low-density lipoprotein receptor-like

Overview
Namelow-density lipoprotein receptor-like
Smed IDSMED30016312
Length (bp)2978
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of low-density lipoprotein receptor-like (SMED30016312) t-SNE clustered cells

Violin plots show distribution of expression levels for low-density lipoprotein receptor-like (SMED30016312) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of low-density lipoprotein receptor-like (SMED30016312) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for low-density lipoprotein receptor-like (SMED30016312) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 367.081 bits (941), Expect = 1.129e-111
Identity = 256/759 (33.73%), Postives = 369/759 (48.62%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRV 2340
            RC R +F CQ+GKCI     CDG   C D SDE  +   + TC   +          I +   CDG+ DCDN  D + C    CS D+F C      CIS+  +C+ + DC DGSDE+  +C ++   P   QC++S          CI +++ CD   DC D SDE           + + L      S+ C   EF+C +G    CI   WRCDG  DC +   DE NC+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  N+FKC  +  CI   +VC+   DC D SDE      + C  N C  NNG C   C +     +CLC  G+++  + + +C DIDEC D   CS  C N  G YKC+C EGF +    K C AVG   +L ++ ++ +R++ L R  Y  ++ + +N       + +D +  S  I+W+    +  ++    L    G     T++   I +P GLA DWIH  ++W+D     +SV +     RKTL R  N SK R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++      AH F + VFED ++ +D  NE I   ++ TG    L++     P  + LFH L QP  +         N  CQYLCLP      +  KF C CPD   L  D ++C  T++E    T   S+  LK   + V
Sbjct:   26 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG--KCISRQFVCDSDRDCLDGSDEA--SCPVLTCGPASFQCNSST---------CIPQLWACDNDPDCEDGSDEW--------PQRCRGLYVFQGDSSPCSAFEFHCLSGE---CIHSSWRCDGGPDCKDK-SDEENCAVATCRPDE-FQCSD-GNCIHGSRQCDREYDCKDMSDEVGCVNVTL----CEGPNKFKC-HSGECITLDKVCNMARDCRDWSDE----PIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNV------VALDTEVASNRIYWSDL--SQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFR-ENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCL-TEAEAAVATQETSTVRLKVSSTAV 736          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 366.696 bits (940), Expect = 1.340e-111
Identity = 256/759 (33.73%), Postives = 369/759 (48.62%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRV 2340
            RC R +F CQ+GKCI     CDG   C D SDE  +   + TC   +          I +   CDG+ DCDN  D + C    CS D+F C      CIS+  +C+ + DC DGSDE+  +C ++   P   QC++S          CI +++ CD   DC D SDE           + + L      S+ C   EF+C +G    CI   WRCDG  DC +   DE NC+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  N+FKC  +  CI   +VC+   DC D SDE      + C  N C  NNG C   C +     +CLC  G+++  + + +C DIDEC D   CS  C N  G YKC+C EGF +    K C AVG   +L ++ ++ +R++ L R  Y  ++ + +N       + +D +  S  I+W+    +  ++    L    G     T++   I +P GLA DWIH  ++W+D     +SV +     RKTL R  N SK R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++      AH F + VFED ++ +D  NE I   ++ TG    L++     P  + LFH L QP  +         N  CQYLCLP      +  KF C CPD   L  D ++C  T++E    T   S+  LK   + V
Sbjct:   26 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG--KCISRQFVCDSDRDCLDGSDEA--SCPVLTCGPASFQCNSST---------CIPQLWACDNDPDCEDGSDEW--------PQRCRGLYVFQGDSSPCSAFEFHCLSGE---CIHSSWRCDGGPDCKDK-SDEENCAVATCRPDE-FQCSD-GNCIHGSRQCDREYDCKDMSDEVGCVNVTL----CEGPNKFKC-HSGECITLDKVCNMARDCRDWSDE----PIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNV------VALDTEVASNRIYWSDL--SQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFR-ENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCL-TEAEAAVATQETSTVRLKVSSTAV 736          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 367.851 bits (943), Expect = 3.539e-111
Identity = 256/759 (33.73%), Postives = 369/759 (48.62%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRV 2340
            RC R +F CQ+GKCI     CDG   C D SDE  +   + TC   +          I +   CDG+ DCDN  D + C    CS D+F C      CIS+  +C+ + DC DGSDE+  +C ++   P   QC++S          CI +++ CD   DC D SDE           + + L      S+ C   EF+C +G    CI   WRCDG  DC +   DE NC+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  N+FKC  +  CI   +VC+   DC D SDE      + C  N C  NNG C   C +     +CLC  G+++  + + +C DIDEC D   CS  C N  G YKC+C EGF +    K C AVG   +L ++ ++ +R++ L R  Y  ++ + +N       + +D +  S  I+W+    +  ++    L    G     T++   I +P GLA DWIH  ++W+D     +SV +     RKTL R  N SK R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++      AH F + VFED ++ +D  NE I   ++ TG    L++     P  + LFH L QP  +         N  CQYLCLP      +  KF C CPD   L  D ++C  T++E    T   S+  LK   + V
Sbjct:  111 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG--KCISRQFVCDSDRDCLDGSDEA--SCPVLTCGPASFQCNSST---------CIPQLWACDNDPDCEDGSDEW--------PQRCRGLYVFQGDSSPCSAFEFHCLSGE---CIHSSWRCDGGPDCKDK-SDEENCAVATCRPDE-FQCSD-GNCIHGSRQCDREYDCKDMSDEVGCVNVTL----CEGPNKFKC-HSGECITLDKVCNMARDCRDWSDE----PIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNV------VALDTEVASNRIYWSDL--SQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFR-ENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCL-TEAEAAVATQETSTVRLKVSSTAV 821          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Match: LDLR (low density lipoprotein receptor [Source:HGNC Symbol;Acc:HGNC:6547])

HSP 1 Score: 367.466 bits (942), Expect = 5.130e-111
Identity = 256/761 (33.64%), Postives = 369/761 (48.49%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNV 2346
            RC R +F CQ+GKCI     CDG   C D SDE  +   + TC   +          I +   CDG+ DCDN  D + C    CS D+F C      CIS+  +C+ + DC DGSDE+  +C ++   P   QC++S          CI +++ CD   DC D SDE           + + L      S+ C   EF+C +G    CI   WRCDG  DC +   DE NC+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  N+FKC  +  CI   +VC+   DC D SDE      + C  N C  NNG C   C +     +CLC  G+++  + + +C DIDEC D   CS  C N  G YKC+C EGF +    K C AVG   +L ++ ++ +R++ L R  Y  ++ + +N       + +D +  S  I+W+    +  ++    L    G     T++   I +P GLA DWIH  ++W+D     +SV +     RKTL R  N SK R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++      AH F + VFED ++ +D  NE I   ++ TG    L++     P  + LFH L QP  +         N  CQYLCLP      +  KF C CPD   L  D ++C  T++E    T   S+  LK   + V  
Sbjct:   26 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG--KCISRQFVCDSDRDCLDGSDEA--SCPVLTCGPASFQCNSST---------CIPQLWACDNDPDCEDGSDEW--------PQRCRGLYVFQGDSSPCSAFEFHCLSGE---CIHSSWRCDGGPDCKDK-SDEENCAVATCRPDE-FQCSD-GNCIHGSRQCDREYDCKDMSDEVGCVNVTL----CEGPNKFKC-HSGECITLDKVCNMARDCRDWSDE----PIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNV------VALDTEVASNRIYWSDL--SQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFRE-NGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCL-TEAEAAVATQETSTVRLKVSSTAVRT 738          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Match: LRP4 (LDL receptor related protein 4 [Source:HGNC Symbol;Acc:HGNC:6696])

HSP 1 Score: 369.392 bits (947), Expect = 2.428e-107
Identity = 255/752 (33.91%), Postives = 362/752 (48.14%), Query Frame = 1
Query:  127 CRRFQFLCQNGK-----CIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCD----NSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDS---------ENSKSKSQSLADLVKQSTI-----------------CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNL----CKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMK-PRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPK--PMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICP 2226
            C R  F C         CIP    CDG ++CGD+SDE       C   + F C +   I ++ +CDG  DC++D D + C   +C  D+F C+     CI     C+ +NDC D SDE              QCD    +   F+C +   CI+  +YCDG +DC D SDE+NCP +         E   +  + + D+                       C++ EF C +G    CI   WRCDG  DC +   DE NC+   C+ ++  RC +   C     RCDG  DC DNSDEE C N      + D   +F C  N  CI  +++C+  NDCGD SDE P    +NC        C +NNG C QKC       +C C  GYR+     T C D++ECA+   CS  C N  G+++C C  G+ +  D + C A+G E  LL++ +  IR++   R  Y  +L + +N       I +DF ++ + +FW+        V +D ++    N      +V + + SP GLA DW+H  L+W+D   + I V N+    RK L+   N  K R+I +HP    I+WTDWG  P+IE   MDG  R+++    L+ PNGL +DY    +YWVDAK   I   NL    R+ V+S    H F I VFED LY +DW  + I   +K TGK + ++ +    PM +   H   QP   +N C   N  C +LCLP+  N      + C CP
Sbjct:   27 CGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCILPTCSPLD-FHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG--YCIRSLWHCDGDNDCGDNSDE--------------QCDMRKCSDKEFRCSDGS-CIAEHWYCDGDTDCKDGSDEENCPSAVPAPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGL---CINAGWRCDGDADC-DDQSDERNCTTSMCTAEQ-FRCHS-GRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALD---QFLCW-NGRCIGQRKLCNGVNDCGDNSDESP---QQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGHT-CQDVNECAEEGYCSQGCTNSEGAFQCWCETGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENA------IALDFHHRRELVFWSD-------VTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLL-WQNLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAG-KNRCGDNNGGCTHLCLPSGQN------YTCACP 725          

HSP 2 Score: 184.111 bits (466), Expect = 1.469e-46
Identity = 119/409 (29.10%), Postives = 178/409 (43.52%), Query Frame = 1
Query: 1069 KNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLV-SKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTG--KQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            KN C  NNG C   C+    +  C C  G+R                   + SH CA  L                        +KFLL++ +  IR +      +     P     +   + +D+D +  +++WT        V  D +  +K        +V + + SP GLA DW+   L+W+D   + I V N    MR  L+   N  + R IVV P    ++WTDWG  PKIE  GMD   R+V+I   L  PNGLA+DY    LYW DA  + I    L   +R+ ++     H F + ++ + +Y +DW  + I    + TG  ++ +  +    M + +FH+   PV+   A  N  C +LCL +     N   F C CP    LL+DGKTCSP  + F 
Sbjct:  699 KNRCGDNNGGCTHLCLPSGQNYTCACPTGFR------------------KISSHACAQSL------------------------DKFLLFARRMDIRRISFDTEDLSDDVIPLADVRS--AVALDWDSRDDHVYWTD-------VSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLI-WENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASGRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGERIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRRRPPVSTPCAMENGGCSHLCLRSP----NPSGFSCTCPTGINLLSDGKTCSPGMNSFL 1051          

HSP 3 Score: 166.777 bits (421), Expect = 3.722e-41
Identity = 112/363 (30.85%), Postives = 167/363 (46.01%), Query Frame = 1
Query: 1222 CSHKCANYL--GSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPT-SNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTG--NMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIEN-ACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            CSH C        + C C  G  +  D K C      FL+++ +  IR + L   Y   +  P N T  N + IG+D   +   ++W+            H +S+      +   ++ + + +  GLA D I   ++W+D   N I V N+   MRK LV   N    R+IV++ +   ++WTDWG+  K+E  GMDG DR VLI + L  PNGL +D     L W DA T +I   +L    R  +VS +  H + + + + ++Y +DW    I +  K TG   ILV S  P  M ++   + AQP+        N  C +LCLP          F C CP    L  DGKTC P+   + 
Sbjct: 1013 CSHLCLRSPNPSGFSCTCPTGINLLSDGKTCSPGMNSFLIFARRIDIRMVSLDIPYFADVVVPINITMKNTIAIGVD--PQEGKVYWSD--------STLHRISRANLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLV-WQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRAVLINNNLGWPNGLTVDKASSQLLWADAHTERIEAADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKGTGSNVILVRSNLPGLMDMQAVDR-AQPLGFNKCGSRNGGCSHLCLPRPSG------FSCACPTGIQLKGDGKTCDPSPETYL 1356          

HSP 4 Score: 156.377 bits (394), Expect = 6.505e-38
Identity = 107/365 (29.32%), Postives = 172/365 (47.12%), Query Frame = 1
Query: 1150 PGYR-IDSINETKCIDIDECAD-HMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTG-NMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPD 2229
            PG   + +++  + +  ++C   +  CSH C      + C C  G  +  D K C    E +LL+S++ SIR + L       ++ P    +N   I +D+D     +++T        + +       G NM+  T++   + +  GLA DW+   L+W+D   N I    +    RK L+   +  + R+I V P+   +FWTDWG   KIE   +DG +RKVLI   L  PNGL LDY    +YWVDA   +I   +L    R+ +VSH+ +H F +   + W+Y +DW  + I ++ K +G+ K  V +     + +     Q     NAC   N  C +LC   + +      F C CPD
Sbjct: 1294 PGLMDMQAVDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDGKTCDPSPETYLLFSSRGSIRRISLDTSDHTDVHVPVPELNNV--ISLDYDSVDGKVYYTDV-----FLDVIRRADLNGSNME--TVIGRGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLIN-NSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASD------FVCACPD 1641          

HSP 5 Score: 75.0998 bits (183), Expect = 6.494e-13
Identity = 45/122 (36.89%), Postives = 64/122 (52.46%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKN---KCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPE 456
            ++ CR  +F+C +G CI     CDG  +C D SDE      +C   E F C     +  +  CDG+ DC ++ D + C      +C++DQF+C      CI +  LCN  NDC D SDESP+
Sbjct:  228 HQPCRSGEFMCDSGLCINAGWRCDGDADCDDQSDERNCTTSMCT-AEQFRCHSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCALDQFLCWNG--RCIGQRKLCNGVNDCGDNSDESPQ 346          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 294.278 bits (752), Expect = 4.162e-85
Identity = 232/737 (31.48%), Postives = 358/737 (48.58%), Query Frame = 1
Query:  160 KCIPETLHCDGHDNCGDNSDEI------CDHRETFTCSD-----SNIILKTELCDGKADCDNDEDPKICVK--NKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNR-CKTIDSCYDNDQR----------CDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNN-TCIAFQRVCDKTN-DCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMS-KDNK--------QCLAVG-EKFLLYSTKNSIRELRLL-RHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPR-------------TLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIK-DGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHG-----FDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLE 2196
            KCIP    CDG  +C D SDE       C  ++ F C +     S  I +T +CDG+ DC N +D + C    +KC  + F C     NCI K  +C+   DCSDGSDE   A    N+  V QC     ++C + + CI   + CD + DC D SDEKNC                  Q T     EF C A     CI K + CDG  DC +   DE +C++         R C      Y  +            C+G  DC D  DE+ C+  +   V+C    E++C      CI   ++C     DCGDG+      K       +CK ++  C  +      +  C CK GY++++    +CIDI+EC    VC   C N  GSY+C C  G+ +S  D K        +C A+G +  +L + +++IR+  L+ + +  +  SP +       + +DF   +  + W+      +++    L    GN+                 L   +IH+P GLA DW+H LLFW+D   ++I+VL++ NG ++ L    +  + R+I V P+   IFWTDWGK+ +IE  GMDGQ R V+++ D +  PNGLALDY    +YW DAK + I   +   +  +++ + L++H      F + VFED L+ +DW+++ +I ++K TG   + ++     PM V+++H+ AQP+ ++N C N  C +LCLP ++  E
Sbjct:   92 KCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQ-FQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNG--NCIFKNWVCDGEEDCSDGSDELLTAPSNCNR-TVNQCPPGEMWKCGSGE-CIPSRWRCDAEVDCKDHSDEKNC---------------TAIQHTCKLAEEFACKASHN--CINKAFVCDGELDCSDG-SDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAP--VTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKKI---IEMCKPSSEGCVCRPSFVRGNNVCHCKDGYKLEN---GQCIDINECEIAGVCDQICLNIPGSYRCACHAGYQISFGDTKIGSGRIANKCRAMGGDPLVLLTNRHTIRQFDLVNKMHFPVSSSPGSA------VAMDFHILNGTLIWS------DVLSKQILKCSIGNVSNAFLGTDMCDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYS-SDLEEPRAIAVDPEVGLIFWTDWGKKARIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWADAKIKSIFSCD---YWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQAQPL-MQNKCENSECDHLCLPRAVYRE 780          

HSP 2 Score: 111.309 bits (277), Expect = 1.131e-24
Identity = 98/294 (33.33%), Postives = 130/294 (44.22%), Query Frame = 1
Query:  226 CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMC--------RTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN----SIHFQCE----NKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-----NCSNF--ECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            CD   +F C D   I  +  CDG  DC N+ED K C K  C  ++  C          +   CI    +C+   DC D SDE              QC N       FQCE    +  LCI   + CDG+ DC++  DE+NC                  +++ C +N F C  G+   CI K W CDG  DC +   DEL     NC+    +C P +  +C +   C  +  RCD   DC D+SDE+ C+   QH  +C    EF C  ++ CI    VCD   DC DGSDE
Sbjct:   32 CDATNSFQCQDGRCIPMSWRCDGDIDCQNEEDEKNCPK-VCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDE-------------FQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNC----------------TSKTSKCPDNNFQCSNGN---CIFKNWVCDGEEDCSDG-SDELLTAPSNCNRTVNQCPPGEMWKCGS-GECIPSRWRCDAEVDCKDHSDEKNCT-AIQH--TCKLAEEFACKASHNCINKAFVCDGELDCSDGSDE 287          

HSP 3 Score: 77.0258 bits (188), Expect = 5.366e-14
Identity = 64/228 (28.07%), Postives = 100/228 (43.86%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-------------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKIC--VKNKCSI-DQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEA---CEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNC----PDSENSKSKSQ---SLADLVKQSTICQNNEFYCGAGSTVPCIAKE 729
            +C    F C NG CI +   CDG ++C D SDE+             C   E + C     I     CD + DC +  D K C  +++ C + ++F C+    NCI+K  +C+   DCSDGSDE   A    E  +           +       +CI    +C+G+ DC D  DEK C    P +    ++ +   +    ++ S +C + +F CG G+   C  K+
Sbjct:  165 KCPDNNFQCSNGNCIFKNWVCDGEEDCSDGSDELLTAPSNCNRTVNQCPPGEMWKCGSGECIPSRWRCDAEVDCKDHSDEKNCTAIQHTCKLAEEFACKAS-HNCINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKK 391          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Match: T13C2.6 (pep chromosome:WBcel235:II:6783427:6788255:1 gene:WBGene00020481.1 transcript:T13C2.6b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:T13C2.6)

HSP 1 Score: 294.278 bits (752), Expect = 4.176e-85
Identity = 232/737 (31.48%), Postives = 358/737 (48.58%), Query Frame = 1
Query:  160 KCIPETLHCDGHDNCGDNSDEI------CDHRETFTCSD-----SNIILKTELCDGKADCDNDEDPKICVK--NKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNR-CKTIDSCYDNDQR----------CDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNN-TCIAFQRVCDKTN-DCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMS-KDNK--------QCLAVG-EKFLLYSTKNSIRELRLL-RHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPR-------------TLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIK-DGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHG-----FDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLE 2196
            KCIP    CDG  +C D SDE       C  ++ F C +     S  I +T +CDG+ DC N +D + C    +KC  + F C     NCI K  +C+   DCSDGSDE   A    N+  V QC     ++C + + CI   + CD + DC D SDEKNC                  Q T     EF C A     CI K + CDG  DC +   DE +C++         R C      Y  +            C+G  DC D  DE+ C+  +   V+C    E++C      CI   ++C     DCGDG+      K       +CK ++  C  +      +  C CK GY++++    +CIDI+EC    VC   C N  GSY+C C  G+ +S  D K        +C A+G +  +L + +++IR+  L+ + +  +  SP +       + +DF   +  + W+      +++    L    GN+                 L   +IH+P GLA DW+H LLFW+D   ++I+VL++ NG ++ L    +  + R+I V P+   IFWTDWGK+ +IE  GMDGQ R V+++ D +  PNGLALDY    +YW DAK + I   +   +  +++ + L++H      F + VFED L+ +DW+++ +I ++K TG   + ++     PM V+++H+ AQP+ ++N C N  C +LCLP ++  E
Sbjct:   94 KCIPNKWVCDGEFDCEDKSDEFQCKNVSCQEKQ-FQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNCTSKTSKCPDNNFQCSNG--NCIFKNWVCDGEEDCSDGSDELLTAPSNCNR-TVNQCPPGEMWKCGSGE-CIPSRWRCDAEVDCKDHSDEKNC---------------TAIQHTCKLAEEFACKASHN--CINKAFVCDGELDCSDG-SDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAP--VTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKKI---IEMCKPSSEGCVCRPSFVRGNNVCHCKDGYKLEN---GQCIDINECEIAGVCDQICLNIPGSYRCACHAGYQISFGDTKIGSGRIANKCRAMGGDPLVLLTNRHTIRQFDLVNKMHFPVSSSPGSA------VAMDFHILNGTLIWS------DVLSKQILKCSIGNVSNAFLGTDMCDKKHEIVLTGDKIHTPDGLAVDWVHDLLFWTDGGLDQINVLDMKNGKQRVLYS-SDLEEPRAIAVDPEVGLIFWTDWGKKARIERSGMDGQHRTVIVEGDRVVWPNGLALDYVDKRVYWADAKIKSIFSCD---YWGKNIKTVLHSHQYLRHPFSMAVFEDRLFYTDWEHDGVITVNKFTGADIRTVMDQVKSPMTVRIYHKQAQPL-MQNKCENSECDHLCLPRAVYRE 782          

HSP 2 Score: 111.694 bits (278), Expect = 1.014e-24
Identity = 97/295 (32.88%), Postives = 130/295 (44.07%), Query Frame = 1
Query:  226 CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKIC-VKNKCSIDQFMC--------RTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN----SIHFQCE----NKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-----NCSNF--ECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            CD   +F C D   I  +  CDG  DC N+ED K C +   C  ++  C          +   CI    +C+   DC D SDE              QC N       FQCE    +  LCI   + CDG+ DC++  DE+NC                  +++ C +N F C  G+   CI K W CDG  DC +   DEL     NC+    +C P +  +C +   C  +  RCD   DC D+SDE+ C+   QH  +C    EF C  ++ CI    VCD   DC DGSDE
Sbjct:   32 CDATNSFQCQDGRCIPMSWRCDGDIDCQNEEDEKNCPISEVCGAEEHKCGEVKSARSSLERFKCIPNKWVCDGEFDCEDKSDE-------------FQCKNVSCQEKQFQCEELSGDYSLCIPETWVCDGQRDCTNGKDEQNC----------------TSKTSKCPDNNFQCSNGN---CIFKNWVCDGEEDCSDG-SDELLTAPSNCNRTVNQCPPGEMWKCGS-GECIPSRWRCDAEVDCKDHSDEKNCT-AIQH--TCKLAEEFACKASHNCINKAFVCDGELDCSDGSDE 289          

