slc16a-25

Overview
Nameslc16a-25 (AKN21520.1)
Smed IDSMED30016317
Length (bp)1502
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of slc16a-25 (SMED30016317) t-SNE clustered cells

Violin plots show distribution of expression levels for slc16a-25 (SMED30016317) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of slc16a-25 (SMED30016317) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for slc16a-25 (SMED30016317) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016317

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016317SMESG000046854.1 SmedASXL_070974SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30016317SMESG000046854.1 SmedASXL_012066SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016317SMESG000046854.1 dd_Smed_v4_10252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016317SMESG000046854.1 dd_Smed_v4_10252_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
headSMED30016317SMESG000046854.1 dd_Smed_v6_10252_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016317SMESG000046854.1 dd_Smed_v6_11873_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016317SMESG000046854.1 OX_Smed_1.0.02518ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of slc16a-25 vs. TrEMBL
Match: A0A0H3YF17 (Slc16a-25 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-25 PE=2 SV=1)

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 427/428 (99.77%), Postives = 428/428 (100.00%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDRM 1285
            WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYLRRNSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSLLMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAGMGLGMLLSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDR+
Sbjct:  137 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYLRRNSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSLLMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAGMGLGMLLSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDRV 564          
BLAST of slc16a-25 vs. TrEMBL
Match: A0A0H3YK67 (Slc16a-8 OS=Schmidtea mediterranea OX=79327 GN=slc16a-8 PE=2 SV=1)

HSP 1 Score: 380.948 bits (977), Expect = 2.786e-124
Identity = 232/371 (62.53%), Postives = 289/371 (77.90%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQED 1114
            WIGDSYAALGY++TT+STA+I+R +R+YR+FQFIGA  IL+ACL SA V +AHWLFLTHTV HG GSSLILS VGL+V E+FD NH  HILATTLVSGGS+ASIVFVQFYAYLI  YGWRKAFV+LG +YF++NL+   VF +K S+K+        S  + + I    + LLI WT+DRI+TSIVTYGMLLNLADY+RR+ S L  STSLT+LFAAGEA+TY+ G I++ LTKK+F ++LKY+LL+S+ LM + L  WE ++S+   S +L++ SGFCLGPSITFLFPAGEE+TTLPG +AYPFSL GMG+GM +SP+L+ALIAQ + Y WFFL+QG L+  K  CL   CV+L    S  S   NI +D
Sbjct:   65 WIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL-MGGSKHSKSFNIHDD 434          
BLAST of slc16a-25 vs. TrEMBL
Match: A0A4S2M3W9 (MFS domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002878 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 4.359e-118
Identity = 223/392 (56.89%), Postives = 288/392 (73.47%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKA-SNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKS 1174
            WIGDSYAA+GYLTT++ST+ I+   R++R+ Q +GA C+L+AC+ SAYV + HWLFLTHT+ HGIGSSL+LS  GLVV EHFD NH+YHILATTLVSGGS+ASIVFV+FYAYLI+  GWR AFVVLG +YF + LTG  VFQK ++     N +   L    R  ++ +   LLILW +DRI TS+VTYGMLLNLADY+ R  +SL+ S  LT LFAAGEA+TY+ GA+V+ LT+    ++L+Y+LL++S +M   L AWE  A++   S  L+Y  GFCLGPSITFLFPAGEELT LPG +AYPFSL GMG+GM LSPVLSALIAQ ++Y+WFFLVQG LM  K  C+++S +IL   RS+        ++R ++    +E +   + E+S
Sbjct:   49 WIGDSYAAIGYLTTSLSTSAILARGRRFRISQLLGAVCVLLACITSAYVPNPHWLFLTHTILHGIGSSLVLSTAGLVVNEHFDKNHRYHILATTLVSGGSVASIVFVEFYAYLIESMGWRNAFVVLGVIYFFVLLTGTCVFQKDATKPDYRNDKYAFLG---RAQLSFQRSCLLILWFIDRIFTSVVTYGMLLNLADYMYRRETSLSRSALLTTLFAAGEASTYVIGAVVTGLTRDLLKNRLRYILLVTSSIMGCALCAWEFWAANVALSHFLAYLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQNFQYRWFFLVQGLLMFIKFGCILLSTMIL---RSL------AHQERSYVCADGTENVESTEDERS 428          
BLAST of slc16a-25 vs. TrEMBL
Match: A0A5J4NSI4 (MFS domain-containing protein OS=Paragonimus westermani OX=34504 GN=DEA37_0008634 PE=4 SV=1)

