   +  + LE  I+E+E KR  FE ++  WE+ N  T
Sbjct:   45 NGSSGSESLVGVG--GRPPNQPPSVPVAASGKLDTSGGGASNGDSNKLTHDLQEKEHQQAQKPQKPPLPVRQKPMEIAGYVGFANLPNQVYRKAVKRGFEFTLMVVGASGLGKSTLINSMFLSDIYNAEQYPGPSLRKKKTVAVEATKVMLKENGVNLTLTVVDTPGFGDAVDNSNCWVPILEYVDSKYEEYLTAESRVYRKTISDSRVHCCLYFIAPSGHGLLPLDIACMQSLSDKVNLVPVIAKADTMTPDEVHLFKKQILNEIAQHKIKIYDFP---------ATLEDAAE-EAKTTQNLRSRVPFAVVGANTIIEQDGKKVRGRRYPWGLVEVENLTHCDFIALRNMVIRTHLQDLKDVTNNVHYENYRCRKL------SELGLVDGKARLSNKNPLTQMEEEKREHEQKMKKMEAEMEQVFDMKVKEKMQKLRDSELELARRHEERKKALELQIRELEEKRREFEREKKEWEDVNHVT 509          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q5R481|SEPT7_PONAB (Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 6.459e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 416          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q16181|SEPT7_HUMAN (Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 6.459e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 416          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q6Q137|SEPT7_BOVIN (Septin-7 OS=Bos taurus OX=9913 GN=SEPTIN7 PE=2 SV=2)

HSP 1 Score: 382.489 bits (981), Expect = 6.459e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   31 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQEHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEDEKANWEAQQR 416          
BLAST of Septin vs. UniProt/SwissProt
Match: sp|Q9WVC0|SEPT7_RAT (Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 PE=1 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 7.274e-127
Identity = 199/401 (49.63%), Postives = 276/401 (68.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKD-------PMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK+ +Y++A++RV+R ++ DNRV  CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +   GV + K+       P++QM+EE+RE  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   30 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDYIDSKFEDYLNAESRVNRRQMPDNRVQCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTLTPEECQQFKKQIMKEIQGHKIKIYEFPE-----------TDDEEEN-KLVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYN---GVDNNKNKGQLTKSPLAQMEEERREHVAKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKANWEAQQR 415          
BLAST of Septin vs. TrEMBL
Match: A0A232F702 (Septin-type G domain-containing protein OS=Trichomalopsis sarcophagae OX=543379 GN=TSAR_004404 PE=3 SV=1)

HSP 1 Score: 428.328 bits (1100), Expect = 6.670e-141
Identity = 204/391 (52.17%), Postives = 284/391 (72.63%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEE 1503
            +GF NLP+Q+YR+++  GFEF LMVVG SGLGKST +N+LFL+++Y+ E+  P+ R +KTV + T+ V + EN V+L LT++DTPGFGD+VDNS CW PV++YIE+KY E+++A++RV R +I D+RVH CLYF+ P+GHGLK LD+EFM+R+H KVNIIP+IAKADT+ P+ECA FKK ILN+I  + IKIY+FPE               E + K   + R R PFA+V +N VIE  G KVRGR YPWG+VEV+NLEHNDF ALR +++ +HLQD+KD T+ V +EN+RC  ++  + D +      K+P++QM+EEKRE E K++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE +R  WE+
Sbjct:   92 VGFANLPNQVYRKAVKKGFEFTLMVVGESGLGKSTMINSLFLTDIYSAEHPGPSLRMKKTVAVETSKVLLKENGVNLTLTIVDTPGFGDAVDNSNCWQPVIEYIENKYEEFLNAESRVMRRQIPDSRVHCCLYFVAPSGHGLKPLDVEFMQRLHDKVNIIPVIAKADTMTPDECAYFKKQILNEIAQHKIKIYEFPEAED------------EEDSKLHKVLRDRVPFAIVGANTVIEHDGKKVRGRKYPWGVVEVENLEHNDFIALRNMIIRTHLQDLKDVTNNVHYENFRCRTLAGLSVDGKPTRVSNKNPLAQMEEEKREHENKMKKMEIEMEQVFEMKVREKRQKLKDLETDLQRRHEQMRRSLEQQAKELEEKRRAFEGERSGWEQ 470          
BLAST of Septin vs. TrEMBL
Match: K7J489 (Septin-type G domain-containing protein OS=Nasonia vitripennis OX=7425 GN=100116362 PE=3 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 8.498e-141
Identity = 204/391 (52.17%), Postives = 284/391 (72.63%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEE 1503
            +GF NLP+Q+YR+++  GFEF LMVVG SGLGKST +N+LFL+++Y+ E+  P+ R +KTV + T+ V + EN V+L LT++DTPGFGD+VDNS CW PV++YIE+KY E+++A++RV R +I D+RVH CLYF+ P+GHGLK LD+EFM+R+H KVNIIP+IAKADT+ P+ECA FKK ILN+I  + IKIY+FPE               E + K   + R R PFA+V +N VIE  G KVRGR YPWG+VEV+NLEHNDF ALR +++ +HLQD+KD T+ V +EN+RC  ++  + D +      K+P++QM+EEKRE E K++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE +R  WE+
Sbjct:  262 VGFANLPNQVYRKAVKKGFEFTLMVVGESGLGKSTMINSLFLTDIYSAEHPGPSLRMKKTVAVETSKVLLKENGVNLTLTIVDTPGFGDAVDNSNCWQPVIEYIENKYEEFLNAESRVMRRQIPDSRVHCCLYFVAPSGHGLKPLDVEFMQRLHDKVNIIPVIAKADTMTPDECAYFKKQILNEIAQHKIKIYEFPE------------AEDEEDSKLHKVLRDRVPFAIVGANTVIEHDGKKVRGRKYPWGVVEVENLEHNDFIALRNMIIRTHLQDLKDVTNNVHYENFRCRTLAGLSVDGKPTRVSNKNPLAQMEEEKREHENKMKKMEIEMEQVFEMKVREKRQKLKDLETDLQRRHEQMRRSLEQQAKELEEKRRAFEGERSGWEQ 640          
BLAST of Septin vs. TrEMBL
Match: A0A2J7Q8E1 (Protein peanut (Fragment) OS=Cryptotermes secundus OX=105785 GN=pnut_1 PE=3 SV=1)