HSP 3 Score: 76.6406 bits (187), Expect = 5.752e-14
Identity = 64/228 (28.07%), Postives = 100/228 (43.86%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-------------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKIC--VKNKCSI-DQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEA---CEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNC----PDSENSKSKSQ---SLADLVKQSTICQNNEFYCGAGSTVPCIAKE 729
            +C    F C NG CI +   CDG ++C D SDE+             C   E + C     I     CD + DC +  D K C  +++ C + ++F C+    NCI+K  +C+   DCSDGSDE   A    E  +           +       +CI    +C+G+ DC D  DEK C    P +    ++ +   +    ++ S +C + +F CG G+   C  K+
Sbjct:  167 KCPDNNFQCSNGNCIFKNWVCDGEEDCSDGSDELLTAPSNCNRTVNQCPPGEMWKCGSGECIPSRWRCDAEVDCKDHSDEKNCTAIQHTCKLAEEFACKAS-HNCINKAFVCDGELDCSDGSDEDDCADVRTECKSGERTCPASYGAYGAESGHVVCIPASSWCNGEEDCPDGGDEKECNMTAPVTCQKGTEYECPSTPLQCIEMSKLCASAQFDCGDGNMSVCSQKK 393          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Match: lrp-1 (Low-density lipoprotein receptor-related protein [Source:UniProtKB/Swiss-Prot;Acc:Q04833])

HSP 1 Score: 289.271 bits (739), Expect = 1.166e-80
Identity = 232/748 (31.02%), Postives = 341/748 (45.59%), Query Frame = 1
Query:  127 CRRFQFLCQNGK-CIPETLHCDGHDNCGDNSDE-----------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKI--CVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKD-ELNC-SNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDE--EFCSNPSQHNVSCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLA---VGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKK----TGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            C      C+N K CIP    CDG ++CGD SDE           +C  ++ F C +   I +   CD   DC +  D K+  C    C+ +QF C      CI    LC+ +NDC DG+DE  E C        VQC +++ F+C N + C+    +CDG+SDC D SDE +C  +  S                C  ++F C   S+  CI   W+CDG  DC +   + +  C S  +CS D+  +C     C  N+  CDG  DC D SDE  E     S +   C PF    C  +  TCI   ++CD    C  G+DE  GG+   C ++LC  +   C  KC N  +   C C  G ++  +N+TKC   +EC D   CS +C +    + C C EG+ +  D + C     V +  +  S +N I       H +D  ++      N   I + +D  +  I+W+      +I +   L +          +   +    G+A DW+   L+W D   N I V N+ +  ++TL+   N S+ R I V P+   +FWTDWG+ P IE   MDG DR++++K  ++ PN +ALDY  D +Y+ D+K   I   N     R  V+  S    H   + +FED +Y SD   +K +Q++ K    T  +    +  K +GV   H + QPV   N C  + C +LCL     L N   F C CP    L   GK C      F 
Sbjct: 1101 CAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVCAAKK-FQCDNHRCIPEQWKCDSDNDCGDGSDEKLEMCGNATCAANQFSCANG--RCIPIYWLCDGDNDCYDGTDEDKERCP------PVQC-SALQFRCANGRQCVPLRNHCDGQSDCEDGSDEDSCAVTAES----------------CTPDQFKCV--SSGLCIPASWKCDGQQDCDDGSDEPKFGCTSGRQCSSDQ-FKCGN-GRCILNNWLCDGENDCGDGSDESSERGCKTSMNARKC-PFEHVACENDQETCIPLHQLCDGKTHCPGGTDE--GGR---CARDLCSADRAGCSFKCHNSPNGPICSCPFGEQL--VNKTKCEPENECLDSSSCSQRCKDEKHGFTCSCDEGYELDVDKRTCKVADNVKDTRIYVSNRNRIY---YSDHKLDNWHTFGAIVEN--AIALAWDSLTDRIYWS------DIREKKILSANRNGTNATVFIADGLDITEGIALDWVGRNLYWVDSSLNTIEVANLEDPKQRTLLVHQNVSQPRGIAVDPRKGVMFWTDWGQNPCIERASMDGTDRQIIVKTKIYWPNTIALDYTTDRVYFADSKLDFIDFVNYDGSGRTQVLASSKFVQHPHALAIFEDMMYYSDRRLQK-LQVYPKYPNGTTSEYPSHTFSKALGVVAVHPVLQPVIKNNPCSTNPCSHLCL-----LNNKNTFTCKCPMGEKLDASGKKCIDDAKPFL 1793          

HSP 2 Score: 280.411 bits (716), Expect = 8.172e-78
Identity = 240/782 (30.69%), Postives = 365/782 (46.68%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDN--SDEIC--------DHRET-FTCSDSNI-ILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--------KNCPDSENSKSKSQSLA---------------DLV------KQSTICQNNEFYCGAG----STVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFC---SNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGN-CEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMV-CSHKCANYLGSYKCECFEGFYMSKDNKQCLAV---GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDG----QDRKV-LIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILV--SSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSE 2280
            C    F C NG CI +T  CDGH++C D   SDE          D R     C ++NI I   +LCDG  DC +  DE+   C+  +C+  Q   R     CI +T  C+ +NDCSDG DE+   C       +  C     FQC+N + CISR + CDG+ DC D SDE        + C D E   + +  LA               D+       + + +C+  +  C  G    S   CI   W CDG  DC +   +  NC+   C PD   +C     C  N  +CDG  DC D SDE+ C   S  +Q    C    +F+C  +  CI   +VCD+  DC D SDE     S  C  + C +     CEQKC++     KC C  G+ ID  ++  C +++EC + +  CS KC + +GSYKC C +G+ +S D+  C       E F L + K+ IR++ +  +  ++         N + + ID   K K     Q +     V +D + S   + +  T++   ++   G+A DW+   L+  +     I V  +     KTL+R     + ++IVVHP    +F+T+W  +P I  + +DG    QD    L +  L  PN +A+DY+ D L+W DA   +I   +     RR + +   +H   + VF+D+LY +DW+  ++++  K TGK + ++  +   P  +++ H + QP    N C   N  C +LCL  +        + C CPD   LL+D KTC P  +E
Sbjct: 2874 CAEGTFPCSNGHCINQTKVCDGHNDCHDEQVSDESLATCPGLPIDCRGVKVRCPNTNICIQPADLCDGYDDCGDKADENQLFCMNQQCA--QHYVRCPSGRCIPETWQCDGDNDCSDGWDETHTNCTDTAGKKI--CVGDYLFQCDNLK-CISRAFICDGEDDCGDGSDEHSRHGCGNRTCTDQEFHCTSNAKLAQPKYECIPRAWLCDGDVTCAGGEDESTELCKTEKKECNKGEFRCSNQHCIHSTWECDGDNDCLDGSDEHANCTYSSCQPDF-FQCAN-HKCVPNSWKCDGNDDCEDGSDEKDCPKNSASAQKASKCSN-GQFQCT-SGECIDDAKVCDRNFDCTDRSDE-----SSLCFIDECSLAEKPLCEQKCMDMKIGYKCDCFEGFAIDISDQKSCHNVNECYEGISGCSQKCDDKIGSYKCGCVDGYQLSSDDHSCKRTEMEPEPFFLLANKHYIRKISIDGNKYELA---AQGFDNVVSLDIDLTEK-KAYLIDQGKLRLLRVDLDEMDSPLSSYE--TVLRHNVYGTEGIAVDWVGRKLYMLNRQERSIRVCELDGRFCKTLIR-DRIQQPKAIVVHPGKGYLFFTEWSLQPYIGRIALDGSPELQDPIFKLAEHDLGWPNAIAIDYFSDRLFWGDAHLNEIGFMDFDGNGRRHIPAQRTSHVSSMVVFDDYLYWADWNLREVLRCDKWTGKNETILKKTVQLPNDLRIVHPMRQPA-YPNPCGDNNGGCSHLCLIGAGG----NGYTCSCPDQFVLLSDQKTCEPNCTE 3629          

HSP 3 Score: 270.011 bits (689), Expect = 2.380e-74
Identity = 207/705 (29.36%), Postives = 313/705 (44.40%), Query Frame = 1
Query:  244 FTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRT---KPMNCISKTSLCNHNNDCSDGSDES--PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLY--SPKNP-------TSNFLPIGIDFDYKSKNIFWTQFEPNPEI---VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA--HGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPK----PMGVKLFHQLAQP---------VNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            F C+D   I     CDG  DC + ED K C    C  DQ+ C T     ++CI++   C++  DC+DGSDE   P +         V C +   F C + + C      CDGK DC D SDEK+                  +  T C   +F C       CI K W CDGS DC +   +   C   +C+ ++  +CK    C     RCD Y DC DNSDE+ C         C P  ++ C     CI   ++CD + DC DG+DE      + C +NLC   +  C+  C       +C C  GY++D      C DI+ECA+   C   CAN+   + C C    +  +              Y   N+  +++L     + LY  +PKNP        S     GIDFDY  + IFWT    +      V  +  +S+   +  ++LVY R      LA DWI   L+  +     I V +  +G R+T++     +    I + P    +F+T+   + K+E   MDG +R+ L+       +G+ +D     +YWVD K  ++   + +   RR V   +N   H F + +F+ +LY +DW    +IQ+ K     K+L S+ +    PMG+  +H +AQP         + IEN C N  C+ +C+ +  N    + ++C CP    L+N GK C
Sbjct:   58 FRCNDGKCIRTEWKCDGSGDCSDGEDEKDCPHPGCKSDQWQCDTYTWHSVSCIAEYQRCDNITDCADGSDEKDCPAS--------TVDCSSQNVFMCADGRQCFDVSKKCDGKYDCRDLSDEKD---------------SCSRNHTACFQYQFRCA--DKTQCIQKSWVCDGSKDCADGSDEPDTCEFKKCTANE-FQCKN-KRCQPRKFRCDYYDDCGDNSDEDECGE-----YRCPP-GKWNCPGTGHCIDQLKLCDGSKDCADGADE------QQCSQNLCP--SLGCQAGCHPSPHGGECTCPSGYKLDDRFHRTCSDINECAEFGYCDQLCANHRPGFTCSCLGDCFTLQMEHGPGKDNLTMRGYCVSNNADKMKLFVARREGLYRLNPKNPDEEVKKLASGEFIYGIDFDYGDRKIFWTDRLAHSAFSADVDDEGEISQIKKLSLKSLVYPRC-----LAVDWITNTLYIIESGSRRIDVSSY-DGERRTVLLADGLTLPLDIALDPLRGEMFFTN---QLKLEAAAMDGTNRRTLVNTHTHQVSGIVVDITAKRVYWVDPKVDRLESIDYQGNDRRIVAQGMNVVPHPFGLALFDQYLYWTDWTRLGVIQVEKFGSDTKLLWSNTENNVFPMGISAYHPMAQPGPGQSECLAMKIENPCTNADCEGMCILSKDNGGFGVGYKCACPIGQKLVN-GKRC 711          

HSP 4 Score: 219.164 bits (557), Expect = 6.652e-58
Identity = 211/748 (28.21%), Postives = 335/748 (44.79%), Query Frame = 1
Query:  160 KCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSN-IILKTELCDGKADC--DNDEDPKIC--VKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELN--CSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDN--SDEEF--CSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKI--NNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGF-----YMSKDNKQCLAVGEKF-LLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTL---VYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKT----------------------LVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDY-YFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP---KPMGVKLFHQLAQPVN-IENACINHTCQYLC--LPTSMNLENYIKFRCICPD 2229
            +CIP    C+G D+C DNSDE       CD    F C+ S   I +  +CD + DC  ++DE    C      CS  +F C      CI  + +C+    CSDG DES   C +    P   QCD+           CI+   +CD K DC + +DE +C D              V + T C   EF C   +   CI +++ CDG  DC +   DE +  C + +C P    RC     C +  Q C+G+ DC  N  SDE    CS+ S++   C   ++FKC  N  C+     CD+ +DCGD SDE   G S++  K  C+   NNG C+  C +      C C+ G+R D  +  +CIDIDECA +  C+  C N  GSY C C E +       S   K C A G+   ++    +S+ +L L     +   + K    +   IGI FD + + ++W   + +   +    + +   + + + L     +    P  +A D+  G LF + +  N  + L      R +                       +  G+  +  +++  P   RI ++D G   KIEC  MDG  R++++KD +++P  +A+D    + +YWVD K R++   N+   +R  VV H     + +DVFE+ +Y    ++ K + +  K G+ ++ V +        V++  + A+      + C    C +LC  LP++        F C+CPD
Sbjct: 3805 RCIPNWAFCNGQDDCRDNSDEDKQRCPTCDDVGEFRCATSGKCIPRRWMCDTENDCGDNSDELDASCGGTTRPCSESEFRCNDG--KCIPGSKVCDGTIQCSDGLDES--QCTLRRCLPGHRQCDDGT---------CIAEHKWCDRKKDCPNAADELHCED--------------VSRRT-CSPFEFEC---ANSVCIPRKFMCDGDNDCGDN-SDETSSECRSAQCDPPLRFRCAHSRLCLNILQLCNGFNDCGPNDFSDEHLSMCSSFSEYG-DCSS-DQFKCA-NGKCVNGTVACDRKDDCGDASDEI--GCSKHGGKTSCEAFGNNGGCKHICTDVRDGFYCHCRDGFRPDPQSPKECIDIDECAGNNTCTQLCLNTKGSYLCRCHEDYENNVVVGSMTGKDCRAKGDAANVMIGADDSLVQLSLHGSGTNRHAAAKANDDDNDIIGIAFDPRKELMYW--IDGSERTIYRSAIANGNQSHEGQKLDVDFAAMGVVPTAIAVDYTTGNLFIAAVSENIENGLVTARKKRMSEPIDNQNTGFIFVCLPDGRYLKKIVAGHLQQPTALITAPSAGRICYSDAGLHAKIECADMDGTHRQIIVKDLVFSPTSMAIDEGKGNRIYWVDPKYRRVDAVNIDGSERTTVV-HDRHIPYAVDVFENHIYWLSRES-KTLYVQDKFGRGRVSVLASDLEDGHTVRVSQKYAKDTQRTVSGCERAQCSHLCVSLPST-------GFACLCPD 4504          

HSP 5 Score: 101.293 bits (251), Expect = 2.874e-21
Identity = 110/359 (30.64%), Postives = 140/359 (39.00%), Query Frame = 1
Query:  319 DPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSI----HFQCENKQLCISRIYYCDGKSDCSDQSDEKNC------------------PDSENSKSKSQSLADLVKQSTICQNNEFYCGAG----STVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERP---GGKSENCDKNLCKINNGNC---------EQKCINFYSHRKCL---CKPGYRIDSINETKCIDIDECADHMVCSHK--CANYLGSYKCE 1266
            D K C  N C+  QF C      CI K   C+   DC DGSDE  E+           C   I     FQC N   C      CDG  DC D SDE+NC                  P                +  T+C + E  C A     +   CIAK WRCD   DC +   +   C+  EC      RC +   C  N   C+G  DC DNSDE+      Q   +CD   EF+C  +  CI  + +CD  NDCGD SDE     GG +  C ++  + N+G C           +C +     +C    C PG+R       +C D    A+H  C  K  C N      CE
Sbjct: 3619 DQKTCEPN-CTERQFACGGDDAKCIPKLWYCDGEPDCRDGSDEPGESI----------CGQRICPVGEFQCTNHN-CTRPFQICDGNDDCGDSSDEQNCDKACDPWMFKCAATGRCIPRRFTCDGDDDCGDRSDEADTLCMSAERNCTAEEFRCNNNKCIAKAWRCDNDDDCGDGSDETPECAQIECKKGW-TRCSSSYRCIPNWAFCNGQDDCRDNSDED-----KQRCPTCDDVGEFRCATSGKCIPRRWMCDTENDCGDNSDELDASCGGTTRPCSESEFRCNDGKCIPGSKVCDGTIQCSDGLDESQCTLRRCLPGHR-------QCDDGTCIAEHKWCDRKKDCPNAADELHCE 3952          

HSP 6 Score: 99.7525 bits (247), Expect = 8.004e-21
Identity = 104/423 (24.59%), Postives = 166/423 (39.24%), Query Frame = 1
Query: 1078 CKINNGNCEQKCINF-YSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYS---PKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSK--TGNMKPRTLVYSRIHSPV--GLAYDWIHGLLFW--SDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLK-TFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVS------SPKPMG-VKLFH-----QLAQPVNIENACINHTCQYLCL-------PTSMNLENYIKFR-CICPDFSYLLNDG 2253
            C INNGNC+  CI   ++ R C C  GY  D                           G   C+ F+               E F++ +TK      +++ + +D   S      P       G+D+DY+SK I+        E   I+  ++    G   PR ++   I S     LA DWI+  +++   D     I V  +    RK L+     +   SI V P  R ++W D G++P I+   +DG  R+V++  G+  P  L +D     +YW DAK   I  Y ++ T    ++V    A    + +    +Y +D   EK+ +   K  +  +L+S      S K +G V +F      + + P  I +      C  LC        PT       +K R C  PD   + +DG
Sbjct: 2084 CHINNGNCDHICIPLMFAQRTCTCANGYVKD---------------------------GQTSCKLFD---------------ESFVIVATKT-----KVIGYPIDETQSKGVAMEPIGGLSITGVDYDYESKTIYVA------EASGINKGITAYTIGESSPRAVIRDSIGSLTIKSLAIDWINYNMYFINHDAERTNIEVSKLDGTYRKILLTTKTETP-SSIAVDPVSRYLYWADQGQKPTIQRSFLDGSRREVIVSSGIAEPTDLVVDVASKMIYWSDAKMDGI--YRVRSTGGTPELVRSDIASAAGVALHGQNMYWTDNRLEKLFRATSKPNQTSLLLSPTTVAASLKDIGDVAVFSSNNQPRASSPCQITDNLRKSPCTQLCFATPGTQTPTCSCARGVLKGRTCEEPDTYIMFSDG 2450          

HSP 7 Score: 94.7449 bits (234), Expect = 2.571e-19
Identity = 115/395 (29.11%), Postives = 166/395 (42.03%), Query Frame = 1
Query:  127 CRRFQFLC--QNGKCIPETLHCDGHDNCGDNSDE----ICDHR----ETFTCSDSNIILKTELCDGKADCDNDEDPKICVK------------NKCSIDQF-----------------MCRTKPMNCISKTSLCNHNNDC-------------SDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSEN-SKSKSQSLADLVKQSTICQNNEFYCG----------AGSTVPCIAKEWR------------CDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGG-KSENCDKNL 1077
            C   QF C   + KCIP+  +CDG  +C D SDE    IC  R      F C++ N     ++CDG  DC +  D + C K             +C   +F                 +C +   NC ++   CN NN C              DGSDE+PE  +I  K    +C +S          CI    +C+G+ DC D SDE  + CP  ++  + +  +    + +  +C + E  CG           G+T PC   E+R            CDG+  C +   DE  C+   C P   +R     +C    + CD   DC + +DE  C + S+   +C PF EF+C  N+ CI  + +CD  NDCGD SDE     +S  CD  L
Sbjct: 3627 CTERQFACGGDDAKCIPKLWYCDGEPDCRDGSDEPGESICGQRICPVGEFQCTNHNCTRPFQICDGNDDCGDSSDEQNCDKACDPWMFKCAATGRCIPRRFTCDGDDDCGDRSDEADTLCMSAERNCTAEEFRCN-NNKCIAKAWRCDNDDDCGDGSDETPECAQIECKKGWTRCSSSYR--------CIPNWAFCNGQDDCRDNSDEDKQRCPTCDDVGEFRCATSGKCIPRRWMC-DTENDCGDNSDELDASCGGTTRPCSESEFRCNDGKCIPGSKVCDGTIQCSDGL-DESQCTLRRCLPG--HRQCDDGTCIAEHKWCDRKKDCPNAADELHCEDVSRR--TCSPF-EFECA-NSVCIPRKFMCDGDNDCGDNSDETSSECRSAQCDPPL 4004          

HSP 8 Score: 73.1738 bits (178), Expect = 1.131e-12
Identity = 56/257 (21.79%), Postives = 110/257 (42.80%), Query Frame = 1
Query: 1429 PIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGK-------EPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLC 2172
            P+G++  + S N        N E  ++    SK  + K        I     +  DW+   ++++     ++  ++ T G   + +  G+ +   ++ + P    +FW+D G        EP+IE   + G  RKV++ + +  P  +A+D+    +YW D     I V +     R+ + S   A   DI  ++ WLY+SD  +  + +I K++G   + ++     P  +++F   +  V   N   N     LC
Sbjct: 2497 PVGVNISWFSMN--------NAENPRLVFGASKQPHAK-------EIRHISDMKLDWLTQKIYFTTGRGGKVMAID-TAGEHLSTIASGDWT--YALAIDPCSGLLFWSDSGYKTSGGLYEPRIERSNLAGGSRKVIVSESISLPAAIAVDFRNQKIYWADVNRLNIEVADYDGQNRKVIASGYRAKSLDI--WDRWLYMSDPLSNGVFRIDKESGSGLENVVSDRRIPGALRVFASESD-VRTRNQVCNALTSQLC 2732          

HSP 9 Score: 66.6254 bits (161), Expect = 1.098e-10
Identity = 59/179 (32.96%), Postives = 84/179 (46.93%), Query Frame = 1
Query:  613 ENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFEC-----SPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEE--FCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQ-KCINFY 1125
            EN+ S  +  A+ ++Q     + +F C  G    CI KEW+CDG  DC +   DE++    +C       +   +C+    C      CDG  DC D SDE+  +C +  +   +     +F+C  N+ CI  Q  CD  NDCGDGSDE    K E C    C  N  +C   +CI  Y
Sbjct: 1037 ENNHSCQKDPAEKIEQLCSSNSTQFQCKNGR---CIPKEWKCDGENDCLDE-SDEIDEKGDKCFHETECAENTIKCRNTKKCIPAQYGCDGDNDCGDYSDEDVKYCKDGQKPVCAA---KKFQC-DNHRCIPEQWKCDSDNDCGDGSDE----KLEMCGNATCAANQFSCANGRCIPIY 1203          