HSP 1 Score: 366.311 bits (939), Expect = 7.972e-118
Identity = 223/412 (54.13%), Postives = 298/412 (72.33%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHI 1237
            WIGDSYAALGYLTT++ST++I+   R++ V Q  GA  IL+AC+ SAYV + HWLF+THT+ HGIGSSL+LS  GLVV EHFD NH+YHILATTLVSGGS+A+IVFV+FYAYLI+ +GWRKAF++LG +YF++ L G  VF+K ++     S    L ++ +  I + +L  LILW +DRI+TS+VTYGMLLNLADY+ R  +SL  S  LT LFAAGEA+TY+ GA+V+ +T+  F ++L+++L+++S +M + L  WE  A +   S  L++  GFCLGPSITFLFPAGEELT LPG +AYPFSL GMG+GM LSPVLSALIAQ + Y+WFFLVQG LM  KC CLI S +IL   RS++S       +  ++ T+     +M + +     P+   E+ QS   GW+++
Sbjct:   49 WIGDSYAALGYLTTSLSTSLILATGRRFWVSQMFGAIAILLACITSAYVPNPHWLFITHTILHGIGSSLVLSTAGLVVNEHFDENHRYHILATTLVSGGSVAAIVFVEFYAYLIEAFGWRKAFIILGVIYFLVLLIGALVFEKNANKPDYRSEKCVLLAQRQLSIRRSSL--LILWFVDRIMTSVVTYGMLLNLADYMYRRETSLRRSALLTTLFAAGEASTYLIGAVVTGITRNLFKNRLRFILIVTSCIMALSLTLWEFTADNRNLSRFLAFLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQMFTYRWFFLVQGSLMYIKCACLISSTLIL---RSMMS------GETPYVHTA---LHNMEEDDGHQTPPVECIENSQS-SKGWENL 445          
BLAST of slc16a-25 vs. TrEMBL
Match: H2KRF1 (Monocarboxylate transporter 5 OS=Clonorchis sinensis OX=79923 GN=CLF_106191 PE=4 SV=1)

HSP 1 Score: 363.999 bits (933), Expect = 3.451e-117
Identity = 219/357 (61.34%), Postives = 272/357 (76.19%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKA-SNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILN 1069
            WIGDSYAA+GYLTT++ST+ I+   R++R+ Q +GA C+L+AC+ SAYV + HWLFLTHT+ HGIGSSL+LS  GLVV EHFD NH+YHILATTLVSGGS+ASIVFV+FYAYLI+  GWR AFVVLG +YF + LTG  VFQK SS     N +   L    R  ++ +   LLILW +DRI TS+VTYGMLLNLADY+ R  +SL+ S  LT LFAAGEA+TY+ GA+V+ LT+    ++L+Y+LL++S +M   L AWE  A++   S  L+Y  GFCLGPSITFLFPAGEELT LPG +AYPFSL GMG+GM LSPVLSALIAQ ++Y+WFFLVQG LM  K  C++ S +IL 
Sbjct:   49 WIGDSYAAIGYLTTSLSTSAILARGRRFRISQLLGAVCVLLACITSAYVPNPHWLFLTHTILHGIGSSLVLSTAGLVVNEHFDKNHRYHILATTLVSGGSVASIVFVEFYAYLIESMGWRNAFVVLGVIYFFVLLTGTCVFQKDSSKPDYRNDKYAFLG---RTQLSFQRSCLLILWFIDRIFTSVVTYGMLLNLADYMYRRETSLSRSALLTTLFAAGEASTYVIGAVVTGLTRDLLKNRLRYILLVTSSIMGCALCAWEFWAANVALSHFLAYLCGFCLGPSITFLFPAGEELTMLPGHMAYPFSLGGMGVGMALSPVLSALIAQNFQYRWFFLVQGLLMFIKFGCILFSTMILR 402          
BLAST of slc16a-25 vs. Planmine SMEST
Match: SMESG000046854.1 (SMESG000046854.1)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 423/428 (98.83%), Postives = 427/428 (99.77%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDRM 1285
            WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGV VFQKKSSSKASNSRLTNLSSKLRQLINKETL+LLILWTLDRIVTSIVTYGMLLNLADYLRRNSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSLLMVICLFAWEILAS+FTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAGMGLGMLLSPVLSA+IAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDR+
Sbjct:   79 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVVVFQKKSSSKASNSRLTNLSSKLRQLINKETLVLLILWTLDRIVTSIVTYGMLLNLADYLRRNSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSLLMVICLFAWEILASNFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAGMGLGMLLSPVLSAVIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITEDGQSIDNGWDHIDLMEAQEVPSCDDDRV 506          
BLAST of slc16a-25 vs. Planmine SMEST
Match: SMESG000026692.1 (SMESG000026692.1)