HSP 1 Score: 426.402 bits (1095), Expect = 8.835e-141
Identity = 202/393 (51.40%), Postives = 282/393 (71.76%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETN 1509
            +GF NLP+Q+YR+++  GF+F LMVVG SGLGKST +N++FL+++Y+ E   P+ R +KTV + TT V + EN V+L LT++DTPGFGD+VDNS CW PV+ YIESKY EY++A++RV+R  + DNRVH CLYFI P+GHGL  LD+EFM+R+H KVNIIP+IAK+DT+ P+EC+ FKK +LN+I  + IKIY+FP+               E   K   + R R PFAVV SN VIE  G K+RGR YPWG+ EV+NLEH DF ALR +L+ +HLQD+KD T+ V +ENYRC +++    D +      K+P++QM+EEKR+ EAK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE  I E+E KR  +E ++ AWE++N
Sbjct:   97 VGFANLPNQVYRKAVKKGFDFTLMVVGESGLGKSTLMNSMFLADIYSAEFPGPSHRIKKTVQVETTKVLLKENGVNLTLTVVDTPGFGDAVDNSNCWQPVIDYIESKYEEYLNAESRVNRRTLADNRVHCCLYFIAPSGHGLTPLDVEFMQRLHDKVNIIPVIAKSDTMTPDECSHFKKQVLNEISQHKIKIYEFPDTED------------EEETKLHKVLRDRVPFAVVGSNTVIEVDGKKIRGRKYPWGIAEVENLEHCDFIALRNMLIRTHLQDLKDVTNNVHYENYRCRKLAGLGTDGKPTRISNKNPLAQMEEEKRDHEAKMKKMESEMEQVFEMKVREKKQKLKDSEADLQRRHEQMKKALEQQINELEEKRRAYEKEKQAWEQSN 477          
BLAST of Septin vs. TrEMBL
Match: A0A2J7Q8F0 (Protein peanut (Fragment) OS=Cryptotermes secundus OX=105785 GN=pnut_1 PE=3 SV=1)

HSP 1 Score: 426.787 bits (1096), Expect = 9.233e-141
Identity = 203/396 (51.26%), Postives = 283/396 (71.46%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRET 1518
            +GF NLP+Q+YR+++  GF+F LMVVG SGLGKST +N++FL+++Y+ E   P+ R +KTV + TT V + EN V+L LT++DTPGFGD+VDNS CW PV+ YIESKY EY++A++RV+R  + DNRVH CLYFI P+GHGL  LD+EFM+R+H KVNIIP+IAK+DT+ P+EC+ FKK +LN+I  + IKIY+FP+               E   K   + R R PFAVV SN VIE  G K+RGR YPWG+ EV+NLEH DF ALR +L+ +HLQD+KD T+ V +ENYRC +++    D +      K+P++QM+EEKR+ EAK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE  I E+E KR  +E ++ AWE++N  T
Sbjct:   97 VGFANLPNQVYRKAVKKGFDFTLMVVGESGLGKSTLMNSMFLADIYSAEFPGPSHRIKKTVQVETTKVLLKENGVNLTLTVVDTPGFGDAVDNSNCWQPVIDYIESKYEEYLNAESRVNRRTLADNRVHCCLYFIAPSGHGLTPLDVEFMQRLHDKVNIIPVIAKSDTMTPDECSHFKKQVLNEISQHKIKIYEFPD------------TEDEEETKLHKVLRDRVPFAVVGSNTVIEVDGKKIRGRKYPWGIAEVENLEHCDFIALRNMLIRTHLQDLKDVTNNVHYENYRCRKLAGLGTDGKPTRISNKNPLAQMEEEKRDHEAKMKKMESEMEQVFEMKVREKKQKLKDSEADLQRRHEQMKKALEQQINELEEKRRAYEKEKQAWEQSNNVT 480          
BLAST of Septin vs. TrEMBL
Match: A0A1Z5LIM1 (Septin (Fragment) OS=Ornithodoros moubata OX=6938 PE=3 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 5.481e-139
Identity = 201/400 (50.25%), Postives = 292/400 (73.00%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG-----KDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRE 1515
            +GF +LPDQ+YR+++ NGFEF LMVVG SGLGKST +N++FL+++Y+NE   P+ R +KTV + TT V + E  V+L LT++DTPGFGD+VDN++CW P++ Y+ESKY EY+ A++RVHR+++ DNRVH CLYFI P+GHGLK L++EFMKR+H KVNIIPIIAKADT+ PEEC+ FK+TILN+I  N I++Y+FPE               + N K +   ++R PFAVV SN ++E  G +VRGR YPWG+ EV+N+EH DF ALR +L+ SH+ D+KD T  V +EN+RC +++        G TDG     K+P++QM+EEK++ +AK+++ME++M  +F+ KV EK +KL+E +  ++R    M + LE   +E+E KR +FE Q+ ++E T+++
Sbjct:  100 VGFASLPDQVYRKAIKNGFEFTLMVVGESGLGKSTLINSMFLTDIYSNEYPGPSHRVKKTVEVETTRVVLREGGVTLTLTIVDTPGFGDAVDNTQCWQPIIDYVESKYAEYLDAESRVHRSKVPDNRVHCCLYFIMPSGHGLKPLNIEFMKRLHDKVNIIPIIAKADTMTPEECSLFKRTILNEIAQNKIRLYEFPE-----------CDYDDEN-KHLKGLKERVPFAVVGSNTIVEVNGKRVRGRKYPWGVAEVENMEHCDFIALRNMLIRSHMHDLKDITHNVHYENFRCRKLAG------VGGTDGSARSNKNPLAQMEEEKKDHDAKMQRMEKEMEQVFEMKVREKMQKLKESEADLQRRNEQMKKSLEQQRQELEEKRRDFEKQKASFELTHKD 481          
BLAST of Septin vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 377.867 bits (969), Expect = 2.481e-126
Identity = 195/398 (48.99%), Postives = 276/398 (69.35%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V + E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADT+ PEEC +FKK I+ +I+ + IK Y+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    N A +++      K P++QM+EE+R+  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPE-----------TDDEEEN-KIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGADNNKNKGQLTKSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKLQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKNNWEVQQR 396          
BLAST of Septin vs. Ensembl Cavefish
Match: sept7a (septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008])

HSP 1 Score: 377.867 bits (969), Expect = 2.626e-126
Identity = 194/405 (47.90%), Postives = 276/405 (68.15%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----------NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V + E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVNIIP+IAKADT+ PEEC +FKK I+ +I+ + IK Y+FPE               E N K +   + R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++           N  + ++    +G  P++QM+EE+R+  AK++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   11 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLVKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNIIPLIAKADTMTPEECQQFKKQIMREIQEHKIKTYEFPE-----------TDDEEEN-KIVKKIKDRLPLAVVGSNTIIEVNGKRVRGRQYPWGVAEVENGEHCDFTILRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGADNNKNKGQLTKVDTVEGMSPLAQMEEERRDHVAKMKKMEMEMEQVFEMKVKEKLQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRQFEEEKNNWEVQQR 403          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 369.007 bits (946), Expect = 2.159e-122
Identity = 201/415 (48.43%), Postives = 285/415 (68.67%), Query Frame = 1
Query:  304 NSKMRLVKN------IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNF------AKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +S M L++N      +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK  ++++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+               + + K I   ++R P AVV SN+V+E  G KVRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR ++++        A  S+  +T  K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   32 DSIMDLIRNRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD------------TEEDEDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLT--KSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQR 432          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 363.999 bits (933), Expect = 1.098e-120
Identity = 199/419 (47.49%), Postives = 282/419 (67.30%), Query Frame = 1
Query:  286 PSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVE----VDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNF------AKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            P   + +    L   +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK  ++++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+               + + K I   ++R P AVV SN+V+E  G KVRGR YPWG+ E    V+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR ++++        A  S+  +T  K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:    5 PESAVSSVARNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD------------TEEDEDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLT--KSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQR 409          
BLAST of Septin vs. Ensembl Cavefish
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:111195760])