HSP 10 Score: 64.3142 bits (155), Expect = 4.808e-10
Identity = 87/372 (23.39%), Postives = 153/372 (41.13%), Query Frame = 1
Query: 1177 ETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIREL--RLLRHYMDMLYSPKNPTSNFLPIGIDF----DYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNIT-NGMRK--TLVRLGNHSKVR---SIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSH--LNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLA-----QPV---NIENACINHTCQYLCLPT-SMNLENYIKFRCIC 2223
            E  C + D C    + S     +   YKC C  G  +  + K+C+   + +LL+S+   +R +   +    +     P +P S    IG+ F    D    + F+     N       + +   G      LV +       +++DWI   L++ D   N + V+ I   G+     LVR    +++R   S+VVHP    +F+ +  +   I    +DGQ+ +V+    L  P+ +A+D+  + L W D   + IS  +   F  ++VV     N     I +  +++Y        I ++HKK G    +V         +F   A     QP+   + E+ C    C  LC  T S +  N ++ +C C
Sbjct:  670 ENPCTNAD-CEGMCILSKDNGGFGVGYKCACPIGQKLV-NGKRCIDSID-YLLFSSNKIVRGIFPEINEKALAEAVLPISPISQRR-IGMYFEVECDVHGNSFFYADIMDN-----TIYRIRPDGEGAAPVLV-THNDGLFSMSFDWISKQLYYVDNIRNSLEVVKIGETGLVHPDELVRRQLITELRDPVSVVVHPWKGLLFYAEAMRPAAIYRCHIDGQNCQVIRNTTLGRPSEMAIDFAENRLCWGDTLLKTISCMD---FDGKNVVKLDIDNPIPVAITIMNEYIYYVHQRPYSIRRVHKKNGGGSKIVREFGADERSIFSLKACSHQNQPIPDDSREHPCRASQCTQLCFATPSESHPNELEAKCAC 1028          

HSP 11 Score: 53.1434 bits (126), Expect = 1.269e-6
Identity = 54/176 (30.68%), Postives = 73/176 (41.48%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESP----EACEIINKPLVVQ--CDNSIHFQC---ENKQLCISRIYYC-------DGKSDCSDQSDEK 597
            Y  C+   F C N KC+P +  CDG+D+C D SDE                          DC  +        +KCS  QF C +    CI    +C+ N DC+D SDES     + C +  KPL  Q   D  I ++C   E   + IS    C       +G S CS + D+K
Sbjct: 3137 YSSCQPDFFQCANHKCVPNSWKCDGNDDCEDGSDE-------------------------KDCPKNS-ASAQKASKCSNGQFQCTSG--ECIDDAKVCDRNFDCTDRSDESSLCFIDECSLAEKPLCEQKCMDMKIGYKCDCFEGFAIDISDQKSCHNVNECYEGISGCSQKCDDK 3284          

HSP 12 Score: 51.6026 bits (122), Expect = 3.736e-6
Identity = 30/85 (35.29%), Postives = 44/85 (51.76%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTC--------SDSNIILKTELCDGKADCDNDEDPKICVKNKC 348
            +K+C   +F C+N +C P    CD +D+CGDNSDE  D    + C           + I + +LCDG  DC +  D + C +N C
Sbjct:  220 FKKCTANEFQCKNKRCQPRKFRCDYYDDCGDNSDE--DECGEYRCPPGKWNCPGTGHCIDQLKLCDGSKDCADGADEQQCSQNLC 302          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Match: lrp-2 (Low-density lipoprotein RecePtor related [Source:UniProtKB/TrEMBL;Acc:O01768])

HSP 1 Score: 248.825 bits (634), Expect = 1.653e-67
Identity = 220/744 (29.57%), Postives = 324/744 (43.55%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHR-------ETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNK-CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCEN-KQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSC---DPFNEFKC-VKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK--FLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDY---KSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE-PKIECMGMDGQDRKVL-----IKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN-----AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVS--SPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDG 2253
            +C   +F C    C+P    CDG  +C D +DE   IC            F CS +  I+K++ C+G  +CDN  D + C ++K C  D+F C T    CI ++ +C+    C DG DE  E C    K     C     F+C N K  C+  I+ CDG +DC D SDE +    E  K  S S        T  + N+F C  G    C+     CDG  DC  T +DE  C    C       C     C      CDG  DC DNSDE+ C+       +     P   ++C   N  CI+ + +CD TNDC +G DE        C  N    ++  C   C        C C   + +D  N   C   D C     CS  C+ +  S+ C C + F +  D   C++   +  FL+YS ++ IR ++    Y   L    N  +    I +DF Y    S +I+WT    +        LV +   +  RT+V   + +  G+A DWI G ++W D   + I V++  +G ++  V   N    RS+ +  +   +FWTDW +  P+IE   + G +R ++     I    W PNG+ALD     +YW DAK+  I      T+  RD V          H F IDV+E  +Y SDW    I ++ K  G    ++   + +P  +K+ H+  Q + I+N+C    C  +CL    N     K  C C +     +DG
Sbjct:  968 KCVGNKFQCDGTTCLPMEFICDGKSDCYDGTDELEKICKKAPIVKCSVSQFQCSKTKCIIKSKRCNGVQECDNGADEEDCPRSKLCDPDEFRCGTGL--CIKQSQVCDGKMQCLDGLDE--EHCNEEEK-----CLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESD----EFCKGNSSS--------TCGKMNQFMCADGK---CLRSFQLCDGFPDC-LTGEDETECPPSMCDSTTHLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIRLDEAALRCQSPM--YQCDGPNFKCISDKHLCDGTNDCEEGDDE-----GLWCTFNCTDADDLGCSHTCRPTPVGPICSCPDDHYLDK-NGVTCSKKDPCR-FGQCSQYCSPHGSSHFCYCEDSFKLGADRSSCISDDPRKPFLIYSNRHEIRMIQ--SKYPGSLPMITNLVN---AIALDFKYHQNGSVSIYWTDLSADKIYTG---LVDQRTILYQRTIVSYGVFNAEGIAVDWISGNIYWIDSFLDTIQVVS-EDGTKRATVINQNMGNARSLAIDVEEGFMFWTDWEESNPRIERASLAGNNRAIIWKISNIAQAGW-PNGIALDTIAKRVYWADAKSDSIHTI---TYDGRDHVIVFRDPERLGHCFGIDVYEGHVYFSDWRTNTISKVDKWFGSNVSIIERVATQPFSLKIVHRSKQKMQIKNSCDGFKCNGICLNNGKN-----KATCQCTNLQSTTDDG 1659          

HSP 2 Score: 231.491 bits (589), Expect = 7.222e-62
Identity = 223/816 (27.33%), Postives = 343/816 (42.03%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSL------CNHNNDCSDGSDESPEACEIINKPLVVQ----CDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSE--------NSKSKSQSLADLVKQSTICQN--NEFYC-------GAGSTVPC-----IAKEWRCDGSYDCPETYK----DELNCSNFECSPDKPNRCKT---IDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE-----------RPG-------------------------------GKSENCD--KNLCKINNGNCEQK--CINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLG-SYKCECFEGFYMSKDNKQCLA--VGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKD-GLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK-QKILVSSP--KPMGVKLFHQLAQPVN----IENACINHT-CQYLCLPTSMN--LENYIKFRCICPDFSYLLNDGKTC 2262
            + CR   F C NG CIPE   C+  ++C + +DE    C+  E F C     I     C+   DC++  D   C    CS       T  +NC + +        C+  NDC DGSDE     E       V     CD    F C   + C+ + + CDG+ DC+D SDEKNC   +         S  K   L         C +  +E  C       G  +T  C     I   WRCDG+ DC +  K    DE++C+    S   P+RC     + +C      CDG  DC+D  DE+ C++  +    C P NE+ C  +  CI   R+CD + DC DGSDE           R G                               G  E CD  +  C     +C+Q   C        C C  GY +   ++  C+    C     CSH C +     ++C C  G+ +S++ K C      E  +L    + ++   +  H    L S  N T+    + +D+D KS  ++WT    +     I  + ++      R +         G+A DW+   ++++D + + I+V ++     + L++    +  R+IV+ P    +FWTDWG    I  M MDG + +V+++D  +  PN LA+D     LY+ DA    I+  N    +RR V+     H F + VFED++Y SDW N  I ++HK TG  +K+L+     +PMG K+ H   Q +       + C     C  LC+P +      +   F C+C       ++G++C
Sbjct: 2679 RVCRPGYFNCGNGLCIPEQKVCNRINDCANFADESNCTCNENE-FRCQSGACIPSKARCNHMQDCNDASDEIGCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKTQFACLATRTCMPKHWQCDGQPDCADGSDEKNCDAKKCTSFEFSCESSKKCIPLEQKCDGRRDCPDGEDEHQCETECDSKGGNATFRCTNHRCIPMAWRCDGTDDCMDNAKSLGSDEVDCAAGRTSFHVPSRCADETCVVACELTAVLCDGIQDCSDGFDEKNCASLDRQ---CKP-NEWMC-DSGQCIDSGRLCDASVDCVDGSDEWVEICSLSEPPRRGCPSGWSCLLTNGTIGCLQEQQLCDGRRDCMSGIDEQCDNPQGNCSSTRNSCDQTWNCQRHAGFESCSCDDGYHLSPYDKKTCLRSPSCP-KANCSHFCIDRRDVGHQCFCAPGYILSENQKDCRRNDTIEAEILMVYGHRLKLFTIDGHAKATLLS--NLTNG---VALDYDVKSDLVYWTDVAHDGNKAGITSMSNQPNTY--RVINSLPTKGIDGIAVDWLGRNIYYTDRNHDAIAVCDMRGRFNRILLKGTPLNDPRAIVLDPLQALVFWTDWGASAHIGRMNMDGSNEQVILQDRTIRWPNALAVDAPAQRLYFGDAHRDYIASCNYDGSKRRMVLRGSVRHIFALAVFEDYVYWSDWHNHTIERVHKITGTNRKVLIQDKQYRPMGFKIVHPSLQSMGSLKTARHPCSQPARCDNLCIPANTPDLTTSSDNFTCMCA--QGFRSEGRSC 3478          

HSP 3 Score: 178.333 bits (451), Expect = 5.997e-45
Identity = 201/732 (27.46%), Postives = 293/732 (40.03%), Query Frame = 1
Query:  127 CRRFQFLCQNG----KCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLA-------DLVKQSTICQNN---EFYCGAGSTVPCIAKEWR-CDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQ-------RCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKC-ANYLGSYKCECFEGFYMSK-DNKQCLAVGEKFLLYSTK-NSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGL-AYDWIHGLLFWSD-------IHFNE---ISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDG-----------QDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS-HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINH 2154
            C+   F C NG    KCIP+  +CDG D+C +  DE         C H E F C+    I K   CDG  DC +  D K C K +C+I   +C     +C+    LC+    C+DGSDE  EAC I  K L+ +         EN++      + CDG  DC D SDEK CPD E   + ++SL           K    C NN    F+  +  T+    KEW+ CDG +DC     D L+ S   C+  K  RC  I  C D  Q        CDG  DC D SDE    NP      C    +++C  N  CI     CD  +DCGDGSDE   G                                                  EC    VC+ KC   +  + +C C  G+  +K D  +C  + +   ++ T  N +  + L    + +L    N   N +P GIDF Y   ++F T       I      +            +    S  GL  YD++H  +++++       + F+    I V    +   +TL+ + +   + S+ V P  R IFWT     P+I    +DG           Q  K L++  ++ P  + LD+  + LYW+D   R I   +     RR V    L      +DV   ++YL       I ++HK TGK    V   + +  ++  ++A P     + I H
Sbjct: 3614 CKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTH-EQFQCTSGKCIPKRRQCDGTLDCRDGSDEKGC-KKECAI---VCDN---SCVHADDLCDGKKKCNDGSDEDEEACVI--KQLLEK---------ENRKC---GGFACDGIVDCEDGSDEKGCPDLECHLASNKSLICDGTIDCSSGKDENNCHNNGESNFFQCSMQTI----KEWQVCDGRWDC----ADGLDESPEMCASRKA-RCFRIGYCDDKKQCLDVSTALCDGIRDCFDGSDE----NPIHCKDMCK--GKYRCT-NGRCIDVSARCDGRDDCGDGSDEDTCGA-------------------------------------------------ECHHFGVCAQKCWMAFNHTARCHCAPGYARTKNDENECEPLSKSAEMFITNGNRLHLMSLENSQVSVLRPVFNIKMNLIPGGIDFGY---DVFRTTLMYTVGIGNSRVDIRSKKWSDGLIGSWGEEESTAGLITYDFMHNNVYFTESSEQNRGVLFDRQANIYVAKAKDTSTRTLI-VNSTGTINSLAVDPIKRLIFWTTSAPVPRILSANLDGKPIAQPFKTGSQPHKALVERNIFEPTSMVLDFSNERLYWIDVLKRTIETVSFDGRDRRTVRKFELGDTPVTMDVLGGYIYLITRQGS-IHRMHKFTGKTNKYVQKIREVSPRIQIRVAHPAKHTVSHITH 4253          

HSP 4 Score: 100.908 bits (250), Expect = 4.007e-21
Identity = 100/322 (31.06%), Postives = 143/322 (44.41%), Query Frame = 1
Query:  121 KRCRRFQFLC-QNGKCIPETLHCDGHDNCGDNSDEICDHRET-------FTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFN---EFKCVKNNTCIAFQRVCDKTNDCGD-----GSDE 1038
            K+C   +F C  + +CI     CD +++C    DE   +  T       F C +   I + ++C+   DC N  D   C    C+ ++F C++    CI   + CNH  DC+D SDE    C   N   + +   +    C     CI   + CDG +DC D SDEK+C    ++   S S        T     +F C A  T  C+ K W+CDG  DC +   DE NC   +C+  + + C++   C   +Q+CDG  DC D  DE  C         CD       F+C  N+ CI     CD T+DC D     GSDE
Sbjct: 2637 KKCAENEFKCLHSDRCIRYEDTCDRYNDCPMFDDEDTKYCSTRVCRPGYFNCGNGLCIPEQKVCNRINDCANFADESNCT---CNENEFRCQSGA--CIPSKARCNHMQDCNDASDEI--GCPFRNCSALNEFGMTGLINCATTSQCIHPSWKCDGTNDCYDGSDEKDCFVEFDATGGSVSAPRSCDAKT-----QFACLATRT--CMPKHWQCDGQPDCADG-SDEKNCDAKKCTSFEFS-CESSKKCIPLEQKCDGRRDCPDGEDEHQC------ETECDSKGGNATFRCT-NHRCIPMAWRCDGTDDCMDNAKSLGSDE 2935          

HSP 5 Score: 100.523 bits (249), Expect = 4.909e-21
Identity = 83/261 (31.80%), Postives = 113/261 (43.30%), Query Frame = 1
Query:  286 CDGKADCDNDEDPK-----ICVKNKCSIDQFMCRTKPMN----CISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVP-CIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            CDG+ DC + ED       +C    C   QF+C     N    C+  + LC+   DCS G DE P  CE        +C  +  F+C +K+ CI     CD + DC D SDE NC                  + T C+ + F C  G+ +  CI KE+ CDG  DCPE   +  +C        +  +C T   C    ++CDG  DC D SDE+ C              E   V +N+C+    +CD    C DGSDE
Sbjct: 3502 CDGQDDCGDGEDEGYFVEGVCPPFPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFCENF------ECTEA-QFKCGDKKKCIPLTSVCDKEKDCDDGSDELNC------------------EITSCKPDFFACFNGTAISKCIPKEFYCDGEDDCPEGQDEPDSCFGIGECTHEQFQC-TSGKCIPKRRQCDGTLDCRDGSDEKGCK------------KECAIVCDNSCVHADDLCDGKKKCNDGSDE 3724          

HSP 6 Score: 88.1965 bits (217), Expect = 3.168e-17
Identity = 79/248 (31.85%), Postives = 112/248 (45.16%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGD-------NSDEICDHRETFTCSDS-----NIILKTELCDGKADCDN--DEDPKICVKNKCS----IDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES--PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECS 804
            K C   +F C  G CI ++  CDG   C D       N +E C     F C++      ++I +   CDG ADC++  DE  + C  N  S    ++QFMC      C+    LC+   DC  G DE+  P +           CD++ H  C N Q CIS+   CDG  DC D SDEK+C +             L + +  CQ+  + C  G    CI+ +  CDG+ DC E   + L C+ F C+
Sbjct: 1051 KLCDPDEFRCGTGLCIKQSQVCDGKMQCLDGLDEEHCNEEEKCLQGRQFRCANGKSTCLDLIFR---CDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADG--KCLRSFQLCDGFPDCLTGEDETECPPS----------MCDSTTHLSCLNGQKCISKQLECDGVDDCGDNSDEKHCTEIR-----------LDEAALRCQSPMYQCD-GPNFKCISDKHLCDGTNDCEEGDDEGLWCT-FNCT 1270          

HSP 7 Score: 84.3445 bits (207), Expect = 4.102e-16
Identity = 81/367 (22.07%), Postives = 153/367 (41.69%), Query Frame = 1
Query: 1219 VCSHKCANYLG-SYKCECFEGFYMSKDNKQCLAVG-----EKFLLYSTKNS-IRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE--------PKIECMGMDGQDRKVLI-KDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKI--IQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIK-FRCICPDFSYLLNDGK 2256
            +C   C  ++  +  C C +G+   ++N +C A       E F+L   + S I+ L   ++Y   +    +  +   P  + FD K + +       +  +VQ      K G+        + I +  G+AYD+    L+ +D     I+V  ++N   + +V  GN S  R+I +H     +FW  W ++          IE   +DG +RK L+ K+ +W  NGL LD   D LYW DA    I         R  VV   +  +H + +  F++ ++ +++    +  + +      Q++   S     + +F           +  ++ C++ C  +S       +  +C C D   +L +GK
Sbjct:  555 MCDDMCIGHINQTSSCFCRDGYI--QNNTKCSASKDLKDEELFVLAQLRPSRIKILGFDKNYRTEIIGVSDLLNVKRPSAMTFDPKGEQLLMYDLRRHSLVVQ------KIGSTNYTVHGLTGIMNCEGMAYDFTSDNLYMTDQRRKIITVQRLSNLSIQKVVVSGNMSNPRAIAIHIAKSYLFWGSWNEDNNDDEKIPAMIERSKLDGSERKTLVSKNAMWI-NGLTLDLKNDYLYWCDAYRNVIERIRWNGADREVVVHGADKISHPYGLAFFDNHIFYTEFKKGAVKRVNVDFPDDVQEVFQYSATVFELLVFKNSNPETTSPCSTSSNICEHFCFASSCKGSVGCEPVKCGCADGMKVLKNGK 912          

HSP 8 Score: 67.781 bits (164), Expect = 4.381e-11
Identity = 113/484 (23.35%), Postives = 179/484 (36.98%), Query Frame = 1
Query:  715 CIAKEWRCDGSYDC------PETYK-----DELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINN----GNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHM-----VCSHKCA-NYLGSYKCECFEGFYMSKDNKQCLA-----VGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIG-IDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQ---DRKVLIKDGLW-----------------TPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFD-IDVFEDWLYLSDWDN 2022
            C  ++W CDG  DC      P T K     +E  C   +C P    R    DS YD  +  +G  D +D +  E C+ P    + CD +NE+ C K+  C+   + CD   DC DGSDE           ++C + +     +CE          KC C     ++   + KC  ++ C         VCS  C  N  G++ C CF+      +   C+A     +    +L   K  + +   +  Y  M      P +  L I   DF   +  I      P+     I          +P T  Y+     +      IH ++ + +I  N I     T+      +   N  ++ S       R +   D G    ++  G++GQ       +++ G+W                 T   LA+D + + LY+VD   R I   +      R +VS   A     ID  E  L+L+  DN
Sbjct:   54 CYPEQWYCDGFPDCQDSSDEPSTCKRTCLENEFVCKTGKCLP----RGYLCDSQYDCGRLPNGDRDLSDEA-PELCNQP----LHCD-YNEYACSKSAQCVPLFKFCDGKRDCSDGSDEH----------SMCHVEDPKTADSCEYGAAMTIDGIKCYCPKNKFLN--EQGKCEFVNHCERTKNGLPPVCSQDCTDNKNGTFTCSCFDPRLTVVNGTHCVADKDQTIPSVAILTKKKLFVLQKNKMSSYSSMPRPLGKPGAMTLVIQHPDFPEATVPILCLSESPSANDSYI--TCGNVEGSEPATKTYA-----IDFDLSSIH-IIRFDNIGNNWI----FTDASYYVFICKHNSVRISSC------RTVTAGDMGTIQDMKYDGLNGQLLVSEVDVLQQGIWRIDVASGQRYRLSYQPITSPALAIDPFTETLYFVDIGARSIKAVDYNANYSRTIVSGRIAKEVKMIDYAEGRLFLTLKDN 497          

HSP 9 Score: 64.3142 bits (155), Expect = 5.995e-10
Identity = 65/197 (32.99%), Postives = 83/197 (42.13%), Query Frame = 1
Query:  571 DCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCP----ETYKDELNCSNFECSPDKPNRCKTIDS----CYDNDQRCDGYPDCTDNSDEE--FCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKIN-----NGNCEQKCI 1116
            D +  SD   C  ++  +S+ +S        + C+ N+F C    T  CI+  WRCDG  DC     E Y  E  C  F C   +    +T  +    C    + CDG  DC+   DEE  FC      N  C    +FKC     CI    VCDK  DC DGSDE       NC+   CK +     NG    KCI
Sbjct: 3455 DLTTSSDNFTCMCAQGFRSEGRSCV------SECKPNDFVCT--KTYKCISSWWRCDGQDDCGDGEDEGYFVEGVCPPFPCIAGQFVCGRTAQNATAQCLYASKLCDGVKDCSGGDDEEPAFC-----ENFECTE-AQFKCGDKKKCIPLTSVCDKEKDCDDGSDEL------NCEITSCKPDFFACFNGTAISKCI 3631          

HSP 10 Score: 63.1586 bits (152), Expect = 1.064e-9
Identity = 45/187 (24.06%), Postives = 89/187 (47.59%), Query Frame = 1
Query: 1585 LAYDWIHGLLFWSDIHFNEISVLNITNG-------MRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWG-KEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA---HGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLF 2106
            +AYD +H  L++   +   I  +N+ +          K ++ L    + R I +HP    +F+T+       IE +   G  R  ++++ L    GL +D   + LY+ D+K  KIS  +     R  VVS+ +    H F++ +++D +  +DW    ++ ++K TG   + I  ++  P+G+ + 
Sbjct: 2396 MAYDEVHTELYFVRANPASIWRINVADNNLESYPTEPKIVLTLTVRDRPRHIAIHPCRMLLFFTNNAITGSVIERVYFSGFKRDQIVQEDLHDLRGLTIDLDSEKLYFSDSKDFKISRCDFDGSHRELVVSNTDIPSIHPFELSIYDDEIIFTDWVRRSVVGVNKITGSDNRNINRATDVPVGLVVV 2582          

HSP 11 Score: 60.077 bits (144), Expect = 1.038e-8
Identity = 43/121 (35.54%), Postives = 60/121 (49.59%), Query Frame = 1
Query:  286 CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCS-------DGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKS 627
            CDG  DC +  D     K  C  ++F+C+T    C+ +  LC+   DC        D SDE+PE C   N+PL   CD +  + C     C+    +CDGK DCSD SDE +    E+ K+
Sbjct:   61 CDGFPDCQDSSDEPSTCKRTCLENEFVCKTG--KCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELC---NQPL--HCDYN-EYACSKSAQCVPLFKFCDGKRDCSDGSDEHSMCHVEDPKT 173          