HSP 1 Score: 381.333 bits (978), Expect = 3.926e-128
Identity = 232/371 (62.53%), Postives = 289/371 (77.90%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQED 1114
            WIGDSYAALGY++TT+STA+I+R +R+YR+FQFIGA  IL+ACL SA V +AHWLFLTHTV HG GSSLILS VGL+V E+FD NH  HILATTLVSGGS+ASIVFVQFYAYLI  YGWRKAFV+LG +YF++NL+   VF +K S+K+        S  + + I    + LLI WT+DRI+TSIVTYGMLLNLADY+RR+ S L  STSLT+LFAAGEA+TY+ G I++ LTKK+F ++LKY+LL+S+ LM + L  WE ++S+   S +L++ SGFCLGPSITFLFPAGEE+TTLPG +AYPFSL GMG+GM +SP+L+ALIAQ + Y WFFL+QG L+  K  CL   CV+L    S  S   NI +D
Sbjct:   60 WIGDSYAALGYISTTLSTALILRSNRRYRLFQFIGAFLILLACLTSAVVPNAHWLFLTHTVLHGFGSSLILSTVGLIVNEYFDKNHPRHILATTLVSGGSVASIVFVQFYAYLIVDYGWRKAFVILGLIYFVVNLSACFVFARKFSNKSEEGLSKKSSVNVCRDIKSSQIPLLIFWTIDRIMTSIVTYGMLLNLADYMRRSESKLTNSTSLTVLFAAGEASTYLIGTIITGLTKKFFHNRLKYILLVSTFLMAVSLVYWEFVSSNKHLSRLLAFVSGFCLGPSITFLFPAGEEMTTLPGHMAYPFSLFGMGIGMAVSPILTALIAQIFDYNWFFLIQGGLIFIKFGCLASICVLL-MGGSKHSKSFNIHDD 429          
BLAST of slc16a-25 vs. Planmine SMEST
Match: SMESG000070297.1 (SMESG000070297.1)

HSP 1 Score: 333.954 bits (855), Expect = 9.061e-110
Identity = 211/341 (61.88%), Postives = 270/341 (79.18%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLM 1024
            WIGDSYAALGYLTTTIST +I+   R++++FQFIGAC +L+AC+ SA VT+AHWLFLTHTVFHGIGSSLILS +GLVV EHF   HKYH+LATTLVSGGS+ASIVFVQFYA+LI+ +GWR AF++LG +YFI+N +G  +FQ+      S  +    S    + I K+   LLI WTLDRI+T+IVTYGMLLNLADYLRR+  +L +STSLT+LFA+GEA+TY+ GA+++A+TK +F ++LKY+LL+ +  M   L  WE    + + +  L++ SGF LGPSITFLFPAGEE+T LPG +AYPFSL GMG+GMLLSP LSA+IA  ++Y+ FFL+QGCL+
Sbjct:   60 WIGDSYAALGYLTTTISTTLILNCDRRFKLFQFIGACFVLLACITSAMVTNAHWLFLTHTVFHGIGSSLILSTIGLVVNEHFGKTHKYHLLATTLVSGGSIASIVFVQFYAFLIEHFGWRTAFIILGVIYFIINCSGSCIFQRNMDISTS-YKPNRCSLNWDEHITKKHFPLLIFWTLDRIITTIVTYGMLLNLADYLRRSEHTLTSSTSLTVLFASGEASTYLIGAVITAVTKDFFKNRLKYILLVCTGFMSFSLIVWEFFVLNKSLTHFLAFSSGFFLGPSITFLFPAGEEMTLLPGHLAYPFSLGGMGIGMLLSPTLSAVIASAFEYRGFFLIQGCLI 399          
BLAST of slc16a-25 vs. Planmine SMEST
Match: SMESG000026519.1 (SMESG000026519.1)