HSP 1 Score: 363.229 bits (931), Expect = 4.323e-120
Identity = 201/419 (47.97%), Postives = 285/419 (68.02%), Query Frame = 1
Query:  304 NSKMRLVKN------IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVE----VDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNF------AKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +S M L++N      +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK  ++++A++RV+R ++ DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+               + + K I   ++R P AVV SN+V+E  G KVRGR YPWG+ E    V+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR ++++        A  S+  +T  K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   32 DSIMDLIRNRNLEGYVGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRQMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD------------TEEDEDSKLIRKIKERMPLAVVGSNVVVEVNGRKVRGRQYPWGVAEEGIFVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSKKLAAVTCNGVDASKSKGQLT--KSPLAQMEEERREHVMKMKKMETEMEQVFEMKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRQFEEEKANWEMQQR 436          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 345.125 bits (884), Expect = 6.031e-114
Identity = 191/401 (47.63%), Postives = 280/401 (69.83%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETN 1521
            +GF NLP+QIYR++   GFEF LMVVG SG+GKST +N++F ++LY+ E   PTKR QKTV +  + V I E  V L LT++DTPG+GD ++NSEC  PV+ +I+S++ +Y++A++RV+R  + D+RVHACLYFI P+GHGLK LD+EFMKR+H KVNIIP++AKAD  +P EC  FKK I+  I  N IKIY F           T     E N K +   ++R P AV+ SN+V++ GG +V GR YPWG+ EVDN+EH DF+ LR +L+ +H+QD+KD T+ V +EN+R  +++    N A++S+  +T  K P++QM+EEK++ ++K++KME +M  +F  KV EK +KL++ +  ++R    M + LE+ ++E+E +R  FE +RLAWE   RE +
Sbjct:   34 VGFANLPNQIYRKAAKRGFEFTLMVVGESGVGKSTLINSMFKTDLYSEEFPGPTKRIQKTVKVEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRRPMPDSRVHACLYFIAPSGHGLKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQF-----------TDTHDEEDN-KLLNKIKERLPLAVIGSNVVVDVGGRRVWGRHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFRSCKLAALTGNVAENSKRQLT--KSPLAQMEEEKKDHKSKMKKMETEMEQVFDMKVKEKKQKLKDSEAELQRRSEQMKRSLESQLRELEERRKQFEEERLAWESQQRELD 420          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 278.87 bits (712), Expect = 4.610e-89
Identity = 138/300 (46.00%), Postives = 195/300 (65.00%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENL-PPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENY--RCEQMS 1221
            +GF  LP+Q++R+S+  GFEF LMV G SGLGKST +N+LFL++LY++  L P   +   T  I   T+ I E  V L+L+L+DTPGF D++DN+ECW PV++Y+E ++  Y   ++ + R  + D RVH CLYFI P GHGLK LD+EFMK +H KVNI+P+IAKADTL   E    K+ +  ++  N IKIY FPE            +  E   +D  +K    PFAV+  + V+E  G +VRGR YPWG+ EVD+ EH D + LRT+L+ +H+QD+KD T  + +E +  RC ++S
Sbjct:   25 VGFATLPNQVHRKSVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYHDRVLLPADGKRCDTTEILRRTLEIEEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRKNLQDTRVHCCLYFISPYGHGLKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIYQFPE--------CDSDEDDEFKRQDEELK-ASIPFAVIGGSAVVEASGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHRARCIRLS 315          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 246.899 bits (629), Expect = 6.838e-79
Identity = 113/197 (57.36%), Postives = 154/197 (78.17%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPE 921
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY +E   P++R +KT+ +  + V + E  V L LT++DTPGFGD+VDNS CW  ++ YI+SK  +Y++A+ RV+R  + D+RVH CLYFI P+GH LK LD+EFMKR+H KVNIIP+IAKAD+L  EEC +FKKTI+ +I  + IKIY+FP+
Sbjct:   17 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASEYPGPSQRVRKTLQVEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNRRLMPDSRVHCCLYFIFPSGHQLKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEFPD 213          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 244.973 bits (624), Expect = 1.348e-76
Identity = 141/331 (42.60%), Postives = 198/331 (59.82%), Query Frame = 1
Query:  259 EPKSVKPKTPS--GNIDNSKMRLVKN------IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLP-PTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIV-DNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS 1221
            EP+ +  +TP   G +     R+  N      +G + + +Q+ R+++  GFEFN+MVVG SGLGKST VNTLF S +      P   ++  KTV I + +  I E  V +KLT+IDTPGFGD ++N+ CW PVLKYI  +Y +Y+  +  + R +++ D+RVH C+YFI  TGH L+ LD+EFMKR+   VNI+P+IAK+DTL  EE   FKK I  Q++T GI IY   E            + R  N K     R+  PFAVV S+      G K  GR   WG++E++N+ H +FS LR LL+ SH QD+K+ T  V +E YR  ++S
Sbjct:   15 EPEEMTTETPGQDGGVARPPTRVKPNLDAFGYVGIDAVLEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPVSRKSCTPNHEEKIPKTVEIKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEEVNITRKKVIPDSRVHCCIYFIPATGHSLRLLDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIYPHKEHDED-------EEDRSVNNK----IRELMPFAVVGSDKDYLVNGRKTLGRKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYRVLRLS 334          
BLAST of Septin vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 209.92 bits (533), Expect = 8.188e-64
Identity = 116/276 (42.03%), Postives = 166/276 (60.14%), Query Frame = 1
Query:  409 GCSGLGKSTFVNTLFLSELYNNENLPPTK-RTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNR-IVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIY---DFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS 1221
            G SGLGKST VNTLF S +      P  + R  KTV I + +  I E  V +KLT+IDTPGFGD ++N  CW P+LKYI  +Y +Y+  + R+ R R I D RVH C+Y I P+GH L+ LD+EFM+ +   V+++P+I KADTL  EE   F++ I   +  +GI +Y   +F E+         V              R++ PFAVV S+   ++ G +V GR   WGLVEV+N+ H +F+ LR LL+ SH++D+KD T  +L+E YR  +++
Sbjct:    1 GQSGLGKSTLVNTLFKSRVSRKSCTPNYQERILKTVEIQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRHIPDTRVHCCIYCIPPSGHSLRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVYPQREFDEDEQGRLENAEV--------------REKIPFAVVGSDREYQENGRRVLGRKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYRVRRLN 262          
BLAST of Septin vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 286.574 bits (732), Expect = 1.528e-90
Identity = 158/411 (38.44%), Postives = 248/411 (60.34%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLS-------------ELYNNENLP---------PTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSE-CWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFP----EEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEK-GGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFE 1479
            +GF NLP Q +RRS+ NGF FNL+ VG  G+GK+T + TLF +             EL N++             ++  +  V I +    I EN V L L +IDT GFGD ++N +  W+P++K I+S++ +Y+ A+N+++R+ I D R+HACLYFIEPTGH LK LDL+FM+ ++ K N+IP+IAK+D L  EE   FKKTI+NQ+  + I+++  P    ++A    L   +  +               P+AV+ SN ++E   GN+VRGR+YPWG++EVDN  H+DF+ L+ LL+   ++++K+ T ++L+ENYR  +++         V    DP+S+  EEK   EAK+ K+E +M  +FQQKVSEK +KL++ +  +    ++M ++L   +K +E K+   E
Sbjct:  100 VGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDDAENSHLSERLFSSL--------------PYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYRSSKLAKLGIKQDNSVFKEFDPISKQQEEKTLHEAKLAKLEIEMKTVFQQKVSEKEKKLQKSETELFARHKEMKEKLTKQLKALEDKKKQLE 496          
BLAST of Septin vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 216.468 bits (550), Expect = 5.194e-65
Identity = 120/294 (40.82%), Postives = 175/294 (59.52%), Query Frame = 1
Query:  364 RRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNEN--LPPTKRTQKXXXXXXXXXXXXEN--SVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRN-RIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGN--KVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSN 1224
            R+ L  G  F +M+VG SG G+STF+NTL   ++ +     L PT  + +            E+   V ++L +IDTPGFGDS+DNS  +  +  YI  +Y E +  ++RV RN R  D RVH CLY I PTGHGLK++D+EF++++ + VNIIP+I+K+D+L  +E    KK I+  I    + IY+FP +   IS      +  ETN       R   PFA++ SN V E GG+   +RGR YPWG+++V++   +DF  LR  LL SHL D+K+ T ++L+E YR E +S 
Sbjct:   14 RKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDLQLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPFDEDEIS-----DEDYETNM----YLRTLLPFAIIGSNEVYEMGGDVGTIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEALSG 298          
BLAST of Septin vs. Ensembl Yeast
Match: CDC10 (Component of the septin ring, required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells; N-terminus interacts with phosphatidylinositol-4,5-bisphosphate; protein abundance increases under DNA damage stress [Source:SGD;Acc:S000000595])