HSP 12 Score: 54.299 bits (129), Expect = 6.527e-7
Identity = 84/296 (28.38%), Postives = 116/296 (39.19%), Query Frame = 1
Query:  493 CDNSIHFQCENKQLCISRIYYCDGKSD------------CSD--------QSDEKNCPDSE---NSKS----KSQSLADLVKQSTI--CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFE-CSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKN-NTCIAFQRVCDKTNDCGDGSDER----PGGKSENCDK-NLCKINNGNCEQK---------CINFYSHRKC---LCKPGYRIDSINETKCID-------IDECADH 1215
            CDN I F C N + C+ +   CDG  D            C D        Q D   C   E   + KS     +  L  + K++ I  C  ++F C   S   CI K  RC+G  +C +   DE +C   + C PD+  RC T   C    Q CDG   C D  DEE C+   +    C    +F+C    +TC+     CD   DC D SDE      G  S  C K N     +G C +          C+      +C   +C     +  +N  KCI        +D+C D+
Sbjct:  925 CDNEIEFTCLNSKKCVPKSNLCDGDDDCGDGSDEDANGICKDYKCVGNKFQCDGTTCLPMEFICDGKSDCYDGTDELEKICKKAPIVKCSVSQFQC---SKTKCIIKSKRCNGVQEC-DNGADEEDCPRSKLCDPDE-FRCGT-GLCIKQSQVCDGKMQCLDGLDEEHCNEEEK----CLQGRQFRCANGKSTCLDLIFRCDGVADCEDSSDESDEFCKGNSSSTCGKMNQFMCADGKCLRSFQLCDGFPDCLTGEDETECPPSMCDSTTHLSCLNGQKCISKQLECDGVDDCGDN 1210          

HSP 13 Score: 53.9138 bits (128), Expect = 6.983e-7
Identity = 37/111 (33.33%), Postives = 54/111 (48.65%), Query Frame = 1
Query:  160 KCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCD---------NDEDPKICVKN-KCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE 447
            KC PE  +CDG  +C D+SDE    + T     F C     + +  LCD + DC          +DE P++C +   C  +++ C +K   C+     C+   DCSDGSDE
Sbjct:   53 KCYPEQWYCDGFPDCQDSSDEPSTCKRTCLENEFVCKTGKCLPRGYLCDSQYDCGRLPNGDRDLSDEAPELCNQPLHCDYNEYAC-SKSAQCVPLFKFCDGKRDCSDGSDE 162          

HSP 14 Score: 50.447 bits (119), Expect = 9.062e-6
Identity = 79/294 (26.87%), Postives = 105/294 (35.71%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTE------LCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN---SIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPD---SENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCK---------TIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSC 939
            K C++   +  +  C+     CDG   C D SDE     +   C    ++ K         CDG  DC++  D K C   +C +             +K+ +C+   DCS G DE+              C N   S  FQC  +   I     CDG+ DC+D  DE   P+   S  ++       D  KQ          C   ST         CDG  DC            F+ S + P  CK         T   C D   RCDG  DC D SDE+ C     H   C
Sbjct: 3691 KGCKKECAIVCDNSCVHADDLCDGKKKCNDGSDE-----DEEACVIKQLLEKENRKCGGFACDGIVDCEDGSDEKGCPDLECHLAS-----------NKSLICDGTIDCSSGKDEN-------------NCHNNGESNFFQCSMQT--IKEWQVCDGRWDCADGLDES--PEMCASRKARCFRIGYCDDKKQ----------CLDVSTA-------LCDGIRDC------------FDGSDENPIHCKDMCKGKYRCTNGRCIDVSARCDGRDDCGDGSDEDTCGAECHHFGVC 3922          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Match: rme-2 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:O44191])

HSP 1 Score: 198.749 bits (504), Expect = 3.656e-52
Identity = 182/692 (26.30%), Postives = 294/692 (42.49%), Query Frame = 1
Query:  358 QFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCP--------DSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCS-----NFECSPDKPNRCKTIDSCY--DNDQRC-DGYPDCTDN------------------------------SDEEFCSNPSQHNVSCDPFNEFKCVKNNT----CIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADH-MVCSHKCANYLGSYKCECFEGFYMSKDNKQC----LAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPI-GIDFDYKSKNIFWT----QFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNI--TNGM--RKTLVRLGNHSKVRSIVVHPKYRRIFWTD-WGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKI-IQ--IHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPD 2229
            +F C    + CI     C++  DC +G DES   C   +      C  S    C+N  LC++  + CDG+ DC D SDE++C         D  N  + +  +         C      C +G    CI  +  CDG  DC     DE+NC+     N + S D  +    +D  +  + D +C  GY  C                                 S+EE+ S  + H  SC     + C    +    CI     C+   +C  G DE     S++C +   K     C+  C+N     +C+C+ GY++     T C D DECA H  +C H C + LGS+ C+C  G+ +  D   C        E +L  S    +R++ L        YSP    +    I  IDF +++  +F +      +P  E+      VS  G M+   ++   +     +A DWI G +F++    +  + ++I   +GM  R+ +         R +VVHP    I W D + K  +I    MDG   ++L+ + L  P+ LA+DY   D+Y+ D + + I   N+ T +RR V+S+   H +D+  F  +LY +DW +E + +Q   H  +  Q I   +  P G+ + H L Q     N C+   C +LC+    + +  +  +C+CPD
Sbjct:   37 EFDCGNGRLRCIPAEWQCDNVADCDNGRDES--GCSYAH-----HCSTSFML-CKNG-LCVANEFKCDGEDDCRDGSDEQHCEYNILKSRFDGSNPSAPTTFVG---HNGPECHPPRLRCRSGQ---CIQPDLVCDGHTDC-SGGDDEVNCTRRGHENMQSSTDFHDDVHLVDPTFFANEDNKCRSGYTMCHSGDVCIPDSFLCDGDLDCDDASDEKNCQTNAPSEEEYLSGQADHMHSCSAAGMYSCGTKGSEIGVCIPMNATCNGIKECPLGDDE-----SKHCSECARK----RCDHTCMNTPHGARCICQEGYKLADDGLT-CEDEDECATHGHLCQHFCEDRLGSFACKCANGYELETDGHSCKYETTTTPEGYLFISLGGEVRQMPLADFTDGSNYSPIQKFAGHGTIRSIDFMHRNNKMFMSISDEHGDPTGELS-----VSDNGLMR---VLRENVIGVSNVAVDWIGGNVFFTQKSPSPSAGISICTMSGMFCRRVIEGKEQGQSYRGLVVHPMRGLIIWIDSYQKYHRIMMANMDGSQVRILLDNKLEVPSALAIDYIRHDVYFGDVERQLIERVNIDTKERRVVISNGVHHPYDMAYFNGFLYWADWGSESLKVQEMTHHHSSPQVIHTFNRYPYGIAVNHSLYQTGPPSNPCLELECPWLCVIVPKS-DFIMTAKCVCPD 693          

HSP 2 Score: 60.8474 bits (146), Expect = 4.733e-9
Identity = 56/155 (36.13%), Postives = 68/155 (43.87%), Query Frame = 1
Query:  628 KSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFC-----------SNPSQ------HN-VSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            K+ + A  V  ST  Q  EF CG G  + CI  EW+CD   DC +  +DE  CS           CK    C  N+ +CDG  DC D SDE+ C           SNPS       HN   C P    +C ++  CI    VCD   DC  G DE
Sbjct:   19 KNTAQAPAVNNSTCDQAKEFDCGNGR-LRCIPAEWQCDNVADC-DNGRDESGCSYAHHCSTSFMLCKN-GLCVANEFKCDGEDDCRDGSDEQHCEYNILKSRFDGSNPSAPTTFVGHNGPECHP-PRLRC-RSGQCIQPDLVCDGHTDCSGGDDE 168          

HSP 3 Score: 55.0694 bits (131), Expect = 2.555e-7
Identity = 73/256 (28.52%), Postives = 104/256 (40.62%), Query Frame = 1
Query:  115 YYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKN---KCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES----------------PEACEIINKPLVVQCDN---SIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFY-CGA-GSTVP-CIAKEWRCDGSYDCPETYKDELNCSNFECS 804
            Y   C     LC+NG C+     CDG D+C D SDE  C++           ILK+       D  N   P   V +   +C   +  CR+    CI    +C+ + DCS G DE                  +   +++       DN   S +  C +  +CI   + CDG  DC D SDEKNC    N+ S+ + L+        C     Y CG  GS +  CI     C+G  +CP    +  +CS  EC+
Sbjct:   71 YAHHCSTSFMLCKNGLCVANEFKCDGEDDCRDGSDEQHCEYN----------ILKSRF-----DGSNPSAPTTFVGHNGPECHPPRLRCRSG--QCIQPDLVCDGHTDCSGGDDEVNCTRRGHENMQSSTDFHDDVHLVDPTFFANEDNKCRSGYTMCHSGDVCIPDSFLCDGDLDCDDASDEKNC--QTNAPSEEEYLSGQADHMHSCSAAGMYSCGTKGSEIGVCIPMNATCNGIKECPLGDDESKHCS--ECA 305          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301471)

HSP 1 Score: 333.569 bits (854), Expect = 1.217e-98
Identity = 246/768 (32.03%), Postives = 350/768 (45.57%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDH---------RETFTCSDSNIILKTELCDGKADC--DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESP--EACEI----------INKPL------------------VVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDE-LNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV---SCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMS-KDNKQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS----PKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            +C   QF C +G CIP    CDG  +C D+SDE              + F C + N I     CD ++DC   +DE  ++C    CS D++ C++    C+    +C+ + DCSDGSDE    + C            I K                    VV CD+     C N   CI++ + CDG  DCSD SDE++C             A++ K +T C ++E+ C     + C+   W CDG  DCP+   +   NC N  C  D+  +C    SC      C+G  DC D SDE  C       +    C+  +EF C     C+   +VCDK  DC DG DE P GK   C  N C   NG C  +CI+      C C  GY++ S ++  C DI+EC     CS  C N +G +KCEC  G+    K++ +C A  G   LL + ++ IR++ L    M  + +     S      +DF +++  IFW+          I       GN K   L  S + S  GLA DWI+  ++++D H   I + N    M K LV+  +    RSI + P    ++W+DWG  P+IE  GMDG  R  +I   +  PNG+ LD     +YWVD K   IS  N    QR  V+       H F I  FED +Y +DWD + + + +K TG+    V++      PM V ++H   QP  + N C  +N  C +LCLP     E   +  C CP    L+ DG  C
Sbjct:  135 KCDEKQFQCHSGDCIPIRFVCDGDADCKDHSDEQIKECKFIEATCSSDQFRCGNGNCIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGA-CIAKRWVCDGDPDCSDGSDERSC-------------ANVTKTTTPCLSHEYQCK--DRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQ-FQCGD-RSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDC-GGGQCVPLSKVCDKRKDCPDGEDE-PAGK---CGINECASKNGGCMHQCIDLKVGHHCECHEGYKL-SPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSIVN-----STKAATALDFVFRTGMIFWSDVTTQ----SIYKAPIDEGNEKTVVLTKSSVTSD-GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK-DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQPDGV-NHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMC 866          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301470)

HSP 1 Score: 335.109 bits (858), Expect = 1.660e-98
Identity = 246/763 (32.24%), Postives = 345/763 (45.22%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESP--EACEI----------INKPL------------------VVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDE-LNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV---SCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYM-SKDNKQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS----PKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C   QF C NG CIP    CD   +C D SDE        C + E    +    I ++ LCDG  DC +  D   C    CS D++ C++    C+    +C+ + DCSDGSDE    + C            I K                    VV CD+     C N   CI++ + CDG  DCSD SDE++C             A++ K +T C ++E+ C     + C+   W CDG  DCP+   +   NC N  C  D+  +C    SC      C+G  DC D SDE  C       +    C+  +EF C     C+   +VCDK  DC DG DE P GK   C  N C   NG C  +CI+      C C  GY++ S ++  C DI+EC     CS  C N +G +KCEC  G+    K++ +C A  G   LL + ++ IR++ L    M  + +     S      +DF +++  IFW+          I       GN K   L  S + S  GLA DWI+  ++++D H   I + N    M K LV+  +    RSI + P    ++W+DWG  P+IE  GMDG  R  +I   +  PNG+ LD     +YWVD K   IS  N    QR  V+       H F I  FED +Y +DWD + + + +K TG+    V++      PM V ++H   QP  + N C  +N  C +LCLP     E   +  C CP    L+ DG  C
Sbjct:  179 CSSDQFRCGNGNCIPNKWRCDQESDCADGSDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGA-CIAKRWVCDGDPDCSDGSDERSC-------------ANVTKTTTPCLSHEYQCK--DRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQ-FQCGD-RSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDC-GGGQCVPLSKVCDKRKDCPDGEDE-PAGK---CGINECASKNGGCMHQCIDLKVGHHCECHEGYKL-SPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSIVN-----STKAATALDFVFRTGMIFWSDVTTQ----SIYKAPIDEGNEKTVVLTKSSVTSD-GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK-DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQPDGV-NHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMC 905          

HSP 2 Score: 90.8929 bits (224), Expect = 3.785e-18
Identity = 70/215 (32.56%), Postives = 98/215 (45.58%), Query Frame = 1
Query:  469 INKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKN-NTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQK 1110
            I + L  +CD    FQC +   CI   + CDG +DC D SDE+              + +       C +++F CG G+   CI  +WRCD   DC +   DE N       P+   +C+T+D C      CDG  DC D SDE  C        +C P +E+ C      C+    +CD++ DC DGSDE    ++   D+  C   NG C QK
Sbjct:  128 IGQSLEAKCDEK-QFQCHSGD-CIPIRFVCDGDADCKDHSDEQ--------------IKECKFIEATCSSDQFRCGNGN---CIPNKWRCDQESDCADG-SDEANELCMNACPNNEFKCQTVDQCIPRSWLCDGSNDCRDKSDEAHC-----RARTCSP-DEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTC--GNGRCIQK 314          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Match: LpR1 (gene:FBgn0066101 transcript:FBtr0301467)

HSP 1 Score: 333.569 bits (854), Expect = 3.150e-98
Identity = 246/768 (32.03%), Postives = 350/768 (45.57%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDH---------RETFTCSDSNIILKTELCDGKADC--DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESP--EACEI----------INKPL------------------VVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDE-LNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV---SCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYM-SKDNKQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS----PKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            +C   QF C +G CIP    CDG  +C D+SDE              + F C + N I     CD ++DC   +DE  ++C    CS D++ C++    C+    +C+ + DCSDGSDE    + C            I K                    VV CD+     C N   CI++ + CDG  DCSD SDE++C             A++ K +T C ++E+ C     + C+   W CDG  DCP+   +   NC N  C  D+  +C    SC      C+G  DC D SDE  C       +    C+  +EF C     C+   +VCDK  DC DG DE P GK   C  N C   NG C  +CI+      C C  GY++ S ++  C DI+EC     CS  C N +G +KCEC  G+    K++ +C A  G   LL + ++ IR++ L    M  + +     S      +DF +++  IFW+          I       GN K   L  S + S  GLA DWI+  ++++D H   I + N    M K LV+  +    RSI + P    ++W+DWG  P+IE  GMDG  R  +I   +  PNG+ LD     +YWVD K   IS  N    QR  V+       H F I  FED +Y +DWD + + + +K TG+    V++      PM V ++H   QP  + N C  +N  C +LCLP     E   +  C CP    L+ DG  C
Sbjct:  135 KCDEKQFQCHSGDCIPIRFVCDGDADCKDHSDEQIKECKFIEATCSSDQFRCGNGNCIPNKWRCDQESDCADGSDEANELCRARTCSPDEYACKSGEGQCVPLAWMCDQSKDCSDGSDEHNCNQTCRADEFTCGNGRCIQKRWKCDHDDDCGDGSDEKECPVVPCDSVAEHTCTNGA-CIAKRWVCDGDPDCSDGSDERSC-------------ANVTKTTTPCLSHEYQCK--DRITCLHHSWLCDGDRDCPDGDDEHTANCKNVTCRADQ-FQCGD-RSCIPGHLTCNGDKDCADGSDERDCGLSLSLGINQGGCNATSEFDC-GGGQCVPLSKVCDKRKDCPDGEDE-PAGK---CGINECASKNGGCMHQCIDLKVGHHCECHEGYKL-SPDKRNCQDINECEVPGKCSQICVNEIGGFKCECEAGYMRDPKNHTRCKASEGHASLLLARRHDIRKIALDHMEMTSIVN-----STKAATALDFVFRTGMIFWSDVTTQ----SIYKAPIDEGNEKTVVLTKSSVTSD-GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK-DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGSHRTTIISYDVKWPNGITLDLVKKRIYWVDGKLNVISSANYDGSQRSQVLYSGEYLRHPFSITTFEDNVYWTDWDKQAVFKANKFTGEDVEPVTAMHMLQHPMVVHVYHPYRQPDGV-NHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMVDGLMC 866          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Match: LpR2 (gene:FBgn0051092 transcript:FBtr0113384)

HSP 1 Score: 332.798 bits (852), Expect = 4.703e-98
Identity = 266/877 (30.33%), Postives = 387/877 (44.13%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDH---------RETFTCSDSNIILKTELCDGKADC--DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN--------------------------------SIHFQCENKQLCISRIYYCDGKSDCSDQSDE-KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETY-KDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFY-MSKDNKQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP----KPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC-SPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLI 2589
            C   QF C  G+CIP    CDG  +C D+SDE  +          +E F C +   I +  +CD + DC   +DE    C  + CS ++F C++    CI  + +C+ N DC DGSDE+   C    +     C N                                S  F C++   CI   + CDG SDC +  DE +NC                V     CQ  EF C     + C+ K W CDG  DCP+   + + NC    C PD+  +C    SC      C+G  DC D SDE  C + S    +C+   EF C     CI   +VC++  DC +G DE P GK   C  N C   NG C  +C+N     +C C  GY++ +   T C+DIDEC    +CS  C N +G++KCEC  G+  + K++ +C A  G   LL + ++ IR++ L R  M  + +     S      +DF +++  IFW+          I       GN +   L  S + S  GLA DWI+  ++++D H   I + N    M K LV+  +    RSI + P    ++W+DWG  P+IE  GMDG  R  +I   +  PNG+ LD     LYWVD K   IS  N    QR  V+       H F I  FED++Y +DWD + + + +K  G     V++      PM V ++H   QP  + N C  +N  C +LCLP     E   +  C CP    L+ DG  C    +++        S+   K      N Y+ + L +   L  + ++  +   +YR   R V   + NF NP Y++    +  ++  N  P    IY    D    N L 
Sbjct:  193 CDEKQFQCSTGECIPIRFVCDGSSDCPDHSDERLEECKFTESTCSQEQFRCGNGKCIPRRWVCDRENDCADGSDESTSQCRSHTCSPEEFACKSGEGECIPLSWMCDQNKDCRDGSDEA--QCNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNFFACKSGP-CIPNQWVCDGDSDCRNGEDEMQNC---------------TVSLLNFCQAGEFQC--SDRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCRPDQ-FQCND-QSCIAGHLTCNGKRDCADGSDEIMC-DISATPRTCNATTEFDC-GGGLCIPNAKVCNRRKDCPNGEDE-PAGK---CGINECSSKNGGCMHQCVNLEVGYRCECHDGYKLGADQHT-CVDIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHTRCKASEGHASLLLARRHDIRKIALDRPEMTSIVN-----STKAATALDFVFRTGMIFWSDVATQ----SIYKAPIDEGNDRTVVLTKSSVTSD-GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK-DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNTISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLEHPMVVHVYHPYRQPDGV-NHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMCVEDLETKTGNNRTDTSNQVHKSDAESENDYVEIALHVIASLAGTALVASVIYVVYRRCTRAV--NSMNFENPVYHKTTEDHFSLEK-NGTP---HIYAAANDEEAVNPLF 1022          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Match: LpR2 (gene:FBgn0051092 transcript:FBtr0113386)

HSP 1 Score: 330.872 bits (847), Expect = 4.356e-97
Identity = 244/767 (31.81%), Postives = 347/767 (45.24%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDH---------RETFTCSDSNIILKTELCDGKADC--DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN--------------------------------SIHFQCENKQLCISRIYYCDGKSDCSDQSDE-KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETY-KDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFY-MSKDNKQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP----KPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C   QF C  G+CIP    CDG  +C D+SDE  +          +E F C +   I +  +CD + DC   +DE    C  + CS ++F C++    CI  + +C+ N DC DGSDE+   C    +     C N                                S  F C++   CI   + CDG SDC +  DE +NC                V     CQ  EF C     + C+ K W CDG  DCP+   + + NC    C PD+  +C    SC      C+G  DC D SDE  C + S    +C+   EF C     CI   +VC++  DC +G DE P GK   C  N C   NG C  +C+N     +C C  GY++ +   T C+DIDEC    +CS  C N +G++KCEC  G+  + K++ +C A  G   LL + ++ IR++ L R  M  + +     S      +DF +++  IFW+          I       GN +   L  S + S  GLA DWI+  ++++D H   I + N    M K LV+  +    RSI + P    ++W+DWG  P+IE  GMDG  R  +I   +  PNG+ LD     LYWVD K   IS  N    QR  V+       H F I  FED++Y +DWD + + + +K  G     V++      PM V ++H   QP  + N C  +N  C +LCLP     E   +  C CP    L+ DG  C
Sbjct:  193 CDEKQFQCSTGECIPIRFVCDGSSDCPDHSDERLEECKFTESTCSQEQFRCGNGKCIPRRWVCDRENDCADGSDESTSQCRSHTCSPEEFACKSGEGECIPLSWMCDQNKDCRDGSDEA--QCNRTCRSDEFTCGNGRCIQNRFKCDDDDDCGDGSDEKNCGEKAKCGSNFFACKSGP-CIPNQWVCDGDSDCRNGEDEMQNC---------------TVSLLNFCQAGEFQC--SDRITCLHKSWVCDGEADCPDGEDESQSNCLKVSCRPDQ-FQCND-QSCIAGHLTCNGKRDCADGSDEIMC-DISATPRTCNATTEFDC-GGGLCIPNAKVCNRRKDCPNGEDE-PAGK---CGINECSSKNGGCMHQCVNLEVGYRCECHDGYKLGADQHT-CVDIDECETPGICSQVCVNEIGAFKCECEAGYMRLLKNHTRCKASEGHASLLLARRHDIRKIALDRPEMTSIVN-----STKAATALDFVFRTGMIFWSDVATQ----SIYKAPIDEGNDRTVVLTKSSVTSD-GLAVDWIYNHVYFTDTHKCTIELTNFEGSMGKVLVK-DSLDIPRSIALDPIEGWMYWSDWGASPRIERAGMDGTHRTAIITYDVKWPNGITLDLVQKRLYWVDGKLNTISSSNYDGSQRHQVLYSGEYLRHPFSITTFEDYVYWTDWDKQAVFKANKFNGMDVEPVTATHMLEHPMVVHVYHPYRQPDGV-NHCQSVNGHCSHLCLPAPRINERSPRISCACPTGLKLMPDGLMC 918          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Match: ldlra (low density lipoprotein receptor a [Source:ZFIN;Acc:ZDB-GENE-031217-1])