HSP 1 Score: 320.472 bits (820), Expect = 1.686e-104
Identity = 201/396 (50.76%), Postives = 278/396 (70.20%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRW--------------RSVLSIGRNIQEDREFLLTSESEQ 1147
            WIGDSYAA+GY+T+ IS A+I+ F R+Y +FQF+GA  +L++C+ S++V + HWLFLTHT+FHGIGSSLI+S VGLVV +HFD  H YHILATTLVSGGS+ASI+FV  +A LI  YGWR AF++LG +YFI+N +  A+F +KS+++  ++    +S +    I    + LL LW +DR++TS+VTYG+LLNL DY+ R   +L  ST+LT LFA+GEA TY+ GA ++A+T+ +F  KL+Y+LL +S  M ICL A E      +   IL + +GF LGPSITFLFPAGEELT LPG +AYP SLAGMG GML+SP+L+A IA+ + YKWFF VQGCL+  K   ++   +IL+ +               + + I  N +++  FLL   +++
Sbjct:   59 WIGDSYAAVGYMTSGISIAIILFFKRRYGMFQFMGAIWVLVSCVTSSFVPNPHWLFLTHTLFHGIGSSLIISTVGLVVNDHFDSKHPYHILATTLVSGGSVASIIFVTLFASLIQSYGWRYAFIILGCLYFIVNASA-ALFFRKSNNQVEDTNKKTVSCRCEGHIKIIHIPLLCLWFIDRVMTSVVTYGLLLNLTDYMYRTEKNLVRSTTLTTLFASGEAITYLIGATITAITRDFFKDKLRYILLGTSFAMSICLIALEYFKGIISVCYILCFLAGFTLGPSITFLFPAGEELTRLPGHMAYPISLAGMGFGMLVSPLLTAKIAEIFLYKWFFFVQGCLILIKVASILAIILILHFYDDKFQPESYSKFNNSNEVPIEENPKKESTFLLNEGNKK 453          
BLAST of slc16a-25 vs. Planmine SMEST
Match: SMESG000026516.1 (SMESG000026516.1)