HSP 1 Score: 213.386 bits (542), Expect = 5.280e-65
Identity = 118/303 (38.94%), Postives = 172/303 (56.77%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNEN------LPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNR-IVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQM 1218
            +GF+ + +QI  R L  GF+FN+MVVG SGLGKST +NTLF S L ++        LP TK T+    +  +T  + E+ V L + +IDTPGFGD +DNS+ W P++KYI+ ++++Y+  +    R R I D RVHA LYF++P G  L +LD+E +KR+    N+IP+I K+DTL  +E  EF++ I N+ +    KIY +  E             R              PFAVV S   IE  G   RGR   W  + V+++   DF  LR  L+ +HLQD+ +TT  + +E +R  Q+
Sbjct:   13 VGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTE----MKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQRERFITDTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGKSDTLTLDERTEFRELIQNEFEKYNFKIYPYDSEELTDEELELNRSVRSI-----------IPFAVVGSENEIEINGETFRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQL 300          
BLAST of Septin vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 204.142 bits (518), Expect = 1.817e-60
Identity = 141/396 (35.61%), Postives = 217/396 (54.80%), Query Frame = 1
Query:  334 GFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKR-TQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQ-----PFAVVCSNIVIEKG-GNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENY---RCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTI--ERTERDMVQQLENDIKEIEYKRNNFEAQ 1485
            G  NLP+Q Y+     G  F +M+ G SGLGK+TF+NTLF + L   +     +   +KTV I+ T   + E    L++ +IDTPGFGD+V+N++ W P++ +I+ ++  YM  + + +R +  D RVHA LYFI PTGHGLK +D+E MKR+ T+ N+IP+IAKADTL  +E  +FK  I   I+   I+I+  P +A +       AK+  +N     ++  RQ     PFA+V S    + G G +V  R YPWGLVE++N  H DF  LR LLL ++L D+  TT ++ +E Y   R E   N  + ++        P  ++    R      ++ E  +   F  +V  + ++  +++Q I  ER       +L  D++EI+ K    E Q
Sbjct:   16 GISNLPNQRYKIVNEEGGTFTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKE----DAKS-GSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYRRLRLEGHENTGEGNEDFTLPAIAPARKLSHNPR-----YKEEENALKKYFTDQVKAEEQRFRQWEQNIVNERI------RLNGDLEEIQGKVKKLEEQ 395          
BLAST of Septin vs. Ensembl Yeast
Match: SPR3 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; septin protein involved in sporulation; regulated by ABFI; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000003291])