HSP 1 Score: 379.793 bits (974), Expect = 1.196e-116
Identity = 251/736 (34.10%), Postives = 373/736 (50.68%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINH-TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPT 2271
            C   Q+ C NGKCI     CD  D+CGD +DE+       TC  S           I K+  CDGKADC+N+ D + C   +C   +F C +    C++   +C+   DC DGSDE    P  C             S  F+C N Q C+ R++ CDG +DC+D SDE  + C    +  +K+            C + EF+CG+G    CI   W+CDG  DC + + DE NCS   C PD+  +C    SC    ++C+   DC D SDE  C N +     C+P   FKC ++  CI+ ++VC+K  DC D SDE        CD N C  NNG C   C +     +CLC  G+R+  +++ +C DIDECA+   CS  C N +GSYKCEC +G+ M   +K C A+G   +L ++ ++ +R++ L R  Y+ ++   KN       + +D +  S++I+W+    + + +    + +   + +   +V S + +P G+A DWIHG ++W+D     ISV       RKTL +  N +K R+IVV P    +FWTDWG   KIE  G++G DR  L+ D +  PNG+ LD   + LYWVD+K   +S  +++   RR ++      AH   + VFE+ ++ +D  N  I+  ++ TG    K+      P  + LFH L QP  I    IN+  C++LCL          K+ C CPD   L  D + C P 
Sbjct:   24 CDSRQYQCGNGKCITARWVCDETDDCGDGTDELPAACLAKTCRPSQFSCGGRLNQCIPKSWKCDGKADCENNADEEGCDPRQCHDGEFRCGSG--QCVTAAFVCDDEIDCEDGSDEVSCPPTTC------------GSSSFRCNNAQ-CVPRLWVCDGDADCADNSDELPEKCGPGTSKPTKNP-----------CTSMEFHCGSGE---CIHGSWKCDGGADCLD-HSDEQNCSLPTCRPDE-FQCGD-GSCIHGSRQCNHVYDCKDMSDELGCVNATH----CEPPYRFKC-RSGECISMEKVCNKQRDCRDWSDE----PLRECDSNECLYNNGGCSHICNDLKIGYECLCPTGFRL--VDKRRCEDIDECANPDTCSQICVNQMGSYKCECEDGYQMDPASKACKAIGTIAYLFFTNRHEVRKMTLDRSEYIRVIPRLKNV------VALDMNIASRDIYWSDL--SLKKIYRAPMDTADNSSQHSIVVGSDLDAPEGIAVDWIHGNIYWTDSIRGAISVATADGSRRKTLFK-ENLAKPRAIVVDPIKNFMFWTDWGTPAKIEKSGLNGVDRSTLVADDIVWPNGITLDLLTERLYWVDSKLHTLSSISVQGDGRRTLIIDQGKLAHPLSLTVFEEKVFWTDVSNNAILSANRVTGGDITKVAEHLSSPEDIVLFHNLKQPTGINWCRINNGGCEFLCLAAPQINRFSPKYTCACPDNMMLARDMRKCVPA 707          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Match: ldlrb (low density lipoprotein receptor b [Source:ZFIN;Acc:ZDB-GENE-040426-1254])

HSP 1 Score: 362.844 bits (930), Expect = 3.713e-111
Identity = 228/690 (33.04%), Postives = 345/690 (50.00%), Query Frame = 1
Query:  244 FTCSD--SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG--EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ--KILVSSPKPMGVKLFHQLAQPVN----IENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSP 2268
            F+C D  +  +     CDGK+DC+N  D + C +  CS ++F C +    C+S + +C+ ++DCSDGSDE+  AC     P          FQC +  +C+ +++ CDG  DC+D SDE  ++C  +               ++ +C   +  C +G  VP     WRCDG++DC +   DE NC+   C PD+   C     C    ++CDG+PDC D SDE  C+  S     CD  + FKC  +  CI+ +RVCD   DCGD SDE       +C+ N C  +NG C   C++     +C C  G+R+   N T C D+DEC D   CS  C N  GSYKC C EG+ +    + C A    E FLL+ST++ +R+L L  R Y  +L   +N       + +D D +   ++W+         +  +  + +   + RT++ S I  P GLA DW+H  ++W+D     +SV       RKTL+        R+IV+ P+   +FW+DWG   +IE  G++G DR  L+ D +  PNG+ALD     LYWVD+K   +S   +    R  ++       H   + VFE+ ++ +D  N  I   ++ TG +   +L     P  + L+H L QP       E+A +N  C++LCLP      +  K+ C CPD   L  D +TC P
Sbjct:   10 FSCGDRLNQCVSSRWRCDGKSDCENGADEQNCAQKNCSAEEFRCGSG--QCVSLSFVCDGDSDCSDGSDEA--AC-----PTHTHTCGPTAFQCSSPAVCVPQLWACDGDPDCADGSDEWLQHCGGA---------------RARVCPEQQMQCRSGECVP---DSWRCDGAFDCSD-RSDEDNCTVHTCRPDE-FLCAD-GGCVPGLRQCDGHPDCGDRSDELDCTPVS----VCDAPSRFKC-SSGECISAERVCDGQRDCGDASDE----PIRDCNVNECLSSNGGCSHLCVDLRLGFECSCPAGFRL--ANHTHCEDVDECVDADACSQMCVNLPGSYKCVCAEGYELDHMTRDCRAATGPEAFLLFSTRHEVRKLALGSREYTAVLRQQRNV------VALDVDVQRDTLYWSDLSQ-----RKIYSTTASNPTQNRTVIDSWISRPEGLAVDWVHRNIYWTDSEQRSVSVATADGSKRKTLIH--GLQNPRAIVLDPQSNFMFWSDWGVSARIERCGLNGADRTALVTDNIVWPNGIALDVLGRRLYWVDSKLHTLSSIGVDGNGRHTLIHDQQTLPHPLALAVFEEKVFWTDVANHGIWSANRLTGHEISAVLKHLQSPEDIVLYHSLTQPSGRDWCRESALLNGGCEFLCLPAPAINTHSPKYTCACPDHMTLAEDMRTCVP 645          

HSP 2 Score: 63.1586 bits (152), Expect = 1.454e-9
Identity = 34/83 (40.96%), Postives = 43/83 (51.81%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE-------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKI--CVKNKC 348
            CR  +FLC +G C+P    CDGH +CGD SDE       +CD    F CS    I    +CDG+ DC +  D  I  C  N+C
Sbjct:  171 CRPDEFLCADGGCVPGLRQCDGHPDCGDRSDELDCTPVSVCDAPSRFKCSSGECISAERVCDGQRDCGDASDEPIRDCNVNEC 253          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 363.614 bits (932), Expect = 1.100e-110
Identity = 263/864 (30.44%), Postives = 403/864 (46.64%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN----SIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSK----------------------------SQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKS-EFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXA--MYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
             C + QF C NG+CIP    CDG  +C D SDE    R+T     F C     I K   CDG+ DC++  DE  ++C    C +++F C      CI     C+   DC +G DE             + C N     + F C + + C+SR + C+G+ DC D SDE++C  S  S S+                             +           C  +E  CG+G    CI ++WRCDG  DC +   DE NCS   C PD+  +C    SC    ++C+G+ DC D +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C INNG C   C +     +C C PG ++  I+   C D++EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW       +      ++ K      +  V   +  PVG+A DWI+  ++WSD+    I+V N  NG +K ++      +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D +NE I   +K TG    L++S   +P  + ++H+L Q ++  N C     N  C ++CLP     ++  K+ C+CP+   L +DG  C    S          +  +L      VN           +L + L+ +       M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   28 ECEQSQFQCGNGRCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE-------------INCGNITCAPLEFTCSSGR-CVSRKFVCNGEDDCGDGSDEQDCAPSSCSPSEIPCGNNTCIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGE---CIHRKWRCDGDPDCKDG-SDEKNCSARNCRPDQ-FKCDD-GSCIHGSRQCNGFRDCVDGTDEVNCKNLTQ----CNSSDQFKC-RSGECIEMSKVCNKVRDCPDWSDE----PIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQL--IDRKTCGDVNECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFIQQMIFWADLG---QKAIFSTVLDKQDESHKK--VIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANF-NGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQ-LSGTNWCNEKMENGGCSFMCLPAPQINKHSPKYTCVCPEGQTLASDGLRCRAASSVSKVASEPVHTEGNLSTSIHEVNTSARGSAAAWAILPVLLLAMAAAGGYLMWRNWQIKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAI 846          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 361.688 bits (927), Expect = 5.937e-110
Identity = 262/871 (30.08%), Postives = 406/871 (46.61%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN----SIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSK----------------------------SQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC-SPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXX---------XXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
             C + QF C NG+CIP    CDG  +C D SDE    R+T     F C     I K   CDG+ DC++  DE  ++C    C +++F C      CI     C+   DC +G DE             + C N     + F C + + C+SR + C+G+ DC D SDE++C  S  S S+                             +           C  +E  CG+G    CI ++WRCDG  DC +   DE NCS   C PD+  +C    SC    ++C+G+ DC D +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C INNG C   C +     +C C PG ++  I+   C D++EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW       +      ++ K      +  V   +  PVG+A DWI+  ++WSD+    I+V N  NG +K ++      +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D +NE I   +K TG    L++S   +P  + ++H+L Q ++  N C     N  C ++CLP     ++  K+ C+CP+   L +DG  C +   S   +    V++    PK+  ++  +            +          +    G  M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   28 ECEQSQFQCGNGRCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE-------------INCGNITCAPLEFTCSSGR-CVSRKFVCNGEDDCGDGSDEQDCAPSSCSPSEIPCGNNTCIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGE---CIHRKWRCDGDPDCKDG-SDEKNCSARNCRPDQ-FKCDD-GSCIHGSRQCNGFRDCVDGTDEVNCKNLTQ----CNSSDQFKC-RSGECIEMSKVCNKVRDCPDWSDE----PIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQL--IDRKTCGDVNECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFIQQMIFWADLG---QKAIFSTVLDKQDESHKK--VIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANF-NGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQ-LSGTNWCNEKMENGGCSFMCLPAPQINKHSPKYTCVCPEGQTLASDGLRCRAEATSAAPQDGGQVTTRPSHPKEGNLSTSIHEVNTSARGSAAAWAILPVLLLAMAAAGGYLMWRNWQIKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAI 853          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Match: vldlr (very low density lipoprotein receptor [Source:ZFIN;Acc:ZDB-GENE-040426-803])

HSP 1 Score: 361.303 bits (926), Expect = 6.325e-110
Identity = 261/864 (30.21%), Postives = 407/864 (47.11%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDN----SIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSK----------------------------SQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDS 2568
             C + QF C NG+CIP    CDG  +C D SDE    R+T     F C     I K   CDG+ DC++  DE  ++C    C +++F C      CI     C+   DC +G DE             + C N     + F C + + C+SR + C+G+ DC D SDE++C  S  S S+                             +           C  +E  CG+G    CI ++WRCDG  DC +   DE NCS   C PD+  +C    SC    ++C+G+ DC D +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C INNG C   C +     +C C PG ++  I+   C D++EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW       +      ++ K      +  V   +  PVG+A DWI+  ++WSD+    I+V N  NG +K ++      +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D +NE I   +K TG    L++S   +P  + ++H+L Q ++  N C     N  C ++CLP     ++  K+ C+CP+   L +DG  C    +     +I   ++S +   +   +           +L+  +    G  M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  + ++
Sbjct:   28 ECEQSQFQCGNGRCIPSVWQCDGDMDCSDGSDETSCVRKTCAEVDFVCRSGQCIPKRWQCDGEPDCEDGSDESIEMCHTRTCRVNEFSCGVGSTQCIPVFWKCDGEKDCDNGEDE-------------INCGNITCAPLEFTCSSGR-CVSRKFVCNGEDDCGDGSDEQDCAPSSCSPSEIPCGNNTCIPRSWLCDDDVDCQDQSDESPERCGHNPTPPAKCSPSEMQCGSGE---CIHRKWRCDGDPDCKDG-SDEKNCSARNCRPDQ-FKCDD-GSCIHGSRQCNGFRDCVDGTDEVNCKNLTQ----CNSSDQFKC-RSGECIEMSKVCNKVRDCPDWSDE----PIKECNMNECLINNGGCSHICRDLTIGFECDCTPGLQL--IDRKTCGDVNECLNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFIQQMIFWADLG---QKAIFSTVLDKQDESHKK--VIDDVQMPVGIAVDWIYKNIYWSDLGSKSITVANF-NGTKKKVLFNSGLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGNDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRRKVLQSPDYLAHPFALTVFEDRVFWTDGENEAIYGANKFTGSDVTLLASNLNEPQDIIVYHELIQ-LSGTNWCNEKMENGGCSFMCLPAPQINKHSPKYTCVCPEGQTLASDGLRCRAEGN--LSTSIHEVNTSARGSAAAWAIL---------PVLLLAMAAAGGYLMWRNWQIKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAVSNA 835          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Match: pigs (phosphatidylinositol glycan anchor biosynthesis class S [Source:Xenbase;Acc:XB-GENE-1005014])

HSP 1 Score: 391.349 bits (1004), Expect = 4.081e-121
Identity = 261/767 (34.03%), Postives = 380/767 (49.54%), Query Frame = 1
Query:  112 QYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKT-IXXXXXXLKPKQSRVNV 2346
            Q   +C R +F C +GKCIP    CDG   C D SDE  +  +  TC   +      L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG YDC +   DE +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ S+I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    R  V+S   HL AH F + VFED ++ +D +NE I   ++ TG    K+      P  + L+H L QP   EN C +H      C+YLCLP  +      KF C CPD  +L  D ++C    +   + T  + + +  +PK +   V
Sbjct:   10 QNGGKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEQHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGYDCKDK-SDEKDCVKPTCRPDE-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRL--VDKKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISSQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFS-DDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETHL-AHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNLRQP-KAENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSCVKGSTTLAKITSTTSTVAPQRPKMASTTV 726          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Match: pigs (phosphatidylinositol glycan anchor biosynthesis class S [Source:Xenbase;Acc:XB-GENE-1005014])

HSP 1 Score: 391.734 bits (1005), Expect = 8.354e-121
Identity = 256/735 (34.83%), Postives = 369/735 (50.20%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            ++C R +F C +GKCIP    CDG   C D SDE  +  +  TC   +      L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG YDC +   DE +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ S+I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    R  V+S   HL AH F + VFED ++ +D +NE I   ++ TG    K+      P  + L+H L QP   EN C +H      C+YLCLP  +      KF C CPD  +L  D ++C
Sbjct:    9 RKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEQHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGYDCKDK-SDEKDCVKPTCRPDE-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRL--VDKKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISSQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFS-DDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETHL-AHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNLRQP-KAENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSC 693          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Match: pigs (phosphatidylinositol glycan anchor biosynthesis class S [Source:Xenbase;Acc:XB-GENE-1005014])

HSP 1 Score: 390.193 bits (1001), Expect = 9.605e-121
Identity = 256/735 (34.83%), Postives = 369/735 (50.20%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            ++C R +F C +GKCIP    CDG   C D SDE  +  +  TC   +      L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG YDC +   DE +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ S+I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    R  V+S   HL AH F + VFED ++ +D +NE I   ++ TG    K+      P  + L+H L QP   EN C +H      C+YLCLP  +      KF C CPD  +L  D ++C
Sbjct:    5 RKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEQHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGYDCKDK-SDEKDCVKPTCRPDE-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRL--VDKKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISSQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFS-DDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETHL-AHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNLRQP-KAENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSC 689          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Match: pigs (phosphatidylinositol glycan anchor biosynthesis class S [Source:Xenbase;Acc:XB-GENE-1005014])

HSP 1 Score: 391.349 bits (1004), Expect = 1.690e-120
Identity = 256/735 (34.83%), Postives = 369/735 (50.20%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            ++C R +F C +GKCIP    CDG   C D SDE  +  +  TC   +      L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG YDC +   DE +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ S+I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    R  V+S   HL AH F + VFED ++ +D +NE I   ++ TG    K+      P  + L+H L QP   EN C +H      C+YLCLP  +      KF C CPD  +L  D ++C
Sbjct:   27 RKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEQHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGYDCKDK-SDEKDCVKPTCRPDE-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRL--VDKKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISSQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFS-DDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETHL-AHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNLRQP-KAENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSC 711          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Match: pigs (phosphatidylinositol glycan anchor biosynthesis class S [Source:Xenbase;Acc:XB-GENE-1005014])

HSP 1 Score: 390.193 bits (1001), Expect = 4.800e-120
Identity = 256/736 (34.78%), Postives = 370/736 (50.27%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNI-ENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            ++C R +F C +GKCIP    CDG   C D SDE  +  +  TC   +      L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG YDC +   DE +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ S+I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    R  V+S   HL AH F + VFED ++ +D +NE I   ++ TG    K+      P  + L+H L QP  + EN C +H      C+YLCLP  +      KF C CPD  +L  D ++C
Sbjct:   23 RKCDRSEFQCGDGKCIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEQHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGYDCKDK-SDEKDCVKPTCRPDE-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PIKECGENECMRNNGGCAHICNDLKIGYECLCNEGYRL--VDKKRCEDINECENPNTCSQICINLDGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISSQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLFS-DDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLTNQRLYWVDSKLHSLSCIDVTGQNRITVISDETHL-AHPFGLTVFEDLVFWTDIENEAIFSANRLTGSNITKVAEDLLSPEDIVLYHNLRQPKGMTENWCESHHLGNGGCEYLCLPAPLITSRSPKFTCACPDGMHLGADMRSC 709          

HSP 2 Score: 60.077 bits (144), Expect = 1.923e-8
Identity = 47/143 (32.87%), Postives = 68/143 (47.55%), Query Frame = 1
Query:  613 ENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-NCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            E++   S +L  L  +   C  +EF CG G    CI  +W CDGS +C +   +    C    C  D  +    ++ C     +CDG  DC + SDE  C+      V  D  ++F C ++  CI+   VCD+  DC DGSDE
Sbjct:    6 EHTTLFSVALFALYLEVRKCDRSEFQCGDGK---CIPYKWICDGSAECKDGSDESPETCKVVTCGADHFSCGGRLNRCIPLLWKCDGQTDCENGSDENDCT----RKVCAD--DQFTC-RSGKCISLDFVCDEDLDCDDGSDE 138          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Match: Ldlr (low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:96765])

HSP 1 Score: 374.4 bits (960), Expect = 1.149e-114
Identity = 254/734 (34.60%), Postives = 371/734 (50.54%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSD---------SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI---ENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C R +F C++GKCI     CDG   C D SDE  +   + TC           S  I  +  CDG+ DC+ND D + C    CS D F C+     CIS   +C+ + DC DGSDE+   C+         C    HF+C N  +CI  ++ CDG  DC D SDE  +NC   +   + S+ +      S+ C + EF+CG+     CI + W CDG  DC +   DE +C+   C PD+  +C    SC    ++CD   DC D SDE  C N +Q    CD  N+FKC  +  CI+  +VCD   DC D SDE      + C  N C  NNG C   C +     +CLC  G+R+  ++  +C DIDEC +   CS  C N  GSYKCEC  GF+M    + C AVG   +LL++ ++ +R++ L R  Y  +L + KN       + +D +  +  I+W+      +      L+ +  N+   T++   +H+P GLA DWIH  ++W+D     +SV +     R+TL +    S+ R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++   N  AH F + ++ED +Y +D  NE I   ++ TG    LV+     P  + LFH++ QP  +   E   +  N  CQYLCLP      +  KF C CPD   L  D ++C
Sbjct:   27 CSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDG--KCISPQFVCDGDRDCLDGSDEA--HCQ------ATTC-GPAHFRC-NSSICIPSLWACDGDVDCVDGSDEWPQNC---QGRDTASKGV------SSPCSSLEFHCGSSE---CIHRSWVCDGEADCKDK-SDEEHCAVATCRPDE-FQCAD-GSCIHGSRQCDREHDCKDMSDELGCVNVTQ----CDGPNKFKC-HSGECISLDKVCDSARDCQDWSDE----PIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRL--VDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNV------VALDTEVTNNRIYWSDLS---QKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAG-SRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSC 712          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 360.533 bits (924), Expect = 1.409e-109
Identity = 265/838 (31.62%), Postives = 397/838 (47.37%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTI---CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEI-VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ--KILVSSPKPMGVKLFHQLAQPVN---IENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            K C    F+C+NG+C+P    CDG  +C D SDE  +     TC  + I         I  +  CDG+ DCDN ED + C    CS D+F C +    C+S+  +CN  +DC DGSDE   +P  C             +  FQC     CI   + CD  +DCSDQSDE              SL    +Q  I   C  +E  CG+G    CI K+WRCDG  DC +   DE+NC +  C PD+   C+   SC    ++C+G  DC D SDE  C N +Q    C    +FKC ++  CI   +VCD+  DC D SDE      + C  N C +NNG C   C +     +C C  G+ +  I+   C DIDEC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR++ L R  Y+ ++   +N       + +D D  ++ +FW            ID  V +   M         +++P  +A DW++  ++W+D     ISV  +    RK L    +  +  SI V P    ++W+DWG+  KIE  GM+G DR+ L+ + +  PNG+ LD     LYW+D+K   +S  +L    RR V+  L   AH   + +FED +Y  D +NE +   +K TG +   ++ +      + ++H+L QP      E+   N  C+YLCLP     ++  K+ C CP+   L  +G+ C     +    T +VS  S+ PK +             + LL+ ++    G  M+RN+  + +K + NF+NP Y +    +L I +      +   Y  +
Sbjct:   70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENCGNITCSADEFTCSSG--RCVSRNFVCNGQDDCDDGSDELDCAPPTC------------GAHEFQCSTSS-CIPLSWVCDDDADCSDQSDE--------------SLEQCGRQPVIHTKCPTSEIQCGSGE---CIHKKWRCDGDPDCKDG-SDEVNCPSRTCRPDQ-FECED-GSCIHGSRQCNGIRDCVDGSDEVNCKNVNQ----CLGPGKFKC-RSGECIDMSKVCDQEQDCRDWSDE----PLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFEL--IDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNT------VALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKM------IDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFN-SDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYNLEENGREC-----QRINVTTAVSEVSVPPKGTSA-------AWAILPLLLLVMAAVGGYLMWRNWQHKNMK-SMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAI 835          