HSP 1 Score: 300.827 bits (769), Expect = 3.340e-97
Identity = 188/379 (49.60%), Postives = 268/379 (70.71%), Query Frame = 2
Query:    2 WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVTSAHWLFLTHTVFHXXXXXXXXXXXXXXXXEHFDLNHKYHILATTLVSGGSLASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKASNSRLTNLSSKLRQL------INKETLILLILWTLDRIVTSIVTYGMLLNLADYXXXXXXXXXXXXXXXMLFAAGEATTYIQGAIVSALTKKWFAXXXXXXXXXXXXXMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGEIAYPFSLAXXXXXXXXSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIVSCVILNRWRSVLSIGRNIQEDRE 1120
            WIGDSY+A+GY++T++S ++II F+R+Y +FQF+GA  +L++C+ S++V + HWLFLTHT+FHGIGSSLI+S  GLVV E+FD  H+YHILATTLVSGGS+ASI+FV  ++ LI+ YGWRK F++LG +YF++       F+K       N  L  +SSK + L      I    + L+I W  DRI+TS+VTYG+LLNL DY+ +    L  S+ LT++FA+GEA TY+ G++++A+TK +F  KL+Y+LL++SL M ICL   E  +   +   +L + +GF LGPSITFLFPAGEE T LPG +AYP SL GMG GM++SP+L+A I +   Y+WFF VQGC + FK  CL+V+ +IL+ +   +     + +D +
Sbjct:   60 WIGDSYSAIGYMSTSLSISIIIYFNRRYGLFQFLGALWVLISCITSSFVPNPHWLFLTHTLFHGIGSSLIISTAGLVVNEYFDKKHRYHILATTLVSGGSVASILFVTLFSKLIEHYGWRKTFIILGIIYFVVCSLAAFFFKK-------NKDLKEISSKGKMLCQGQWNIKSIQIPLIIFWFTDRIMTSVVTYGLLLNLTDYVYQGHKDLMKSSILTIIFASGEAVTYLIGSVITAITKDFFKEKLRYILLVTSLSMSICLIILEYTSHIVSIRRLLCFFAGFSLGPSITFLFPAGEEFTRLPGHLAYPVSLGGMGFGMIISPLLTAKIIELLDYRWFFFVQGCFILFKSSCLLVNIIILHFFIQKIEEPPQLTDDEK 431          
The following BLAST results are available for this feature:
BLAST of slc16a-25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF170.000e+099.77Slc16a-25 (Fragment) OS=Schmidtea mediterranea OX=... [more]
A0A0H3YK672.786e-12462.53Slc16a-8 OS=Schmidtea mediterranea OX=79327 GN=slc... [more]
A0A4S2M3W94.359e-11856.89MFS domain-containing protein OS=Opisthorchis feli... [more]
A0A5J4NSI47.972e-11854.13MFS domain-containing protein OS=Paragonimus weste... [more]
H2KRF13.451e-11761.34Monocarboxylate transporter 5 OS=Clonorchis sinens... [more]
back to top
BLAST of slc16a-25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of slc16a-25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046854.10.000e+098.83SMESG000046854.1[more]
SMESG000026692.13.926e-12862.53SMESG000026692.1[more]
SMESG000070297.19.061e-11061.88SMESG000070297.1[more]
SMESG000026519.11.686e-10450.76SMESG000026519.1[more]
SMESG000026516.13.340e-9749.60SMESG000026516.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016317
GenBankAKN21520.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016317 ID=SMED30016317|Name=slc16a-25|organism=Schmidtea mediterranea sexual|type=transcript|length=1502bp
TTGGATTGGAGATTCCTATGCTGCACTAGGATATTTGACAACGACGATTT
CTACCGCAGTGATTATTCGGTTTCATAGAAAATATCGAGTTTTCCAGTTC
ATTGGAGCGTGCTGTATTCTAATGGCTTGTTTAGCTTCTGCATACGTTAC
TAGCGCTCATTGGTTGTTTTTAACACACACCGTATTCCATGGAATCGGAT
CGAGTCTCATCTTAAGCGTTGTCGGATTAGTTGTCGGGGAACATTTTGAT
TTGAATCATAAATATCACATTTTAGCGACCACTTTGGTGTCGGGAGGGTC
TCTTGCATCGATAGTCTTCGTTCAATTTTACGCATACTTGATAGACCAAT
ACGGTTGGCGTAAAGCGTTTGTAGTGCTTGGGTTTGTCTACTTCATCATG
AATTTGACCGGTGTTGCGGTATTTCAGAAGAAATCAAGTTCTAAGGCTTC
CAATAGTCGACTGACGAACCTTTCGTCAAAATTAAGGCAACTGATAAATA
AAGAGACTTTAATCCTTTTAATTTTATGGACACTAGACCGAATTGTCACT
AGTATTGTTACGTATGGGATGCTATTGAATTTAGCGGATTACTTACGCAG
AAATTCTAGCAGCTTGAATACGAGCACGTCTTTGACAATGCTTTTTGCAG
CTGGAGAGGCAACAACGTACATACAGGGTGCAATTGTGAGTGCTCTTACG
AAAAAATGGTTTGCATCAAAACTAAAATATTTGCTTTTAATTTCTAGTTT
ATTGATGGTTATTTGTCTGTTTGCTTGGGAAATTTTAGCAAGTAGTTTCA
CTTGGAGCTGTATTCTTTCGTATTGTTCGGGATTTTGCTTGGGACCTTCA
ATCACATTTTTGTTTCCTGCGGGGGAGGAGTTGACTACATTGCCAGGAGA
AATTGCATATCCATTTTCACTTGCCGGAATGGGACTTGGAATGTTGCTGT
CACCAGTTTTGAGTGCTTTAATAGCTCAGAAATACAAATACAAATGGTTC
TTTCTGGTGCAAGGTTGTTTGATGTGTTTCAAGTGTTGCTGTTTGATTGT
GAGTTGTGTCATTCTTAATCGTTGGAGGTCGGTTCTTTCAATTGGAAGAA
ATATTCAAGAAGATAGAGAATTTCTTTTGACAAGTGAGAGTGAACAAATG
TCAATGATGAAACGGGAGAAGAGCTCATTCCAGCCCTTGCCTATTACCGA
AGACGGTCAGTCAATCGACAATGGGTGGGATCACATAGATCTTATGGAAG
CCCAAGAAGTACCTTCATGTGATGATGATCGAATGAGTTTTGTCTATGAA
ATTAGGAGTATTATCATTGAAACTGAGATTTCAGATTTTTGTTCAAATCG
TCAGTGAAGTGAGAAACCGAATGTACTTGGTAAGATCTCCCAGCATTTTA
TCAACAACGAGAAAGCTTACTCTATTGCCAATTTGATTTTATCAGTAAAC
CGTGGAAAATACTATTATAAAAATTAATTTAAAATAATAAATAATGTTGG
TA
back to top