HSP 1 Score: 175.637 bits (444), Expect = 6.557e-49
Identity = 104/302 (34.44%), Postives = 169/302 (55.96%), Query Frame = 1
Query:  325 KNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNN---ENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSN-IVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQM 1218
            ++IG +NLP Q    +  NG +F LMV G SGLGK+TF+N+LF + L ++   EN P  +              +  +   L   +IDTPGFG+++DN+  W  ++ YI+ +   Y+  + +  R ++VDNRVH CLYF+ P+  G+  LD+  MK++  +VN+IP+IAK+D L  EE   F KT + +I    I++ D P        G  V  A +    DI    ++ PF+++ SN  +  + G KV+GR Y WG V+++N ++ DF  L+  +   +L D+ ++T+   +E  R E +
Sbjct:   88 QDIGIKNLPRQRELLNAKNGIDFTLMVAGQSGLGKTTFINSLFSTSLIDDDIKENKPIIR----------YKSIVEGDGTHLNFNVIDTPGFGNNMDNAFTWRTMVNYIDEEIRSYIFQEEQPDRTKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTKEELKNF-KTQVREI----IRVQDIP---VCFFFGDEVLNATQ----DIF---QKYPFSIIASNEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTED-YYEKCRSEML 363          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 353.214 bits (905), Expect = 4.333e-117
Identity = 184/377 (48.81%), Postives = 258/377 (68.44%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTK-RTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFA----KDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDI 1446
            +GF NLP+Q++R+S+  GFEF +MVVG SGLGKST +N+LFL++LY   + P  K +  KTV +   TV + E  V L+LT++DTPGFGD+VDN++CW PV+KYI+SK+ E+++A++RV R+   DNRVH CLYFI PTGH LK LD+EFMK++H KVNI+P+I+KADTL  EEC  FKK IL +IK N I IY+FP+      LG       E    D    R + PFAVV SN V+E  G +VR R YPWG+VEV+N+EH DF ALR +L+ +H+QD+KD T+   +ENYRC+++++        S   V+  K P+ Q++ EK + E K++KME++M  +F  KV EK +KL++ +  + +    M  QLE  +
Sbjct:    5 VGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVEVKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRSPFPDNRVHCCLYFISPTGHSLKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEFPD------LG-----GEEDAELDAVNMRDKVPFAVVGSNTVLEVNGKRVRARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYRCDKLASMTVGSPSSSPSHVSLSKSPLEQLEAEKDDHEKKLKKMEQEMEQVFDIKVKEKKKKLKDSEAELGKKHEQMTNQLEQQL 370          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 299.286 bits (765), Expect = 6.458e-97
Identity = 162/366 (44.26%), Postives = 241/366 (65.85%), Query Frame = 1
Query:  322 VKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTK-RTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFP-------EEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNF-----AKDSQ--FGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTR 1374
            V  +GF NLP+Q++R+S+  GFEF LMVVG SGLGKST +++LFL++LY+++++PP K R  +TVHI + TV I E  V L+LT++DTPGF D+VDN+  W P++ YI+ ++  Y+  ++ ++R  I+D RVH CLYFI P GHGL+ +D+EFMK +HTKVNI+P+IAK+D+L   E +  K+ +L++I  + IKIY FP       EE  AI+             KD+   +   PFAV+ SN VIE  G KVR R YPWG  EV+N +H DF  LR +L+ +H+QD+KD T  V +ENYR +++ +       K+S+   G  D    +S+ D+  +E EA++R+M+E M    QQ++ ++ +
Sbjct:   15 VAYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYDDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRRNIMDTRVHCCLYFINPHGHGLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYSFPECDSEDDEEFLAIN-------------KDL---KASLPFAVIGSNTVIEVKGRKVRARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRLLDQTGKANTKNSKKTTGSYDQVVDISEKDKMLQEKEAELRRMQE-MLAKMQQEIHQQKK 363          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 254.218 bits (648), Expect = 7.691e-81
Identity = 131/278 (47.12%), Postives = 189/278 (67.99%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNEN-LPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQ-----PFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLL 1146
            +GF NLP+Q++R+S+  GFEF LMVVG SGLGKST +++LFL++LY++   L   +R +KTV I T+TV I E  V L+LT++DTPG+GD +++   + P+L Y  +++  Y+  ++ ++R  I+D+RVH C YFI PTGHGLK LD+EFMK +H  VNI+P+I KADTL P E  E K+ +L++I   GI+IY+ P+               +++  +  I++ RQ     PFAVV SN +I+  G KVRGR YPWG+VEV+N  H DFS LR +L+
Sbjct:    5 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRRHIIDSRVHCCFYFIAPTGHGLKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIYELPQ--------------CDSDEDEEFIEQTRQLKEGMPFAVVGSNTLIDVCGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 240.35 bits (612), Expect = 3.776e-74
Identity = 138/380 (36.32%), Postives = 223/380 (58.68%), Query Frame = 1
Query:  301 DNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELY---NNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHR--NRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDG-----KDPMSQMDEEKR-EFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIER 1407
            D  ++RL  ++GF++LPDQ+  +S+  GF FN++ +G +G+GKST ++TLF +      ++ +LP  +       I   T ++ E++V LKLT++DT G+GD ++  +  + ++ YI+ ++  Y+H + ++ R  +   D R+HACLYFI PTGH LK LDL  MK++  KVNIIPIIAKADT+   E  +FK+ I++++++NG++IY FP +        TVA+   T   +I       PFAVV S   +     K R R YPWG VEV+N  H DF  LR +L+ +++Q + D T  V +E +R  ++       + G  DG        + +  EE+R E+ ++ +  EE M   F QKV +K  +L++ +Q + R
Sbjct:   15 DGRQLRLAGHVGFDSLPDQLVNKSVNRGFAFNILCIGETGIGKSTLMDTLFQTTFEGQPHSHHLPGVQ-------IEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFHDTRIHACLYFISPTGHSLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPVDDE------TVAEMNSTMNNEI-------PFAVVGSREEVMVNKTKSRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFRRNKL------EEMGFNDGDANNKSHSLQETYEERRKEYMSQFQDKEEKMRQRFVQKVKDKENELKKAEQEVRR 368          
BLAST of Septin vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 184.111 bits (466), Expect = 5.210e-55
Identity = 94/194 (48.45%), Postives = 129/194 (66.49%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRN-RIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIY 909
            +GF+ + +QI R+SL  GFEFNLMVVG SGLGKST VNTLF  +L    +        KTV + + +  I E  V LKLT+ DTPGFGD ++N +CW P++ YI S+Y +++  +  + R  RI D+RVH CLYFI PTGH LK +D+EFMKR+   VNI+P+IAKAD +  EE   F++ +   I+ + I I+
Sbjct:    3 VGFDTVQEQIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLFKGKLSRPTSTGKPTIIPKTVDVKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKPRIPDSRVHCCLYFIAPTGHRLKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNINIH 196          
BLAST of Septin vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 375.941 bits (964), Expect = 1.996e-125
Identity = 193/411 (46.96%), Postives = 276/411 (67.15%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKD------------SQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETNFR 1527
            +GF +LP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ D+R+H CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N     IK K  P AVV SN +IE    +VRGR YPWG+ EV+N +H DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    +            ++    +GK P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE +R  WE   R+   +
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-----------TDDEEENRLVKKIKDKL-PLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGLDNNKGKGQLSTKLDTVEGKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERANWEALQRQEQLK 409          
BLAST of Septin vs. Ensembl Medaka
Match: sept7b (septin-7 [Source:NCBI gene;Acc:101155717])

HSP 1 Score: 373.629 bits (958), Expect = 1.031e-124
Identity = 193/404 (47.77%), Postives = 273/404 (67.57%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS-----NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETNFR 1527
            +GF +LP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ +I+SK+ +Y++A++RV+R ++ D+R+H CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC +FKK I+ +I+ + IKIY+FPE               E N     IK K  P AVV SN +IE    +VRGR YPWG+ EV+N +H DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++         +   G    K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  ++R    M + LE   KE+E KR  FE +R  WE   R+   +
Sbjct:   11 VGFASLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSAEYPGPSHRIKKTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSNCWQPVIDHIDSKFEDYLNAESRVNRRQMPDSRIHCCLYFIAPSGHGLKPLDIEFMKRLHEKVNVIPLIAKADTLTPEECQQFKKQIMREIQEHKIKIYEFPE-----------TDDEEENRLVKKIKDKL-PLAVVGSNTIIEVNSKRVRGRQYPWGVAEVENSDHCDFTILRDMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTYNGLDNNKGKGQLSTKSPLAQMEEERREHVTKMKKMEMEMEQVFEMKVKEKVQKLKDSEAELQRRHEQMKKNLEAQHKELEEKRRVFEEERANWEALQRQEQLK 402          
BLAST of Septin vs. Ensembl Medaka
Match: sept15 (septin-7-like [Source:NCBI gene;Acc:105358736])