HSP 2 Score: 94.7449 bits (234), Expect = 3.017e-19
Identity = 84/234 (35.90%), Postives = 109/234 (46.58%), Query Frame = 1
Query:  337 KNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            K KC   QF C      CI+    C+ + DC+DGSDE         K  V +      F C+N Q C+   + CDG  DC D SDE   P+  + ++              C+ NE  CGA ST  CI   WRCDG  DC +  +DE NC N  CS D+   C +   C   +  C+G  DC D SDE  C+ P+         +EF+C   ++CI    VCD   DC D SDE
Sbjct:   30 KAKCDSSQFQCTNG--RCITLLWKCDGDEDCADGSDE---------KNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDES--PEQCHMRT--------------CRINEISCGARST-QCIPVSWRCDGENDC-DNGEDEENCGNITCSADEFT-CSS-GRCVSRNFVCNGQDDCDDGSDELDCAPPTCG------AHEFQC-STSSCIPLSWVCDDDADCSDQSDE 224          

HSP 3 Score: 58.9214 bits (141), Expect = 3.277e-8
Identity = 49/161 (30.43%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-CDHR----ETFTCSDSNIILKTELCDGKADCDNDEDPKICVK-NKC-SIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEI------------INKPLVV--QCDNSIHFQCENKQLC 537
            + +C   +  C +G+CI +   CDG  +C D SDE+ C  R    + F C D + I  +  C+G  DC +  D   C   N+C    +F CR+    CI  + +C+   DC D SDE  + C I            I K LV+  +CD +  F+  +++ C
Sbjct:  236 HTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSG--ECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTC 394          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 359.762 bits (922), Expect = 5.229e-109
Identity = 266/854 (31.15%), Postives = 396/854 (46.37%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTI---CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEI-VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPK-PMGVKLFHQLAQPVN---IENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEF-------FRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXX---------XXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            K C    F+C+NG+C+P    CDG  +C D SDE  +     TC  + I         I  +  CDG+ DCDN ED + C    CS D+F C +    C+S+  +CN  +DC DGSDE   +P  C             +  FQC     CI   + CD  +DCSDQSDE              SL    +Q  I   C  +E  CG+G    CI K+WRCDG  DC +   DE+NC +  C PD+   C+   SC    ++C+G  DC D SDE  C N +Q    C    +FKC ++  CI   +VCD+  DC D SDE      + C  N C +NNG C   C +     +C C  G+ +  I+   C DIDEC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR++ L R  Y+ ++   +N       + +D D  ++ +FW            ID  V +   M         +++P  +A DW++  ++W+D     ISV  +    RK L    +  +  SI V P    ++W+DWG+  KIE  GM+G DR+ L+ + +  PNG+ LD     LYW+D+K   +S  +L    RR V+  L   AH   + +FED +Y  D +NE +   +K TG +   LV++      + ++H+L QP      E+   N  C+YLCLP     ++  K+ C CP+   L  +G+ C  T +            T  + +S L P    V   +    V       +         ++    G  M+RN+  + +K + NF+NP Y +    +L I +      +   Y  +
Sbjct:   70 KTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCHMRTCRINEISCGARSTQCIPVSWRCDGENDCDNGEDEENCGNITCSADEFTCSSG--RCVSRNFVCNGQDDCDDGSDELDCAPPTC------------GAHEFQCSTSS-CIPLSWVCDDDADCSDQSDE--------------SLEQCGRQPVIHTKCPTSEIQCGSGE---CIHKKWRCDGDPDCKDG-SDEVNCPSRTCRPDQ-FECED-GSCIHGSRQCNGIRDCVDGSDEVNCKNVNQ----CLGPGKFKC-RSGECIDMSKVCDQEQDCRDWSDE----PLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFEL--IDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRNT------VALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKM------IDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFN-SDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYNLEENGRECQSTSTPVTYSETKDINTTDILRTSGLVPGGINVTTAVSEVSVPPKGTSAAWAILPLLLLVMAAVGGYLMWRNWQHKNMK-SMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAI 863          

HSP 2 Score: 95.1301 bits (235), Expect = 2.130e-19
Identity = 84/234 (35.90%), Postives = 109/234 (46.58%), Query Frame = 1
Query:  337 KNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            K KC   QF C      CI+    C+ + DC+DGSDE         K  V +      F C+N Q C+   + CDG  DC D SDE   P+  + ++              C+ NE  CGA ST  CI   WRCDG  DC +  +DE NC N  CS D+   C +   C   +  C+G  DC D SDE  C+ P+         +EF+C   ++CI    VCD   DC D SDE
Sbjct:   30 KAKCDSSQFQCTNG--RCITLLWKCDGDEDCADGSDE---------KNCVKKTCAESDFVCKNGQ-CVPNRWQCDGDPDCEDGSDES--PEQCHMRT--------------CRINEISCGARST-QCIPVSWRCDGENDC-DNGEDEENCGNITCSADEFT-CSS-GRCVSRNFVCNGQDDCDDGSDELDCAPPTCG------AHEFQC-STSSCIPLSWVCDDDADCSDQSDE 224          

HSP 3 Score: 59.3066 bits (142), Expect = 2.751e-8
Identity = 49/161 (30.43%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-CDHR----ETFTCSDSNIILKTELCDGKADCDNDEDPKICVK-NKC-SIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEI------------INKPLVV--QCDNSIHFQCENKQLC 537
            + +C   +  C +G+CI +   CDG  +C D SDE+ C  R    + F C D + I  +  C+G  DC +  D   C   N+C    +F CR+    CI  + +C+   DC D SDE  + C I            I K LV+  +CD +  F+  +++ C
Sbjct:  236 HTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSG--ECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTC 394          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Match: Vldlr (very low density lipoprotein receptor [Source:MGI Symbol;Acc:MGI:98935])

HSP 1 Score: 357.066 bits (915), Expect = 8.383e-109
Identity = 265/835 (31.74%), Postives = 397/835 (47.54%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTI---CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEI-VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPK-PMGVKLFHQLAQPVN---IENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            +C   QF C NG+CI     CDG ++C D SDE    ++T     F C +   +     CDG  DC++  DE P+ C    CS D+F C +    C+S+  +CN  +DC DGSDE   +P  C             +  FQC     CI   + CD  +DCSDQSDE              SL    +Q  I   C  +E  CG+G    CI K+WRCDG  DC +   DE+NC +  C PD+   C+   SC    ++C+G  DC D SDE  C N +Q    C    +FKC ++  CI   +VCD+  DC D SDE      + C  N C +NNG C   C +     +C C  G+ +  I+   C DIDEC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR++ L R  Y+ ++   +N       + +D D  ++ +FW            ID  V +   M         +++P  +A DW++  ++W+D     ISV  +    RK L    +  +  SI V P    ++W+DWG+  KIE  GM+G DR+ L+ + +  PNG+ LD     LYW+D+K   +S  +L    RR V+  L   AH   + +FED +Y  D +NE +   +K TG +   LV++      + ++H+L QP      E+   N  C+YLCLP     ++  K+ C CP+   L  +G+ C     +    T +VS  S+ PK +             + LL+ ++    G  M+RN+  + +K + NF+NP Y +    +L I +      +   Y  +
Sbjct:   32 KCDSSQFQCTNGRCITLLWKCDGDEDCADGSDEKNCVKKTCAESDFVCKNGQCVPNRWQCDGDPDCEDGSDESPEQCRNITCSADEFTCSSG--RCVSRNFVCNGQDDCDDGSDELDCAPPTC------------GAHEFQCSTSS-CIPLSWVCDDDADCSDQSDE--------------SLEQCGRQPVIHTKCPTSEIQCGSGE---CIHKKWRCDGDPDCKDG-SDEVNCPSRTCRPDQ-FECED-GSCIHGSRQCNGIRDCVDGSDEVNCKNVNQ----CLGPGKFKC-RSGECIDMSKVCDQEQDCRDWSDE----PLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFEL--IDRKTCGDIDECQNPGICSQICINLKGGYKCECSRGYQMDLATGVCKAVGKEPSLIFTNRRDIRKIGLERKEYIQLVEQLRN------TVALDADIAAQKLFWADLSQKAIFSASIDDKVGRHFKM------IDNVYNPAAIAVDWVYKTIYWTDAASKTISVATLDGAKRKFLFN-SDLREPASIAVDPLSGFVYWSDWGEPAKIEKAGMNGFDRRPLVTEDIQWPNGITLDLVKSRLYWLDSKLHMLSSVDLNGQDRRIVLKSLEFLAHPLALTIFEDRVYWIDGENEAVYGANKFTGSELATLVNNLNDAQDIIVYHELVQPSGKNWCEDDMENGGCEYLCLPAPQINDHSPKYTCSCPNGYNLEENGREC-----QRINVTTAVSEVSVPPKGTSA-------AWAILPLLLLVMAAVGGYLMWRNWQHKNMK-SMNFDNPVYLKTTEEDLSIDIGRHSASVGHTYPAI 794          

HSP 2 Score: 59.3066 bits (142), Expect = 2.304e-8
Identity = 49/161 (30.43%), Postives = 76/161 (47.20%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI-CDHR----ETFTCSDSNIILKTELCDGKADCDNDEDPKICVK-NKC-SIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEI------------INKPLVV--QCDNSIHFQCENKQLC 537
            + +C   +  C +G+CI +   CDG  +C D SDE+ C  R    + F C D + I  +  C+G  DC +  D   C   N+C    +F CR+    CI  + +C+   DC D SDE  + C I            I K LV+  +CD +  F+  +++ C
Sbjct:  195 HTKCPTSEIQCGSGECIHKKWRCDGDPDCKDGSDEVNCPSRTCRPDQFECEDGSCIHGSRQCNGIRDCVDGSDEVNCKNVNQCLGPGKFKCRSG--ECIDMSKVCDQEQDCRDWSDEPLKECHINECLVNNGGCSHICKDLVIGYECDCAAGFELIDRKTC 353          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Match: Lrp4 (low density lipoprotein receptor-related protein 4 [Source:MGI Symbol;Acc:MGI:2442252])

HSP 1 Score: 368.622 bits (945), Expect = 3.418e-107
Identity = 253/752 (33.64%), Postives = 363/752 (48.27%), Query Frame = 1
Query:  127 CRRFQFLCQNGK-----CIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCD----NSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSK---------SKSQSLADLVKQSTI-----------------CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNL----CKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMK-PRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPK--PMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICP 2226
            C R  F C         CIP    CDG ++CGD+SDE       C   + F C +   I ++ +CDG  DC++D D + C   +C  D+F C+     CI     C+ +NDC D SDE              QCD    +   F+C +   CI+  +YCDG +DC D SDE++CP +  S          +  + + D+                       C++ EF C +G    CI   WRCDG  DC +   DE NC+   C+ ++  RC++   C     RCDG  DC DNSDEE C N      + D   +F C  N  CI  +++C+  NDCGD SDE P    +NC        C +NNG C QKC       +C C  GYR+     T C D++ECA+   CS  C N  G+++C C  G+ +  D + C A+G E  LL++ +  IR++   R  Y  +L + +N       I +DF ++ + +FW+        V +D ++    N      +V + + SP GLA DW+H  L+W+D   + I V N+    RK L+   +  K R+I +HP    I+WTDWG  P+IE   MDG  R+++    L+ PNGL +DY    +YWVDAK   I   NL    R+ V+S    H F I VFED LY +DW  + I   +K TGK + ++ +    PM +   H   QP   +N C   N  C +LCLP+  N      + C CP
Sbjct:   27 CGRSHFTCAVSALGECTCIPAQWQCDGDNDCGDHSDEDGCTLPTCSPLD-FHCDNGKCIRRSWVCDGDNDCEDDSDEQDCPPRECEEDEFPCQNG--YCIRSLWHCDGDNDCGDNSDE--------------QCDMRKCSDKEFRCSDGS-CIAEHWYCDGDTDCKDGSDEESCPSAVPSPPCNLEEFQCAYGRCILDIYHCDGDDDCGDWSDESDCSSHQPCRSGEFMCDSGL---CINSGWRCDGDADC-DDQSDERNCTTSMCTAEQ-FRCRS-GRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASD---QFLCW-NGRCIGQRKLCNGINDCGDSSDESP---QQNCRPRTGEENCNVNNGGCAQKCQMVRGAVQCTCHTGYRLTEDGRT-CQDVNECAEEGYCSQGCTNTEGAFQCWCEAGYELRPDRRSCKALGPEPVLLFANRIDIRQVLPHRSEYTLLLNNLENA------IALDFHHRRELVFWSD-------VTLDRILRANLNGSNVEEVVSTGLESPGGLAVDWVHDKLYWTDSGTSRIEVANLDGAHRKVLL-WQSLEKPRAIALHPMEGTIYWTDWGNTPRIEASSMDGSGRRIIADTHLFWPNGLTIDYAGRRMYWVDAKHHVIERANLDGSHRKAVISQGLPHPFAITVFEDSLYWTDWHTKSINSANKFTGKNQEIIRNKLHFPMDIHTLHPQRQPAG-KNRCGDNNGGCTHLCLPSGQN------YTCACP 725          

HSP 2 Score: 183.341 bits (464), Expect = 1.776e-46
Identity = 111/358 (31.01%), Postives = 167/358 (46.65%), Query Frame = 1
Query: 1222 CSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLV-SKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTG--KQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            C+H C     +Y C C  GF    ++  C    +KFLL++ +  IR +      +     P     +   + +D+D +  +++WT        V  D +  +K        +V + + SP GLA DW+   L+W+D   + I V N    MR  L+   N  + R IVV P    ++WTDWG  PKIE  GMD   R+V+I   L  PNGLA+DY    LYW DA  + I    L   +R+ ++     H F + ++   +Y +DW  + I    + TG  ++ +  +    M + +FH+   PV    A  N  C +LCL +     N   F C CP    LL DGKTCSP  + F 
Sbjct:  709 CTHLCLPSGQNYTCACPTGF-RKINSHACAQSLDKFLLFARRMDIRRISFDTEDLSDDVIPLADVRS--AVALDWDSRDDHVYWTD-------VSTDTISRAKWDGTGQEVVVDTSLESPAGLAIDWVTNKLYWTDAGTDRIEVANTDGSMRTVLI-WENLDRPRDIVVEPMGGYMYWTDWGASPKIERAGMDASSRQVIISSNLTWPNGLAIDYGSQRLYWADAGMKTIEFAGLDGSKRKVLIGSQLPHPFGLTLYGQRIYWTDWQTKSIQSADRLTGLDRETLQENLENLMDIHVFHRQRPPVTTLCAVENGGCSHLCLRSP----NPSGFSCTCPTGINLLRDGKTCSPGMNSFL 1051          

HSP 3 Score: 165.236 bits (417), Expect = 9.321e-41
Identity = 111/363 (30.58%), Postives = 167/363 (46.01%), Query Frame = 1
Query: 1222 CSHKCANYL--GSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPT-SNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTG--NMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIEN-ACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            CSH C        + C C  G  + +D K C      FL+++ +  +R + L   Y   +  P N T  N + IG+D       ++W+            H +S+      +   ++ + + +  GLA D I   ++W+D   N I V N+   MRK LV   N    R+IV++ +   ++WTDWG+  K+E  GMDG DR VLI + L  PNGL +D     L W DA T +I V +L    R  +VS +  H + + + + ++Y +DW    I +  K TG   ILV S  P  M ++   + AQP+        N  C +LCLP          F C CP    L  D KTC P+   + 
Sbjct: 1013 CSHLCLRSPNPSGFSCTCPTGINLLRDGKTCSPGMNSFLIFARRIDVRMVSLDIPYFADVVVPINMTMKNTIAIGVD--PLEGKVYWSD--------STLHRISRASLDGSQHEDIITTGLQTTDGLAVDAIGRKVYWTDTGTNRIEVGNLDGSMRKVLV-WQNLDSPRAIVLYHEMGFMYWTDWGENAKLERSGMDGSDRTVLINNNLGWPNGLTVDKTSSQLLWADAHTERIEVADLNGANRHTLVSPVQ-HPYGLTLLDSYIYWTDWQTRSIHRADKSTGSNVILVRSNLPGLMDIQAVDR-AQPLGFNKCGSRNGGCSHLCLPRPSG------FSCACPTGIQLKGDRKTCDPSPETYL 1356          

HSP 4 Score: 157.147 bits (396), Expect = 2.598e-38
Identity = 112/377 (29.71%), Postives = 176/377 (46.68%), Query Frame = 1
Query: 1150 PGYR-IDSINETKCIDIDECAD-HMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTG-NMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            PG   I +++  + +  ++C   +  CSH C      + C C  G  +  D K C    E +LL+S++ SIR + L       ++ P    +N   I +D+D     +++T        + +       G NM+  T++   + +  GLA DW+   L+W+D   N I    +    RK L+   +  + R+I V P+   +FWTDWG   KIE   +DG +RKVLI   L  PNGL LDY    +YWVDA   +I   +L    R+ +VSH+ +H F +   + W+Y +DW  + I ++ K +G+ K  V +     + +     Q     NAC   N  C +LC   + +      F C CPD      DG  CS
Sbjct: 1294 PGLMDIQAVDRAQPLGFNKCGSRNGGCSHLCLPRPSGFSCACPTGIQLKGDRKTCDPSPETYLLFSSRGSIRRISLDTDDHTDVHVPVPGLNNV--ISLDYDSVHGKVYYTDV-----FLDVIRRADLNGSNME--TVIGHGLKTTDGLAVDWVARNLYWTDTGRNTIEASRLDGSCRKVLIN-NSLDEPRAIAVFPRKGYLFWTDWGHIAKIERANLDGSERKVLINTDLGWPNGLTLDYDTRRIYWVDAHLDRIESADLNGKLRQVLVSHV-SHPFALTQQDRWIYWTDWQTKSIQRVDKYSGRNKETVLANVEGLMDIIVVSPQRQTGTNACGVNNGGCTHLCFARASD------FVCACPDEP----DGHPCS 1649          

HSP 5 Score: 73.9442 bits (180), Expect = 1.132e-12
Identity = 45/122 (36.89%), Postives = 63/122 (51.64%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKN---KCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPE 456
            ++ CR  +F+C +G CI     CDG  +C D SDE      +C   E F C     +  +  CDG+ DC ++ D + C      +C+ DQF+C      CI +  LCN  NDC D SDESP+
Sbjct:  228 HQPCRSGEFMCDSGLCINSGWRCDGDADCDDQSDERNCTTSMCT-AEQFRCRSGRCVRLSWRCDGEDDCADNSDEENCENTGSPQCASDQFLCWNG--RCIGQRKLCNGINDCGDSSDESPQ 346          
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Match: sp|Q99087|LDLR1_XENLA (Low-density lipoprotein receptor 1 OS=Xenopus laevis OX=8355 GN=ldlr-a PE=1 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 2.943e-119
Identity = 253/735 (34.42%), Postives = 371/735 (50.48%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP--KPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            ++C R +F C +GKCIP    CDG   C D+SDE  +     TC          L         CDG+ DC+N  D   C    C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE++C   E            +K    C   EF+CG+G    CI   W+CDG +DC +   DE +C    C PD+  +C T  +C    ++CD   DC D SDEE C N ++    C+  + FKC ++  CI   +VC+K  DC D SDE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   CS  C N +G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y  ++   KN       + +D +  S  I+W+        +    +          T++ ++I +P G+A DWIHG ++W+D  F+ ISV N T G ++      +  K R IVV P    ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  ++    RR V+S   HL AH F + +FED ++ +D +NE I   ++ TG+  + V+     P  + L+H L QP   EN C  H      C+YLCLP         KF C CPD  +L +D ++C
Sbjct:   25 RKCDRNEFQCGDGKCIPYKWICDGSAECKDSSDESPETCREVTCGTDQFSCGGRLNRCIPMSWKCDGQTDCENGSDENDCTHKVCADDQFTCRSG--KCISLDFVCDEDLDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDPDCEDGSDEEHCEGREP-----------IKTDKPCSPLEFHCGSGE---CIHMSWKCDGGFDCKDK-SDEKDCVKPTCRPDQ-FQCNT-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CEGPDVFKC-RSGECITMDKVCNKKRDCRDWSDE----PLKECGENECLRNNGGCSHICNDLKIGYECLCNEGYRL--VDQKRCEDINECENPNTCSQICINLVGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSVIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMEKADNTSHHETVISNQIQAPDGIAVDWIHGNIYWTDSKFSTISVAN-TEGSKRRTPPSDDLEKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTENIEWPNGITLDLINQRLYWVDSKLHSLSCIDVTGENRRTVISDETHL-AHPFGLTIFEDLVFWTDIENEAIFSANRLTGRNIMKVAEDLLSPEDIVLYHNLRQP-KAENWCEAHHLGNGGCEYLCLPAPHITARSPKFTCACPDGMHLGDDMRSC 709          

HSP 2 Score: 68.1662 bits (165), Expect = 2.949e-10
Identity = 69/220 (31.36%), Postives = 89/220 (40.45%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGK----------------------------------------CIPETLHCDGHDNCGDNSDEI-CDHRET-----------FTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSE 615
            +K C   QF C++GK                                        CIP+   CDG  +C D SDE  C+ RE            F C     I  +  CDG  DC +  D K CVK  C  DQF C T    CI  +  C+   DC D SDE  E C  +N   V +C+    F+C + + CI+    C+ K DC D SDE  K C ++E
Sbjct:  106 HKVCADDQFTCRSGKCISLDFVCDEDLDCDDGSDESYCPAPTCNPAMFQCKDKGICIPKLWACDGDPDCEDGSDEEHCEGREPIKTDKPCSPLEFHCGSGECIHMSWKCDGGFDCKDKSDEKDCVKPTCRPDQFQCNTG--TCIHGSRQCDREYDCKDLSDE--EGC--VN---VTKCEGPDVFKCRSGE-CITMDKVCNKKRDCRDWSDEPLKECGENE 315          
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Match: sp|P35951|LDLR_MOUSE (Low-density lipoprotein receptor OS=Mus musculus OX=10090 GN=Ldlr PE=1 SV=2)