protein sequence of SMED30016317-orf-1

>SMED30016317-orf-1 ID=SMED30016317-orf-1|Name=SMED30016317-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=452bp
WIGDSYAALGYLTTTISTAVIIRFHRKYRVFQFIGACCILMACLASAYVT
SAHWLFLTHTVFHGIGSSLILSVVGLVVGEHFDLNHKYHILATTLVSGGS
LASIVFVQFYAYLIDQYGWRKAFVVLGFVYFIMNLTGVAVFQKKSSSKAS
NSRLTNLSSKLRQLINKETLILLILWTLDRIVTSIVTYGMLLNLADYLRR
NSSSLNTSTSLTMLFAAGEATTYIQGAIVSALTKKWFASKLKYLLLISSL
LMVICLFAWEILASSFTWSCILSYCSGFCLGPSITFLFPAGEELTTLPGE
IAYPFSLAGMGLGMLLSPVLSALIAQKYKYKWFFLVQGCLMCFKCCCLIV
SCVILNRWRSVLSIGRNIQEDREFLLTSESEQMSMMKREKSSFQPLPITE
DGQSIDNGWDHIDLMEAQEVPSCDDDRMSFVYEIRSIIIETEISDFCSNR
Q*
back to top
Aliases
The feature 'slc16a-25' has the following synonyms
Synonym
slc16a-25
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR011701MFS
IPR020846MFS_dom
IPR022776TRM13/UPF0224_CHHC_Znf_dom
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 4..153
e-value: 2.1E-10
score: 42.2
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 165..357
e-value: 6.4E-8
score: 34.2
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 1..351
NoneNo IPR availableCDDcd17352MFS_MCT_SLC16coord: 1..341
e-value: 1.5665E-12
score: 66.422
NoneNo IPR availableTMHMMTMhelixcoord: 170..192
NoneNo IPR availableTMHMMTMhelixcoord: 90..112
NoneNo IPR availableTMHMMTMhelixcoord: 207..229
NoneNo IPR availableTMHMMTMhelixcoord: 31..50
NoneNo IPR availableTMHMMTMhelixcoord: 334..356
NoneNo IPR availableTMHMMTMhelixcoord: 302..324
NoneNo IPR availableTMHMMTMhelixcoord: 122..141
NoneNo IPR availableTMHMMTMhelixcoord: 268..290
NoneNo IPR availableTMHMMTMhelixcoord: 55..77
NoneNo IPR availableTMHMMTMhelixcoord: 241..263
NoneNo IPR availableTMHMMTMhelixcoord: 5..24
IPR011701Major facilitator superfamilyPFAMPF07690MFS_1coord: 9..285
e-value: 2.3E-12
score: 46.5
IPR020846Major facilitator superfamily domainPROSITEPS50850MFScoord: 1..451
score: 8.783
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 5..350