HSP 1 Score: 364.385 bits (934), Expect = 5.584e-121
Identity = 197/398 (49.50%), Postives = 275/398 (69.10%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ +   P++R +KTV +  + V I E  V L LT++DTPGFGD+VDNS CW PV+ YI+SK  ++++A++RV+R  + DNRVH CLYFI P+GHGLK LD+EFMKR+H KVN+IP+IAKADTL PEEC  FKK I+ +I+ + IKIY+FP+            +  E N K I   +++ P AVV SN+V+E  G KVRGR YPWG+ EV+N EH DF+ LR +L+ +H+QD+KD T+ V +ENYR  +++    N    S+      K P++QM+EE+RE   K++KME +M  +F+ KV EK +KL++ +  +ER    M + LE   KE+E KR  FE ++  WE   R
Sbjct:   21 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSKDYPGPSQRIKKTVQVEQSKVLIKEGGVQLTLTIVDTPGFGDAVDNSNCWQPVINYIDSKCEDFLNAESRVNRRSMPDNRVHCCLYFIAPSGHGLKPLDIEFMKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPD-----------TEEDEDN-KLIRKIKEKMPLAVVGSNVVVEVNGKKVRGRQYPWGVAEVENGEHCDFTVLRNMLIRTHMQDLKDVTNNVHYENYRSRKLAAVTCNGVDTSKRNGQLTKSPLAQMEEERREHVMKMKKMEAEMEQVFELKVKEKKQKLKDSEAELERRHEQMKRNLEAQYKELEEKRRVFEEEKANWEAQQR 406          
BLAST of Septin vs. Ensembl Medaka
Match: ENSORLT00000010965.2 (septin-7 [Source:NCBI gene;Acc:101158211])

HSP 1 Score: 363.999 bits (933), Expect = 1.113e-120
Identity = 187/404 (46.29%), Postives = 271/404 (67.08%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFG------VTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R ++TV +  + V I E  V L LT++DTPGFGD+VDNS CW  V  YI+SK+ ++++A++RV+R ++ D+RVH CLYFI P+GHGLK LD EFMK +H KVNIIP+IAKADTL PEEC +FK+ I+ +I+ N IKIY+FPE      + + V K ++           R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF  LR +L+ +H+QD+KD T+ V +EN+R  +++    N  ++   G       +DG  P++QM+EE++E   +I+KME++M N+F+ KV EK +KL + +  +++    M + +    +++E KR   E +   WE   R
Sbjct:   28 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKQTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSGCWKSVTDYIDSKFEDFLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDTEFMKYLHEKVNIIPLIAKADTLTPEECQQFKRQIMKEIQENEIKIYEFPETEDEEEMKM-VKKIKD-----------RLPLAVVGSNTIIEVDGKRVRGRKYPWGVAEVENSEHCDFMILRNMLIRTHMQDLKDVTNNVHYENFRSGKLAAVTCNGVENKHNGQLTKTDTSDGMSPLAQMEEERQENMGRIKKMEQEMENVFEMKVKEKLQKLRDSEAELQKRHDQMNRSILAQHRDLEEKRRQLEEEIATWETQQR 419          
BLAST of Septin vs. Ensembl Medaka
Match: ENSORLT00000010963.2 (septin-7 [Source:NCBI gene;Acc:101158211])

HSP 1 Score: 362.844 bits (930), Expect = 3.414e-120
Identity = 187/404 (46.29%), Postives = 271/404 (67.08%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMS----NFAKDSQFG------VTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNR 1512
            +GF NLP+Q+YR+S+  GFEF LMVVG SGLGKST +N+LFL++LY+ E   P+ R ++TV +  + V I E  V L LT++DTPGFGD+VDNS CW  V  YI+SK+ ++++A++RV+R ++ D+RVH CLYFI P+GHGLK LD EFMK +H KVNIIP+IAKADTL PEEC +FK+ I+ +I+ N IKIY+FPE      + + V K ++           R P AVV SN +IE  G +VRGR YPWG+ EV+N EH DF  LR +L+ +H+QD+KD T+ V +EN+R  +++    N  ++   G       +DG  P++QM+EE++E   +I+KME++M N+F+ KV EK +KL + +  +++    M + +    +++E KR   E +   WE   R
Sbjct:   34 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYSPEYPGPSHRIKQTVQVEQSKVLIKEGGVQLLLTIVDTPGFGDAVDNSGCWKSVTDYIDSKFEDFLNAESRVNRRQMPDSRVHCCLYFIAPSGHGLKPLDTEFMKYLHEKVNIIPLIAKADTLTPEECQQFKRQIMKEIQENEIKIYEFPETEDEEEMKM-VKKIKD-----------RLPLAVVGSNTIIEVDGKRVRGRKYPWGVAEVENSEHCDFMILRNMLIRTHMQDLKDVTNNVHYENFRSGKLAAVTCNGVENKHNGQLTKTDTSDGMSPLAQMEEERQENMGRIKKMEQEMENVFEMKVKEKLQKLRDSEAELQKRHDQMNRSILAQHRDLEEKRRQLEEEIATWETQQR 425          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000016474.1 (SMESG000016474.1)

HSP 1 Score: 987.252 bits (2551), Expect = 0.000e+0
Identity = 490/490 (100.00%), Postives = 490/490 (100.00%), Query Frame = 1
Query:   82 MQRNKEEIVNGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETNFRVSMDALDV 1551
            MQRNKEEIVNGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTTVNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETNFRVSMDALDV
Sbjct:    1 MQRNKEEIVNGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTNFKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTTVNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRETNFRVSMDALDV 490          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 442.195 bits (1136), Expect = 1.349e-150
Identity = 214/405 (52.84%), Postives = 296/405 (73.09%), Query Frame = 1
Query:  301 DNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRE 1515
            +N K+ ++  IGF +L DQ+Y+R+   GFEFNLMVVGCSGLGKSTF+N+L +S+ YN E L P+KR +KTV+I  TTV + EN V+LKL L+DTPGFGD+VDNS CW+P+++YI++++ E++  +N+V+R    D R+HAC+YFI+PTGH LK LD+EFMKRIH KVNIIP+I K+DT+ PEEC +FKK +LNQ+  + IKIYDFPE  AA S     A   +    D+   R++ PF+V+ SNI I+K G K+RGR YPWG VEV+N EHNDF  L+ +++ +HL D+KD T Q L+E YR  +MS  A+DS F V+DGKDPM Q++ EK E E +I+KMEE+M  LF+QK  E+T KL+E +  +E+ +  M  QLE   KE+E ++  F+ ++  WEE +R+
Sbjct:   65 NNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYS-----ASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRD 464          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 438.343 bits (1126), Expect = 2.699e-149
Identity = 212/395 (53.67%), Postives = 290/395 (73.42%), Query Frame = 1
Query:  331 IGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQMDEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQLENDIKEIEYKRNNFEAQRLAWEETNRE 1515
            IGF +L DQ+Y+R+   GFEFNLMVVGCSGLGKSTF+N+L +S+ YN E L P+KR +KTV+I  TTV + EN V+LKL L+DTPGFGD+VDNS CW+P+++YI++++ E++  +N+V+R    D R+HAC+YFI+PTGH LK LD+EFMKRIH KVNIIP+I K+DT+ PEEC +FKK +LNQ+  + IKIYDFPE  AA S     A   +    D+   R++ PF+V+ SNI I+K G K+RGR YPWG VEV+N EHNDF  L+ +++ +HL D+KD T Q L+E YR  +MS  A+DS F V+DGKDPM Q++ EK E E +I+KMEE+M  LF+QK  E+T KL+E +  +E+ +  M  QLE   KE+E ++  F+ ++  WEE +R+
Sbjct:   60 IGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKRIKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYS-----ASDNDGEVMDLKKCREKIPFSVIGSNIFIDKNGKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYRVLKMSKIAEDSNFNVSDGKDPMMQLEAEKGEQENRIKKMEEEMKQLFEQKAEERTTKLKESEIDLEKRKEHMKVQLETQSKELEEQKAKFDLEKSQWEELHRD 449          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 255.758 bits (652), Expect = 6.907e-79
Identity = 131/313 (41.85%), Postives = 193/313 (61.66%), Query Frame = 1
Query:  292 GNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELY-------NNENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEK-GGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYR 1206
            G+  N +++L    GF NLP+Q+ R+++  GF F LM+VG SGLGKSTFVN+L    +Y       + + +  T + +K            E  V L+LT++DTPGFGD +D  ECW P+++YI+  + +Y   +  ++R  I DNRVH CLYFI PTGHG+K +D+E MK +H KVNI+PIIAKAD+L   E   FK+ +++ ++   I  Y  P   +         +  E   +D  I R   PF+VV SNI+++   G K+RGR Y WG+ EV+N +H +F+ LRT +L +H+QD+KD T+ +L+ENYR
Sbjct:   39 GSAKNDELKL----GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDSSSEDMINSTTKIEKHFIELD------EKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGS--------DEEDEFRAQDAEI-RAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 332          
BLAST of Septin vs. Planmine SMEST
Match: SMESG000048968.1 (SMESG000048968.1)