HSP 1 Score: 374.4 bits (960), Expect = 8.037e-114
Identity = 254/734 (34.60%), Postives = 371/734 (50.54%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSD---------SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI---ENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C R +F C++GKCI     CDG   C D SDE  +   + TC           S  I  +  CDG+ DC+ND D + C    CS D F C+     CIS   +C+ + DC DGSDE+   C+         C    HF+C N  +CI  ++ CDG  DC D SDE  +NC   +   + S+ +      S+ C + EF+CG+     CI + W CDG  DC +   DE +C+   C PD+  +C    SC    ++CD   DC D SDE  C N +Q    CD  N+FKC  +  CI+  +VCD   DC D SDE      + C  N C  NNG C   C +     +CLC  G+R+  ++  +C DIDEC +   CS  C N  GSYKCEC  GF+M    + C AVG   +LL++ ++ +R++ L R  Y  +L + KN       + +D +  +  I+W+      +      L+ +  N+   T++   +H+P GLA DWIH  ++W+D     +SV +     R+TL +    S+ R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++   N  AH F + ++ED +Y +D  NE I   ++ TG    LV+     P  + LFH++ QP  +   E   +  N  CQYLCLP      +  KF C CPD   L  D ++C
Sbjct:   27 CSRNEFQCRDGKCIASKWVCDGSPECPDGSDESPETCMSVTCQSNQFSCGGRVSRCIPDSWRCDGQVDCENDSDEQGCPPKTCSQDDFRCQDG--KCISPQFVCDGDRDCLDGSDEA--HCQ------ATTC-GPAHFRC-NSSICIPSLWACDGDVDCVDGSDEWPQNC---QGRDTASKGV------SSPCSSLEFHCGSSE---CIHRSWVCDGEADCKDK-SDEEHCAVATCRPDE-FQCAD-GSCIHGSRQCDREHDCKDMSDELGCVNVTQ----CDGPNKFKC-HSGECISLDKVCDSARDCQDWSDE----PIKECKTNECLDNNGGCSHICKDLKIGSECLCPSGFRL--VDLHRCEDIDECQEPDTCSQLCVNLEGSYKCECQAGFHMDPHTRVCKAVGSIGYLLFTNRHEVRKMTLDRSEYTSLLPNLKNV------VALDTEVTNNRIYWSDLS---QKKIYSALMDQAPNLSYDTIISEDLHAPDGLAVDWIHRNIYWTDSVPGSVSVADTKGVKRRTLFQEAG-SRPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIHSLVTENIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTILEDENRLAHPFSLAIYEDKVYWTDVINEAIFSANRLTGSDVNLVAENLLSPEDIVLFHKVTQPRGVNWCETTALLPNGGCQYLCLPAPQIGPHSPKFTCACPDGMLLAKDMRSC 712          
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Match: sp|P20063|LDLR_RABIT (Low-density lipoprotein receptor (Fragment) OS=Oryctolagus cuniculus OX=9986 GN=LDLR PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 1.258e-112
Identity = 249/736 (33.83%), Postives = 356/736 (48.37%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES---PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEI-VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            +C R +F C+NGKCI     CDG   C D SDE      + TC   +      L         CDG+ DC++  D   C    CS D+F C      CIS+   C+   DC DGSDE+   P  C               HF+C N   C+  ++ CDG+ DC D SDE   P    ++   Q           C  +EF+CG+G    C+   WRCDG  DC +   DE +C+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  ++FKC  +  CI+  +VC+   DC D SDE      + C  N C   NG C   C +     +C C  GYR+  +++ +C DI+EC D  +CS  C N  GSYKCEC  GF +   ++ C AV    +L ++ ++ +R++ L R  Y  ++ + KN       + +D +  S  I+W+          QID      G     T++ S + +P GLA DWIHG ++W+D     +SV +     RKTL R    SK R+IVV P +  ++WTDWG   KIE  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ V+      AH F + +FED ++ +D  NE I   ++ TG    LV+     P  + LFH L QP  +    + A  N  CQYLCLP      +  KF C CPD + L  D ++C
Sbjct:   13 KCGRNEFQCRNGKCISYKWVCDGSSECQDGSDEWEQTCMSLTCKSDDFSCGGRLNRCIPGHWKCDGQQDCEDGSDELGCAPKTCSQDEFRCAEGA--CISRLFACDGEPDCPDGSDEASCAPSTC------------GPAHFRC-NSSSCVPALWACDGEPDCDDGSDEW--PARCGARPSPQ------PGRGPCSRHEFHCGSGE---CVHASWRCDGDADCRDG-SDERDCAAATCRPDE-FQCSD-GTCIHGSRQCDQQQDCGDMSDEVGCVNVTL----CEGPDKFKC-HSGECISLDKVCNSARDCQDWSDE----PIKECATNECMRGNGGCSHTCFDLRIGHECHCPKGYRL--VDQRRCEDINECEDPDICSQLCVNLAGSYKCECRAGFQLDPHSQACKAVDSIAYLFFTNRHEVRKMTLDRSEYTSLIANLKNV------VALDAEVASNRIYWSDLSQRKIYSAQID---GAHGFPAYDTVISSDLQAPDGLAVDWIHGHIYWTDSVLGTVSVADTRGFRRKTLFRQ-EGSKPRAIVVDPAHGFMYWTDWGVPAKIEKGGLNGVDVYSLVTEDIQWPNGITLDLSSGRLYWVDSKLHSISSIDVNGGNRKTVLEDEQRLAHPFSLAIFEDKVFWTDVINEAIFSANRLTGSDVHLVAENLLSPEDIVLFHNLTQPRGVNWCEKTALPNGGCQYLCLPAPQINSHSPKFTCACPDGTLLAADMRSC 698          
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Match: sp|Q99088|LDLR2_XENLA (Low-density lipoprotein receptor 2 OS=Xenopus laevis OX=8355 GN=ldlr-b PE=2 SV=1)

HSP 1 Score: 370.548 bits (950), Expect = 5.147e-112
Identity = 252/734 (34.33%), Postives = 360/734 (49.05%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS---HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP--KPMGVKLFHQLAQPVNIENACINH-----TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            +C R +F C +GKCIP    CDG   C D SDE  +     TC          L         CDG+ DC+N  D   C +  C+ DQF CR+    CIS   +C+ + DC DGSDES       N  +         FQC++K +CI +++ CDG  DC D SDE +C   E            +K    C   EF+CG+G    CI   W+CD  YDC     D+ +C    C PD+  +C    +C    ++CD   DC D SDEE C N ++    C   + FKC ++  CI   +VC K  DC D +DE      + C +N C  NNG C   C +     +CLC  GYR+  +++ +C DI+EC +   C+  C N  G YKCEC EG+ M      C ++G   +L ++ ++ +R++ L R  Y   +   KN       + +D +  S  I+W+        +    +          T++ ++I +P G+A DWIHG ++W+D  F+ ISV N     RKTL    + +K R IVV P    ++WTDWG   KIE  G++G DR  L+ D +  PNG+ LD     LYWVD+K   +S  ++    RR V+S   HL AH F + +FED ++ +D +NE I    + TG+  + V+     P  + L+H L QP   EN C +H      C YLCLP         KF C CPD  +L  D + C
Sbjct:   26 KCDRNEFQCGDGKCIPYKWICDGSAECKDGSDESSETCRALTCGADQFSCGGRLNRCIPMSWKCDGQTDCENGSDENDCTRKVCADDQFTCRSG--KCISLDFVCDQDQDCDDGSDESYCPAPTCNPAM---------FQCKDKGICIPKLWACDGDRDCEDGSDEDHCEGREP-----------IKTDKPCAPLEFHCGSGE---CIHMSWKCDAGYDCKHK-SDDKDCVKPTCRPDQ-FQCND-GTCIHGSRQCDREYDCKDLSDEEGCVNVTK----CQGPDVFKC-RSGECITMDKVCHKKRDCRDWTDE----PIKECGENECLRNNGGCSHICNDLKIGYECLCNEGYRL--VDQKRCEDINECENPNTCTQICINLHGGYKCECREGYQMDPVTASCKSIGTVAYLFFTNRHEVRKMTLDRSEYTSFIPRLKNV------VALDMEIASNKIYWSDL--TQRKIYSASMDKADNTSHHETVISNQIQAPDGIAVDWIHGNIYWTDSKFSTISVANTEGSKRKTLF-TDDLAKPRDIVVDPSQGFMYWTDWGLPAKIEKGGLNGVDRYPLVTDNIEWPNGITLDLISQRLYWVDSKLHSLSCIDITGENRRTVLSDETHL-AHPFGLTIFEDLVFWTDIENEAIFSAKRLTGENIMKVAEHLLSPEDIVLYHNLRQP-KAENWCESHHLGNGGCGYLCLPAPHVNARSPKFTCACPDGMHLGTDMRNC 709          

HSP 2 Score: 60.8474 bits (146), Expect = 6.414e-8
Identity = 66/219 (30.14%), Postives = 84/219 (38.36%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGK----------------------------------------CIPETLHCDGHDNCGDNSDE-ICDHRE-----------TFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSE 615
            K C   QF C++GK                                        CIP+   CDG  +C D SDE  C+ RE            F C     I  +  CD   DC +  D K CVK  C  DQF C      CI  +  C+   DC D SDE  E C  +N   V +C     F+C + + CI+    C  K DC D +DE  K C ++E
Sbjct:  107 KVCADDQFTCRSGKCISLDFVCDQDQDCDDGSDESYCPAPTCNPAMFQCKDKGICIPKLWACDGDRDCEDGSDEDHCEGREPIKTDKPCAPLEFHCGSGECIHMSWKCDAGYDCKHKSDDKDCVKPTCRPDQFQCNDG--TCIHGSRQCDREYDCKDLSDE--EGC--VN---VTKCQGPDVFKCRSGE-CITMDKVCHKKRDCRDWTDEPIKECGENE 315          
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Match: sp|P01130|LDLR_HUMAN (Low-density lipoprotein receptor OS=Homo sapiens OX=9606 GN=LDLR PE=1 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 5.421e-111
Identity = 256/759 (33.73%), Postives = 369/759 (48.62%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNI----ENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRV 2340
            RC R +F CQ+GKCI     CDG   C D SDE  +   + TC   +          I +   CDG+ DCDN  D + C    CS D+F C      CIS+  +C+ + DC DGSDE+  +C ++   P   QC++S          CI +++ CD   DC D SDE           + + L      S+ C   EF+C +G    CI   WRCDG  DC +   DE NC+   C PD+  +C    +C    ++CD   DC D SDE  C N +     C+  N+FKC  +  CI   +VC+   DC D SDE      + C  N C  NNG C   C +     +CLC  G+++  + + +C DIDEC D   CS  C N  G YKC+C EGF +    K C AVG   +L ++ ++ +R++ L R  Y  ++ + +N       + +D +  S  I+W+    +  ++    L    G     T++   I +P GLA DWIH  ++W+D     +SV +     RKTL R  N SK R+IVV P +  ++WTDWG   KI+  G++G D   L+ + +  PNG+ LD     LYWVD+K   IS  ++    R+ ++      AH F + VFED ++ +D  NE I   ++ TG    L++     P  + LFH L QP  +         N  CQYLCLP      +  KF C CPD   L  D ++C  T++E    T   S+  LK   + V
Sbjct:   26 RCERNEFQCQDGKCISYKWVCDGSAECQDGSDESQETCLSVTCKSGDFSCGGRVNRCIPQFWRCDGQVDCDNGSDEQGCPPKTCSQDEFRCHDG--KCISRQFVCDSDRDCLDGSDEA--SCPVLTCGPASFQCNSST---------CIPQLWACDNDPDCEDGSDEW--------PQRCRGLYVFQGDSSPCSAFEFHCLSGE---CIHSSWRCDGGPDCKDK-SDEENCAVATCRPDE-FQCSD-GNCIHGSRQCDREYDCKDMSDEVGCVNVTL----CEGPNKFKC-HSGECITLDKVCNMARDCRDWSDE----PIKECGTNECLDNNGGCSHVCNDLKIGYECLCPDGFQL--VAQRRCEDIDECQDPDTCSQLCVNLEGGYKCQCEEGFQLDPHTKACKAVGSIAYLFFTNRHEVRKMTLDRSEYTSLIPNLRNV------VALDTEVASNRIYWSDL--SQRMICSTQLDRAHGVSSYDTVISRDIQAPDGLAVDWIHSNIYWTDSVLGTVSVADTKGVKRKTLFR-ENGSKPRAIVVDPVHGFMYWTDWGTPAKIKKGGLNGVDIYSLVTENIQWPNGITLDLLSGRLYWVDSKLHSISSIDVNGGNRKTILEDEKRLAHPFSLAVFEDKVFWTDIINEAIFSANRLTGSDVNLLAENLLSPEDMVLFHNLTQPRGVNWCERTTLSNGGCQYLCLPAPQINPHSPKFTCACPDGMLLARDMRSCL-TEAEAAVATQETSTVRLKVSSTAV 736          
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Match: A0A1S6KMH2 (Uncharacterized protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 1675.6 bits (4338), Expect = 0.000e+0
Identity = 859/860 (99.88%), Postives = 860/860 (100.00%), Query Frame = 1
Query:   55 MKYXXXXXXXXXXXXXXXXQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN 2634
            MKYLLISCLVISIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICV+NKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISVSSSSLKPKQSRVNVYLIVGLVITIVLLISLVLVGLGIAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN
Sbjct:    1 MKYLLISCLVISIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVQNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISVSSSSLKPKQSRVNVYLIVGLVITIVLLISLVLVGLGIAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN 860          
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Match: W5MM69 (Low density lipoprotein receptor OS=Lepisosteus oculatus OX=7918 GN=LDLR PE=4 SV=1)

HSP 1 Score: 402.519 bits (1033), Expect = 7.371e-122
Identity = 260/741 (35.09%), Postives = 377/741 (50.88%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN-KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLV--RLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILV--SSPKPMGVKLFHQLAQPVNIENAC-----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSE 2280
            C    F C N KCI     CDG D+CGD SDE+       TC  S       L         CDGK DC+N  D + C   +C+ D+F CR    NC+S + +C+  +DC DGSDE+  +C      P   QC+NS+         C+ R++ CDG +DC+D SDE          +           +  C   EF CG G    CI   WRCDGS DCP+ + DE NC    CSPD+  +C    +C    ++CD   DC D SDE  CSN ++    C+  ++F+C ++  CI   +VCD+  DC D SDE      + CD N C INNG C   C +     +CLC  G+ +  +++ +C DIDECA+   CS  C N  GSYKCEC EG+ +    K C A+G   +L ++ ++ +R++ L R  Y  ++   KN       + +D +  S  I+W+    + + +   H+     +    T++ S I +P G+A DWIHG ++W+D  F  ISV       RKTL+  RL   ++ R+IVV P +  ++WTDWG   KIE  G++G DR  L+ + +  PNG+ LD     LYWVD+K   +S  +++   RR+V+      AH F + VFE+ ++ +D +N  I+  ++ TG   + V  +   P  + L+H L QP   EN C      N  C+YLCLP      +  K+ C CPD   L  D + C P  SE
Sbjct:   32 CSAGLFQCANEKCITTRWVCDGTDDCGDGSDEVTSVCMAKTCKPSEFSCGGRLNQCVPSGWRCDGKKDCENGADEESCAPRECADDEFRCRNG--NCVSVSFVCDEEDDCEDGSDEA--SCPAPTCGPASFQCNNSV---------CVPRLWACDGDADCADGSDE-------GPAACGGQAGPAPPHAARCSPLEFQCGGGQ---CIHSSWRCDGSNDCPD-HSDEDNCIKPTCSPDE-FQCSD-GACIHGSRQCDKEYDCKDLSDELGCSNVTK----CEGPSKFRC-RSGECIGVDKVCDRQRDCRDWSDE----PVKECDNNECLINNGGCSHTCNDLKIGFECLCPEGFHL--VDKKRCEDIDECANPDTCSQICVNLEGSYKCECEEGYQIDPVTKSCKAIGTVAYLFFTNRHEVRKMTLDRSEYTRLIPRLKNV------VALDMEIPSNKIYWSDL--SQKKIYSTHMDKAGNSSHHSTVIESGIEAPEGIAVDWIHGNIYWTDSVFGTISVATTDGHRRKTLISERL---ARPRAIVVDPVHNFMYWTDWGTPAKIEKGGLNGVDRVPLVTENIEWPNGITLDLLNQRLYWVDSKLHSLSSIDVRGGNRREVIMDEEKLAHPFSLTVFEEKVFWTDIENSAILSANRLTGGDIVAVVENVALPEDIVLYHNLKQPTG-ENWCESGKLPNGGCEYLCLPAPQINRHSAKYTCACPDHLTLGPDMRKCVPVSSE 723          

HSP 2 Score: 68.1662 bits (165), Expect = 1.072e-7
Identity = 72/243 (29.63%), Postives = 97/243 (39.92%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADC--DNDEDPKICVKNKCSIDQFMCRTKPM-------NCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL--NCSNFEC 801
            + C   +F C+NG C+  +  CD  D+C D SDE      T     F C++S  + +   CDG ADC   +DE P  C            R  P+        CI  +  C+ +NDC D SDE     +   KP      +   FQC +   CI     CD + DC D SDE  C +    +  S+                F C +G    CI  +  CD   DC   + DE    C N EC
Sbjct:  112 RECADDEFRCRNGNCVSVSFVCDEEDDCEDGSDEASCPAPTCGPASFQCNNSVCVPRLWACDGDADCADGSDEGPAACGGQAGPAPPHAARCSPLEFQCGGGQCIHSSWRCDGSNDCPDHSDE-----DNCIKPTC----SPDEFQCSDGA-CIHGSRQCDKEYDCKDLSDELGCSNVTKCEGPSK----------------FRCRSGE---CIGVDKVCDRQRDC-RDWSDEPVKECDNNEC 324          
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Match: A0A3Q3LTV1 (Low density lipoprotein receptor a OS=Mastacembelus armatus OX=205130 PE=4 SV=1)

HSP 1 Score: 394.43 bits (1012), Expect = 4.515e-119
Identity = 257/738 (34.82%), Postives = 381/738 (51.63%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSD--SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES---PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPT 2271
            C   Q  C NGKCI     CDG D+CGD +DE+        C   E F+C+   +  +  T  CDGKADCDN  D + CV   C+  +F C +    C+S + +C+   DC DGSDE+   P  C            ++  F+C N  +C+ R++ CDG +DC D SDE  +NC         +Q  A  V+Q   C + EF+CG+G    CI   W+CDG  DC +   DE+NC++  C PD+  +C    +C    ++CD   DC+D SDE  C N ++    C+  + F+C ++  C++ ++VCDK  DC D SDE        C  N C  NNG C   C +     +CLC  GY +  +++ +C DIDECA    CS  C N +GSYKC+C EG+ +    K C A+G   +L ++ ++ +R++ L R  Y  ++   KN       + +D +  +K I+W+    + + +    + S         ++ S + +P G+A+DWIHG L+W+D   + ISV       RKTL R  N SK RSIVV P    I+WTDWG   KIE  G++G DR VL+ D +  PNG+ LD     LYWVD+K   +S  +++   RR +++  +  AH   + VFE+ ++ +D  N  I+  ++ TG     V+     P  + L+H L QP    N C   N  C++LCL       +  K+ C CPD   L  D +TC P 
Sbjct:   23 CGTDQLQCGNGKCITVRWVCDGTDDCGDGTDELPATCLAKTCRPTE-FSCTGRLNQCVPSTWRCDGKADCDNGADEESCVPRPCTHTEFRCGSG--QCVSSSFVCDDEPDCDDGSDEASCPPVTC------------SATSFRC-NNSICVPRLWACDGDADCLDGSDEWPQNC--------GTQRPATAVRQ---CSSLEFHCGSGE---CIHSNWKCDGGIDCLD-QSDEVNCAHPTCRPDE-YQCGD-GTCIHGSRQCDHQYDCSDMSDETGCVNATR----CEGPSRFRC-RSGECVSMEKVCDKRRDCRDWSDE----PLRECGSNECLYNNGGCSHICKDLKIGYECLCPAGYSL--VDQRRCEDIDECASPDTCSQICINQIGSYKCQCEEGYQVDPATKACKAIGTVAYLFFTNRHEVRKMTLDRSEYTRVIPRLKNA------VALDMNMATKEIYWSDI--SQKKIYRAPMDSAEDATHHSVVIGSDVDAPEGIAFDWIHGNLYWTDSIRSTISVTTADGSRRKTLFRH-NISKPRSIVVDPHSNFIYWTDWGNHAKIEKGGLNGGDRTVLVTDNIVWPNGITLDLLNQRLYWVDSKLHTLSSIDVQGGGRRTLIADEDKLAHPLGLTVFEERVFWTDVSNSAILSANRLTGDDIAPVAEHLSSPEDIILYHNLKQPAG-RNWCQVSNGGCEFLCLAAPQVGGHPPKYTCACPDNMMLARDMRTCVPA 706          
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Match: A0A484CKQ0 (Uncharacterized protein OS=Perca flavescens OX=8167 GN=EPR50_G00153770 PE=4 SV=1)

HSP 1 Score: 396.741 bits (1018), Expect = 8.038e-119
Identity = 257/731 (35.16%), Postives = 373/731 (51.03%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSD--SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPT 2271
            C   QF C NGKCI     CDG D+CGD +DE+        C   E F C+D  +  +  T  CDGKADC+N  D   C   +C+  +F C+     C+S + +C+   DC DGSDE+  +C       V  C N   FQC N  +CI R++ CDG +DCSD SDE   P +  +K+   + A        C + EF CG+G    CI   W+CDG  DC +   DE  C+   C PD+   C    +C    ++C+   DC D SDE  C N +Q    C+    FKC +N  CI+ ++VCDK  DC D SDE        C  N C  NNG C   C +     +CLC  G+R+  +++ +C DIDECA+   CS  C N +GSYKC+C EG+ +    K C A+G   +L ++ ++ +R++ L +  Y  ++   KN       + +D +  +K I+W+    + + +    + S         ++ S I +P G+A+DWIHG L+W+D   + ISV+      RKTL   G  SK R IVV P    I+WTDWG   KIE  G++G DR  L+ D +  PNG+ LD     LYWVD+K   +S  +++   RR ++   H  AH   + VFED ++ +D  N  I+  ++ TG+    V+     P  + LFH L QP    + C    C ++CL       +  K+ C+CP+   L  D +TC P 
Sbjct:   38 CGSSQFQCGNGKCITVRWVCDGTDDCGDGTDELPGTCMAKTCRPTE-FNCADRLNQCVPSTWRCDGKADCENGADEDSCAPKQCADTEFRCKNG--QCLSSSFVCDDEADCGDGSDEA--SCP------VASC-NPRSFQC-NNTVCIPRLWSCDGDADCSDGSDEW--PQNCGTKTPDSAAAHQ------CSSLEFRCGSGE---CIHGSWKCDGGADCLD-QSDEAECARSTCRPDE-FECGD-GTCIHGSRQCNHQYDCRDMSDEAGCVNATQ----CEGPTRFKC-RNGECISMEKVCDKHRDCSDWSDE----PLRECGSNECLYNNGGCSHICNDLRIGYECLCPTGFRL--VDKKRCEDIDECANPDTCSQICINLIGSYKCQCEEGYQVDPATKACKAIGTIAYLFFTNRHEVRKMTLDKSEYTRVIPRLKNV------VALDMNMAAKEIYWSDI--SQKKIYRAQMDSAEDTAHHSVVIGSGIDAPEGIAFDWIHGNLYWTDSIRSSISVVTADGSRRKTLFHQG-LSKPRGIVVDPHSNFIYWTDWGNPAKIEKAGLNGGDRTALVTDNIVWPNGITLDLVNQRLYWVDSKLHTLSSIDVQGSGRRTIIIDEHRLAHPLGLTVFEDKVFWTDVSNNAILSANRLTGEDITPVAEHLTSPEDIVLFHNLKQPAG-RDWCKVSGCAFMCLAAPQVGRHSPKYTCVCPNNMMLDRDMRTCVPA 720          

HSP 2 Score: 73.1738 bits (178), Expect = 2.868e-9
Identity = 50/127 (39.37%), Postives = 67/127 (52.76%), Query Frame = 1
Query:  664 TICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL--NCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            T C +++F CG G    CI   W CDG+ DC +   DEL   C    C P + N    ++ C  +  RCDG  DC + +DE+ C+ P Q   +     EF+C KN  C++   VCD   DCGDGSDE
Sbjct:   36 TTCGSSQFQCGNGK---CITVRWVCDGTDDCGDG-TDELPGTCMAKTCRPTEFNCADRLNQCVPSTWRCDGKADCENGADEDSCA-PKQCADT-----EFRC-KNGQCLSSSFVCDDEADCGDGSDE 151          