HSP 1 Score: 246.514 bits (628), Expect = 1.010e-75
Identity = 129/301 (42.86%), Postives = 187/301 (62.13%), Query Frame = 1
Query:  322 VKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNN-ENLPPTKRTQKXXXXXXXXXXXXENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPE----EAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCS-NIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYR 1206
            ++++GF  +PDQ++R+++  GF F++MVVG SGLGKSTFVN+L +++LY + E LP  +    T  I    + + E  V L+LT+IDTPGF D+V+   CW P+  YI   + +Y   +  ++R  I DNR+H CLYF+ P G GLK LD+E +KR+  K+NIIP+I KAD+L  +E  + K+ ILN I+   + +Y  PE    E A+I    +  KA               PF+++ S +I+    G K+RGR Y WG  EV+N +H DFS LR  LL +H+QD+KD T  VL+ENYR
Sbjct:   38 LQSLGFGQIPDQMHRKAVKKGFNFSIMVVGESGLGKSTFVNSLLMTDLYKDREILPAFESIAVTTKIVKRFIELDEKGVKLRLTIIDTPGFNDAVNCYNCWKPIEDYINDTFDQYFKEECGLNRKNIQDNRIHCCLYFVNPFGRGLKPLDVEVIKRLQCKINIIPVIGKADSLTADELKKLKQKILNDIERYQLDVYRLPECESDEEASIRTLDSEIKA-------------CLPFSIIGSPDIIDNTRGPKIRGRQYIWGTSEVENNKHCDFSRLRLFLLKTHMQDLKDMTSDVLYENYR 325          
The following BLAST results are available for this feature:
BLAST of Septin vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN72.051e-12749.63septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN72.758e-12749.63septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN71.550e-11448.94septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN77.496e-11348.16septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN45.687e-9640.72septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
back to top
BLAST of Septin vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-591.315e-10143.24pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
unc-617.848e-6634.98pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-611.045e-6534.74pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-612.639e-6534.98pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
back to top
BLAST of Septin vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pnut6.148e-13244.93gene:FBgn0013726 transcript:FBtr0088792[more]
pnut6.148e-13244.93gene:FBgn0013726 transcript:FBtr0088793[more]
Sep11.677e-9342.73gene:FBgn0011710 transcript:FBtr0077198[more]
Sep41.295e-9138.05gene:FBgn0259923 transcript:FBtr0074368[more]
Sep41.295e-9138.05gene:FBgn0259923 transcript:FBtr0074366[more]
back to top
BLAST of Septin vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept151.023e-12847.46septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept151.648e-12848.74septin 15 [Source:ZFIN;Acc:ZDB-GENE-061103-265][more]
sept7a5.731e-12846.96septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7a1.693e-12747.90septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7b4.834e-10748.53septin 7b [Source:ZFIN;Acc:ZDB-GENE-030131-37][more]
back to top
BLAST of Septin vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN71.075e-12848.89septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN75.302e-12848.89septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN75.519e-12848.79septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN75.599e-12848.89septin 7 [Source:NCBI gene;Acc:100216295][more]
SEPTIN75.720e-12848.89septin 7 [Source:NCBI gene;Acc:100216295][more]
back to top
BLAST of Septin vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sept71.278e-12749.63septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept72.012e-12749.63septin 7 [Source:MGI Symbol;Acc:MGI:1335094][more]
Sept41.724e-9442.30septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept43.668e-9442.30septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept42.633e-9343.33septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
back to top
BLAST of Septin vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P40797|PNUT_DROME6.162e-13144.93Protein peanut OS=Drosophila melanogaster OX=7227 ... [more]
sp|Q5R481|SEPT7_PONAB6.459e-12749.63Septin-7 OS=Pongo abelii OX=9601 GN=SEPTIN7 PE=2 S... [more]
sp|Q16181|SEPT7_HUMAN6.459e-12749.63Septin-7 OS=Homo sapiens OX=9606 GN=SEPTIN7 PE=1 S... [more]
sp|Q6Q137|SEPT7_BOVIN6.459e-12749.63Septin-7 OS=Bos taurus OX=9913 GN=SEPTIN7 PE=2 SV=... [more]
sp|Q9WVC0|SEPT7_RAT7.274e-12749.63Septin-7 OS=Rattus norvegicus OX=10116 GN=Septin7 ... [more]
back to top
BLAST of Septin vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A232F7026.670e-14152.17Septin-type G domain-containing protein OS=Trichom... [more]
K7J4898.498e-14152.17Septin-type G domain-containing protein OS=Nasonia... [more]
A0A2J7Q8E18.835e-14151.40Protein peanut (Fragment) OS=Cryptotermes secundus... [more]
A0A2J7Q8F09.233e-14151.26Protein peanut (Fragment) OS=Cryptotermes secundus... [more]
A0A1Z5LIM15.481e-13950.25Septin (Fragment) OS=Ornithodoros moubata OX=6938 ... [more]
back to top
BLAST of Septin vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept7a2.481e-12648.99septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept7a2.626e-12647.90septin 7a [Source:ZFIN;Acc:ZDB-GENE-040426-1008][more]
sept152.159e-12248.43septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept151.098e-12047.49septin-7-like [Source:NCBI gene;Acc:111195760][more]
sept154.323e-12047.97septin-7-like [Source:NCBI gene;Acc:111195760][more]
back to top
BLAST of Septin vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN76.031e-11447.63septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
zgc:1622394.610e-8946.00zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN76.838e-7957.36septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN91.348e-7642.60septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN98.188e-6442.03septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
back to top
BLAST of Septin vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC31.528e-9038.44Component of the septin ring that is required for ... [more]
CDC115.194e-6540.82Component of the septin ring that is required for ... [more]
CDC105.280e-6538.94Component of the septin ring, required for cytokin... [more]
CDC121.817e-6035.61Component of the septin ring that is required for ... [more]
SPR36.557e-4934.44Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO345224.333e-11748.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO474096.458e-9744.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331067.691e-8147.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379503.776e-7436.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479755.210e-5548.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept7b1.996e-12546.96septin-7 [Source:NCBI gene;Acc:101155717][more]
sept7b1.031e-12447.77septin-7 [Source:NCBI gene;Acc:101155717][more]
sept155.584e-12149.50septin-7-like [Source:NCBI gene;Acc:105358736][more]
ENSORLT00000010965.21.113e-12046.29septin-7 [Source:NCBI gene;Acc:101158211][more]
ENSORLT00000010963.23.414e-12046.29septin-7 [Source:NCBI gene;Acc:101158211][more]
back to top
BLAST of Septin vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016474.10.000e+0100.00SMESG000016474.1[more]
SMESG000064397.11.349e-15052.84SMESG000064397.1[more]
SMESG000064397.12.699e-14953.67SMESG000064397.1[more]
SMESG000076922.16.907e-7941.85SMESG000076922.1[more]
SMESG000048968.11.010e-7542.86SMESG000048968.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016322 ID=SMED30016322|Name=Septin|organism=Schmidtea mediterranea sexual|type=transcript|length=1705bp
TTTTAAATATCGCACATTTTGAAGTATAATTTAAGAACTTCTGTTTGTCA
TTTTCATTATAATTTGCAATTTCAGCTAAATATGCAACGTAACAAAGAAG
AAATAGTCAATGGTGTTACTGGCAAAGAAACAATTATTACTACTCCGAAG
ATATCAAAACCTCCTGTTGAAAGACCTTATGAAAGAAAAGGAAGTAATGT
TAATGCCAGCCCAACAGTAGAGCCAACTAATTTTAAACCAGAAAATGAGT
TAACAATTGAACCTAAATCAGTTAAGCCCAAGACCCCATCCGGCAATATA
GATAACTCAAAAATGAGACTTGTGAAAAATATCGGATTCGAAAATCTACC
AGACCAAATCTATAGACGATCACTATTCAATGGGTTTGAATTTAATTTGA
TGGTCGTTGGATGCTCAGGGTTGGGAAAATCGACTTTCGTCAACACACTG
TTTCTTTCAGAATTATACAATAACGAAAACTTACCTCCAACAAAGAGAAC
ACAAAAAACCGTCCATATCAACACAACGACTGTAAACATCACTGAAAACT
CAGTGTCACTGAAGCTGACTTTGATTGACACCCCTGGATTTGGTGATTCA
GTTGACAATTCTGAATGCTGGAACCCAGTGTTGAAATATATCGAATCGAA
ATATACAGAATATATGCATGCACAAAACCGTGTTCACCGCAATCGAATTG
TGGACAATCGCGTTCACGCTTGCCTTTATTTCATCGAGCCAACTGGGCAC
GGTCTGAAACAGCTCGATCTTGAATTCATGAAACGCATTCACACCAAAGT
CAATATCATTCCGATTATTGCAAAAGCCGATACGCTAATTCCAGAGGAGT
GCGCTGAATTCAAGAAAACAATTCTCAATCAAATTAAAACGAATGGAATT
AAAATTTACGATTTTCCAGAAGAAGCAGCAGCTATATCTTTGGGAGTAAC
GGTTGCCAAAGCCAGGGAAACCAACTGGAAAGATATTACAATTAAACGAA
AGCGTCAACCATTCGCAGTTGTCTGCAGCAATATAGTCATTGAAAAAGGA
GGTAACAAAGTTCGAGGAAGAACGTATCCTTGGGGTTTGGTTGAAGTTGA
CAATCTCGAACACAACGATTTCTCTGCTTTGCGAACTCTTCTTTTGAGCT
CTCATCTCCAAGATATAAAGGACACAACCGACCAGGTGTTATTTGAAAAC
TATCGATGTGAACAAATGAGCAATTTTGCAAAAGATAGCCAATTTGGAGT
AACTGATGGCAAAGATCCAATGAGTCAAATGGACGAAGAAAAGCGAGAAT
TTGAAGCCAAAATCCGAAAAATGGAAGAAGATATGCACAATTTATTCCAA
CAAAAGGTATCTGAGAAAACGAGGAAATTGGAAGAGTTTCAGCAGACCAT
CGAACGGACCGAAAGAGACATGGTACAGCAATTAGAGAACGATATCAAAG
AGATCGAATACAAAAGAAATAATTTCGAGGCTCAAAGATTGGCATGGGAG
GAAACCAATCGGGAGACAAATTTCCGAGTGTCGATGGACGCATTGGACGT
GAAGGATAAAAACAAATCAAAGGGTAAATGGCTGTTGAAATAGTCGGGCG
GCATCCTTTGTGTGCATGAAAATTGTGGAGATTCTTCTTATCGTATTTCT
GTCAGCAGCATGTTTTATATTGATCATTATTTTGTAATAAATGTGTGGTT
TTCAT
back to top

protein sequence of SMED30016322-orf-1

>SMED30016322-orf-1 ID=SMED30016322-orf-1|Name=SMED30016322-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=504bp
MQRNKEEIVNGVTGKETIITTPKISKPPVERPYERKGSNVNASPTVEPTN
FKPENELTIEPKSVKPKTPSGNIDNSKMRLVKNIGFENLPDQIYRRSLFN
GFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTT
VNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNR
VHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKAD
TLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWK
DITIKRKRQPFAVVCSNIVIEKGGNKVRGRTYPWGLVEVDNLEHNDFSAL
RTLLLSSHLQDIKDTTDQVLFENYRCEQMSNFAKDSQFGVTDGKDPMSQM
DEEKREFEAKIRKMEEDMHNLFQQKVSEKTRKLEEFQQTIERTERDMVQQ
LENDIKEIEYKRNNFEAQRLAWEETNRETNFRVSMDALDVKDKNKSKGKW
LLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR027417P-loop_NTPase
IPR016491Septin
IPR030379G_SEPTIN_dom
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0031105septin complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 426..468
NoneNo IPR availableCOILSCoilCoilcoord: 397..424
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 79..383
e-value: 3.2E-113
score: 379.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 38..52
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 19..53
NoneNo IPR availablePANTHERPTHR18884SEPTINcoord: 65..492
NoneNo IPR availablePANTHERPTHR18884:SF120SEPTIN-7coord: 65..492
IPR016491SeptinPIRSFPIRSF006698Septincoord: 28..495
e-value: 1.3E-138
score: 459.9
IPR016491SeptinCDDcd01850CDC_Septincoord: 100..380
e-value: 5.39127E-136
score: 391.909
IPR030379Septin-type guanine nucleotide-binding (G) domainPFAMPF00735Septincoord: 100..383
e-value: 6.7E-109
score: 363.5
IPR030379Septin-type guanine nucleotide-binding (G) domainPROSITEPS51719G_SEPTINcoord: 100..381
score: 89.114
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 84..276