HSP 3 Score: 71.633 bits (174), Expect = 7.970e-9
Identity = 68/244 (27.87%), Postives = 103/244 (42.21%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI------CDHRETFTCSDSNIILKTELCDGKADCDNDED----------PKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-NCSNFEC 801
            K+C   +F C+NG+C+  +  CD   +CGD SDE       C+ R +F C+++  I +   CDG ADC +  D          P     ++CS  +F C +    CI  +  C+   DC D SDE+ E      +P   +C +           CI     C+ + DC D SDE  C ++   +  ++                F C  G    CI+ E  CD   DC +   + L  C + EC
Sbjct:  118 KQCADTEFRCKNGQCLSSSFVCDDEADCGDGSDEASCPVASCNPR-SFQCNNTVCIPRLWSCDGDADCSDGSDEWPQNCGTKTPDSAAAHQCSSLEFRCGSG--ECIHGSWKCDGGADCLDQSDEA-ECARSTCRPDEFECGDGT---------CIHGSRQCNHQYDCRDMSDEAGCVNATQCEGPTR----------------FKCRNGE---CISMEKVCDKHRDCSDWSDEPLRECGSNEC 329          
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Match: A0A2I4B9F9 (low-density lipoprotein receptor OS=Austrofundulus limnaeus OX=52670 GN=ldlr PE=4 SV=1)

HSP 1 Score: 395.201 bits (1014), Expect = 8.894e-119
Identity = 262/755 (34.70%), Postives = 383/755 (50.73%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSD--SNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV--SHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENACI-NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRV 2340
            C   QF C  GKCI     CDG D+CGD +DE+        C   + F+C+D  +N +  +  CDGKADC+N  D + C   +C+  +F C+     CIS T +C+ + DC DGSDE       ++ P  V C +S  FQC N  +CI R++ CDG  DC D SDE     SEN K ++++       +  C + EF C +G    CI   W+CDG  DC +   DE +C+   C PD+   C    +C    ++C+ Y DC D SDE  C N S     CD    FKC ++  CI+ ++VCD   DC D SDE        C  N C+ NNG C   C +     KCLC  GY +  ++  +C DIDECA+   CS  C N +GSYKCEC EG+ +    K C A+G   +L ++ ++ +R++ L +  Y  ++   KN       + +D +  +K IFW+          +  L     +     ++ + I +P G+A+DWIHG L+W+D     ISV+      RKTL    N SK R++VV P    I+WTDWG   KIE  G++G DR  L+ D +  PNG+ LD     LYWVD+K   +S  +++   R  ++   H  AH   + VFE+ ++ +D  N  I+  ++ TG+    V+     P  + L+H L QP   +   + N +C+++CLP         K+ C+CPD   L  D +TC P            +SS+  P QS V
Sbjct:   25 CESSQFQCGTGKCITMRWVCDGMDDCGDGTDELPSVCLVKTCKPTD-FSCADRHNNCVPSSWRCDGKADCENGADEENCAPRQCTNSEFRCKNG--QCISSTFVCDQDTDCYDGSDE-------LSCP-AVTCKSS-SFQC-NNTVCIPRLWACDGDRDCLDGSDEW----SENCKQQART----TPAAPQCSSREFQCASGE---CIHSTWKCDGENDCLD-RSDEADCARVTCRPDE-FECGD-GTCIHGSRQCNSYYDCKDMSDELGCVNVSH----CDGPTRFKC-RSGECISMEKVCDNKRDCRDWSDE----PLRECGSNECQYNNGGCSHICNDLKIGYKCLCPTGYSL--VDNKRCEDIDECANPETCSQICINQMGSYKCECEEGYQVDPATKACKAIGTIAYLFFTNRHEVRKMTLDKSEYTRVIPRLKNV------VALDMNMATKEIFWSDISQKKIYRTLMDLAEDASHH--HVVIDNDIDAPEGIAFDWIHGHLYWTDSIRRTISVVTADGSRRKTLFH-QNLSKPRAVVVDPHSNFIYWTDWGNPAKIEKGGLNGVDRTALVIDNIVWPNGITLDILSQRLYWVDSKLHTLSSIDVQGDSRHTLIIDEHQLAHPLGLTVFEERVFWTDVSNNAILSANRLTGEDVAPVAEHLSSPEDIILYHNLKQPAGRDWCQVSNSSCEFMCLPAPQVGRRPPKYTCVCPDNMMLARDMRTCVPAVPTTAVPIEPETSSTRPPHQSPV 732          

HSP 2 Score: 69.707 bits (169), Expect = 3.309e-8
Identity = 52/132 (39.39%), Postives = 67/132 (50.76%), Query Frame = 1
Query:  649 LVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELN--CSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDE 1038
            L    T C++++F CG G    CI   W CDG  DC +   DEL   C    C P   +     ++C  +  RCDG  DC + +DEE C+ P Q   S     EF+C KN  CI+   VCD+  DC DGSDE
Sbjct:   18 LTNALTACESSQFQCGTGK---CITMRWVCDGMDDCGDG-TDELPSVCLVKTCKPTDFSCADRHNNCVPSSWRCDGKADCENGADEENCA-PRQCTNS-----EFRC-KNGQCISSTFVCDQDTDCYDGSDE 138          

HSP 3 Score: 65.4698 bits (158), Expect = 5.893e-7
Identity = 67/243 (27.57%), Postives = 101/243 (41.56%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE-----ICDHRETFTCSDSNIILKTELCDGKADC--DNDEDPKIC--------VKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-NCSNFEC 801
            ++C   +F C+NG+CI  T  CD   +C D SDE     +     +F C+++  I +   CDG  DC   +DE  + C           +CS  +F C +    CI  T  C+  NDC D SDE+ +   +  +P   +C +           CI     C+   DC D SDE  C +  +    ++                F C +G    CI+ E  CD   DC +   + L  C + EC
Sbjct:  105 RQCTNSEFRCKNGQCISSTFVCDQDTDCYDGSDELSCPAVTCKSSSFQCNNTVCIPRLWACDGDRDCLDGSDEWSENCKQQARTTPAAPQCSSREFQCASG--ECIHSTWKCDGENDCLDRSDEA-DCARVTCRPDEFECGDGT---------CIHGSRQCNSYYDCKDMSDELGCVNVSHCDGPTR----------------FKCRSGE---CISMEKVCDNKRDCRDWSDEPLRECGSNEC 316          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 369.777 bits (948), Expect = 3.383e-113
Identity = 266/835 (31.86%), Postives = 400/835 (47.90%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTC---------SDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            K C    F+C+NG+CIP+  HCDG  +C D SDE  +   T TC           +  I     CDG++DCDN ED   C    C++ +F C +    CIS+  +CN  +DC DGSDE   +P +C                FQC N   CI   + CD   DC D SDE       N    ++           C  +E  CG+G    CI ++WRCDG  DC +   DE NC    C PD+  +C+   SC    ++C+G  DCTD +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C +NNG C   C +     +C C PG ++  I+   C DI+EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW           +       G  K    V   +  PVG+A DWI+  ++WSD+    I V N  NG ++ ++   N  +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D ++E I   +K TG    ++++   +P  + ++H+L Q ++  N C     N  C Y+CLP     ++  K+ C+CP    L +DG  C P         IS S   +K  +     +        + +L+  +    G  M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   65 KMCAETDFVCRNGQCIPKRWHCDGEPDCEDGSDEGTEQCYTRTCRMNEFSCGVGSTPCIPVFWKCDGESDCDNGEDEMNCGNVTCALLEFTCTSG--RCISQNFVCNGEDDCGDGSDEQDCAPSSC------------GPNEFQCGNAT-CIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAK-----------CSVSEILCGSGE---CIHRKWRCDGDADCKDG-SDEKNCPARSCRPDQ-FKCED-GSCIHGSRQCNGIRDCTDGTDEVNCKNLTQ----CNGPDKFKC-RSGECIDMHKVCNKARDCPDWSDE----PIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQL--IDRKTCGDINECLNPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFTQQRIFWADLGQKAIFSTVLDKREDVGYTK----VIDNVQMPVGIAVDWIYKNIYWSDLGSKTIVVANF-NGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQ-LSGTNWCNEKVNNGGCSYMCLPAPQINKHSPKYTCVCPVGQELSSDGLRCRP------EGNISTSIHEVKSAKGSAAAW------AVLPVLLLAMAAAGGYLMWRNWQLKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAI 831          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 370.163 bits (949), Expect = 3.796e-113
Identity = 267/844 (31.64%), Postives = 402/844 (47.63%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTC---------SDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKS-EFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXA--------MYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            K C    F+C+NG+CIP+  HCDG  +C D SDE  +   T TC           +  I     CDG++DCDN ED   C    C++ +F C +    CIS+  +CN  +DC DGSDE   +P +C                FQC N   CI   + CD   DC D SDE       N    ++           C  +E  CG+G    CI ++WRCDG  DC +   DE NC    C PD+  +C+   SC    ++C+G  DCTD +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C +NNG C   C +     +C C PG ++  I+   C DI+EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW           +       G  K    V   +  PVG+A DWI+  ++WSD+    I V N  NG ++ ++   N  +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D ++E I   +K TG    ++++   +P  + ++H+L Q ++  N C     N  C Y+CLP     ++  K+ C+CP    L +DG  C P  S +  +        S  P++  ++  +              VL  L +A        M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   65 KMCAETDFVCRNGQCIPKRWHCDGEPDCEDGSDEGTEQCYTRTCRMNEFSCGVGSTPCIPVFWKCDGESDCDNGEDEMNCGNVTCALLEFTCTSG--RCISQNFVCNGEDDCGDGSDEQDCAPSSC------------GPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAK-----------CSVSEILCGSGE---CIHRKWRCDGDADCKDG-SDEKNCPARSCRPDQ-FKCED-GSCIHGSRQCNGIRDCTDGTDEVNCKNLTQ----CNGPDKFKC-RSGECIDMHKVCNKARDCPDWSDE----PIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQL--IDRKTCGDINECLNPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFTQQRIFWADLGQKAIFSTVLDKREDVGYTK----VIDNVQMPVGIAVDWIYKNIYWSDLGSKTIVVANF-NGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQ-LSGTNWCNEKVNNGGCSYMCLPAPQINKHSPKYTCVCPVGQELSSDGLRCRPVASTDAPQDEGRTLIHSTHPQEGNISTSIHEVKSAKGSAAAWAVLPVLLLAMAAAGGYLMWRNWQLKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAI 852          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Match: ldlra (low density lipoprotein receptor [Source:NCBI gene;Acc:103022705])

HSP 1 Score: 370.163 bits (949), Expect = 5.562e-113
Identity = 255/734 (34.74%), Postives = 362/734 (49.32%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRD-VVSHLN-AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPT 2271
            C    F C NGKCI     CDG D+CGD +DE+     T TC  S       L         CD  ADC+N  D   C    C   +F C +    C+S+  +C+   DC DGSDE+        + L   C +S  F C N   CI R++ CDG +DC D SDE  +NC         +QS     ++S  C   EF+CG+G    CI   WRCDG  DC +   DE NC+   C PD+  RC    SC    ++C+   DC D SDE  C N S     C+  + FKC  +  CI+ ++VC+K  DC D SDE        CD N C  NNG C   C +     +CLC  G+R+  +++ +C DIDECA+   CS  C N +GSYKCEC EG+ +    K C A+G   +L ++ ++ +R++ L R  Y  ++   KN       + +D +  +K IFW     + + +    + S   + +   ++ S + +P G+A DWIHG ++W+D     ISV       RKTL +  + +K R+IVV P    ++WTDWG   KIE  G++G DR  L+ D +  PNG+ LD     LYWVD+K   +S  +++   RR  +V H   AH   + VFE+ ++ +D  N  I+  ++ TG    K+      P  + LFH L QP    N C   N  C++LCL          K+ C CPD   L    + C P 
Sbjct:   24 CGIRDFQCGNGKCIILRWMCDGADDCGDGTDELPSACLTRTCRTSEFSCGGRLNQCIPNSWKCDSHADCENGADEVGCGTKHCLSGEFRCASG--QCVSRAFVCDEEADCQDGSDEA--------QCLPTTCSSS-SFHCNNSA-CIPRLWACDGDTDCGDGSDEWPQNC--------GAQSTVP-PERSRHCAVQEFHCGSGE---CIHNSWRCDGDPDCLD-RSDEKNCTVSTCQPDE-FRCGD-GSCIHGSRQCNQVYDCKDMSDELGCVNASH----CEAPSRFKC-HSGECISMEQVCNKQRDCRDWSDE----PLRECDSNECMYNNGGCSHVCNDLKIGYECLCPSGFRL--VDKKRCEDIDECANPDTCSQICINQVGSYKCECEEGYQIDPATKACKAIGTIAYLFFTNRHEVRKMTLDRSEYTRVISRLKNA------VALDMNIATKEIFWCDL--SLKKIYRASMDSAADSSQHNIVIGSGVDAPEGIAVDWIHGNIYWTDSIRGTISVATADGRKRKTLFK-KDLAKPRAIVVDPLKNFVYWTDWGTPAKIERGGLNGVDRSALVTDNIVWPNGITLDLLNQRLYWVDSKLHTLSSIDVQGGSRRTLIVDHGRLAHPLSLTVFEEKVFWTDVSNNAILSANRVTGGDITKVAEHLSSPEDIVLFHNLKQP-RATNWCTFANGGCEFLCLAAPQVNRFSPKYTCACPDNMMLDTTMRKCVPA 709          

HSP 2 Score: 51.6026 bits (122), Expect = 5.045e-6
Identity = 41/123 (33.33%), Postives = 57/123 (46.34%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICV-KNKC-SIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACE 465
            + C   +F C +G+CI  +  CDG  +C D SDE       C   E F C D + I  +  C+   DC +  D   CV  + C +  +F C +    CIS   +CN   DC D SDE    C+
Sbjct:  193 RHCAVQEFHCGSGECIHNSWRCDGDPDCLDRSDEKNCTVSTCQPDE-FRCGDGSCIHGSRQCNQVYDCKDMSDELGCVNASHCEAPSRFKCHSG--ECISMEQVCNKQRDCRDWSDEPLRECD 312          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Match: ldlra (low density lipoprotein receptor [Source:NCBI gene;Acc:103022705])

HSP 1 Score: 369.777 bits (948), Expect = 8.595e-113
Identity = 255/734 (34.74%), Postives = 362/734 (49.32%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTEL---------CDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE--KNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRD-VVSHLN-AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPT 2271
            C    F C NGKCI     CDG D+CGD +DE+     T TC  S       L         CD  ADC+N  D   C    C   +F C +    C+S+  +C+   DC DGSDE+        + L   C +S  F C N   CI R++ CDG +DC D SDE  +NC         +QS     ++S  C   EF+CG+G    CI   WRCDG  DC +   DE NC+   C PD+  RC    SC    ++C+   DC D SDE  C N S     C+  + FKC  +  CI+ ++VC+K  DC D SDE        CD N C  NNG C   C +     +CLC  G+R+  +++ +C DIDECA+   CS  C N +GSYKCEC EG+ +    K C A+G   +L ++ ++ +R++ L R  Y  ++   KN       + +D +  +K IFW     + + +    + S   + +   ++ S + +P G+A DWIHG ++W+D     ISV       RKTL +  + +K R+IVV P    ++WTDWG   KIE  G++G DR  L+ D +  PNG+ LD     LYWVD+K   +S  +++   RR  +V H   AH   + VFE+ ++ +D  N  I+  ++ TG    K+      P  + LFH L QP    N C   N  C++LCL          K+ C CPD   L    + C P 
Sbjct:   35 CGIRDFQCGNGKCIILRWMCDGADDCGDGTDELPSACLTRTCRTSEFSCGGRLNQCIPNSWKCDSHADCENGADEVGCGTKHCLSGEFRCASG--QCVSRAFVCDEEADCQDGSDEA--------QCLPTTCSSS-SFHCNNSA-CIPRLWACDGDTDCGDGSDEWPQNC--------GAQSTVP-PERSRHCAVQEFHCGSGE---CIHNSWRCDGDPDCLD-RSDEKNCTVSTCQPDE-FRCGD-GSCIHGSRQCNQVYDCKDMSDELGCVNASH----CEAPSRFKC-HSGECISMEQVCNKQRDCRDWSDE----PLRECDSNECMYNNGGCSHVCNDLKIGYECLCPSGFRL--VDKKRCEDIDECANPDTCSQICINQVGSYKCECEEGYQIDPATKACKAIGTIAYLFFTNRHEVRKMTLDRSEYTRVISRLKNA------VALDMNIATKEIFWCDL--SLKKIYRASMDSAADSSQHNIVIGSGVDAPEGIAVDWIHGNIYWTDSIRGTISVATADGRKRKTLFK-KDLAKPRAIVVDPLKNFVYWTDWGTPAKIERGGLNGVDRSALVTDNIVWPNGITLDLLNQRLYWVDSKLHTLSSIDVQGGSRRTLIVDHGRLAHPLSLTVFEEKVFWTDVSNNAILSANRVTGGDITKVAEHLSSPEDIVLFHNLKQP-RATNWCTFANGGCEFLCLAAPQVNRFSPKYTCACPDNMMLDTTMRKCVPA 720          

HSP 2 Score: 60.8474 bits (146), Expect = 6.102e-9
Identity = 67/245 (27.35%), Postives = 100/245 (40.82%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDN--DEDPKICVKNK---------CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDEL-NCSNFEC 801
            K C   +F C +G+C+     CD   +C D SDE       C    +F C++S  I +   CDG  DC +  DE P+ C             C++ +F C +    CI  +  C+ + DC D SDE         K   V       F+C +   CI     C+   DC D SDE  C ++ + ++ S+                F C +G    CI+ E  C+   DC +   + L  C + EC
Sbjct:  115 KHCLSGEFRCASGQCVSRAFVCDEEADCQDGSDEAQCLPTTCS-SSSFHCNNSACIPRLWACDGDTDCGDGSDEWPQNCGAQSTVPPERSRHCAVQEFHCGSG--ECIHNSWRCDGDPDCLDRSDE---------KNCTVSTCQPDEFRCGDGS-CIHGSRQCNQVYDCKDMSDELGCVNASHCEAPSR----------------FKCHSGE---CISMEQVCNKQRDCRDWSDEPLRECDSNEC 327          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:103023739])

HSP 1 Score: 367.851 bits (943), Expect = 4.185e-112
Identity = 268/860 (31.16%), Postives = 406/860 (47.21%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTC---------SDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKS---------EFFRKTIXXXXXXLKPKQS----------RVNVYXXXXXXXXXXXXXXXXXXXXXXA------MYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
            K C    F+C+NG+CIP+  HCDG  +C D SDE  +   T TC           +  I     CDG++DCDN ED   C    C++ +F C +    CIS+  +CN  +DC DGSDE   +P +C                FQC N   CI   + CD   DC D SDE       N    ++           C  +E  CG+G    CI ++WRCDG  DC +   DE NC    C PD+  +C+   SC    ++C+G  DCTD +DE  C N +Q    C+  ++FKC ++  CI   +VC+K  DC D SDE      + C+ N C +NNG C   C +     +C C PG ++  I+   C DI+EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  IR+L L  R Y  ++   +N       + +D D+  + IFW           +       G  K    V   +  PVG+A DWI+  ++WSD+    I V N  NG ++ ++   N  +  SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    RR V+   +  AH F + VFED ++ +D ++E I   +K TG    ++++   +P  + ++H+L Q ++  N C     N  C Y+CLP     ++  K+ C+CP    L +DG  C P  S              T     ++ KPK +            +++ +     +      L ++ L +A      M+RN+  +  K++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   65 KMCAETDFVCRNGQCIPKRWHCDGEPDCEDGSDEGTEQCYTRTCRMNEFSCGVGSTPCIPVFWKCDGESDCDNGEDEMNCGNVTCALLEFTCTSG--RCISQNFVCNGEDDCGDGSDEQDCAPSSC------------GPNEFQCGNA-TCIPSGWVCDDDPDCQDHSDESPLRCGRNPTPPAK-----------CSVSEILCGSGE---CIHRKWRCDGDADCKDG-SDEKNCPARSCRPDQ-FKCED-GSCIHGSRQCNGIRDCTDGTDEVNCKNLTQ----CNGPDKFKC-RSGECIDMHKVCNKARDCPDWSDE----PIKECNLNECLLNNGGCSHICRDMVIGYECDCTPGLQL--IDRKTCGDINECLNPGICSQICINLKGGYKCECHSGYLMDAATGVCKAVGKEPCLIFTNRRDIRKLGLERREYTQIVEQLRNT------VALDADFTQQRIFWADLGQKAIFSTVLDKREDVGYTK----VIDNVQMPVGIAVDWIYKNIYWSDLGSKTIVVANF-NGTKQKVLFDRNLKEPASIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKSRLYWVDSKLHTLCSVDLNGDNRRKVLQSQDYLAHPFALTVFEDRVFWTDGESEAIYGANKFTGSDVTMLANNLNEPQDIIVYHELIQ-LSGTNWCNEKVNNGGCSYMCLPAPQINKHSPKYTCVCPVGQELSSDGLRCRPVASTDAPQDEGRTLIHSTHPQVRTTTKPKVAPQAKLVEGNISTSIHEVKSAKGSAAAWAVLPVLLLAMAAAGGYLMWRNWQLKN-KKSMNFDNPVYLKTTEEDLNIDISRHSASVGHTYPAI 868          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Match: lrp2a (low density lipoprotein receptor-related protein 2a [Source:ZFIN;Acc:ZDB-GENE-050119-2])

HSP 1 Score: 328.561 bits (841), Expect = 2.786e-94
Identity = 232/766 (30.29%), Postives = 351/766 (45.82%), Query Frame = 1
Query:  142 FLCQNGKCIPETLHCDGHDNCGDNSDE---------------ICDHR------------------ETFTCSDSN-IILKTELCDGKADCDNDEDPKIC-VKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETK-CIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLA--VGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLP-----IGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPV--GLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPK--YRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSH--LNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTG--KQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFF 2286
            F C NG+C+P    CDG+D+C D SDE                C +R                  + FTC+  N  I +  +CD   DC +  D + C +   C   QF C      CI    +C+ ++DC DG+DE         +  V  C  S  F C +   CI+  Y CDG  DC D+SDE  CP                +   +C N+EF C +     CI   W CDG  DC +   +   C    C+     RC    +C     RCDG  DC D +DE  C  P      C   +++ C  +  C+  ++VCD   DC DG DE P     +C+++ C +NNG C   C+      +C C PG+++  +++TK C D+DEC     CS +C N  GS++C C  G+ M  D + C A    E  LL  +++ I        Y D + +  N  S+ +      + +DFD ++  I+W         V  D + S   N   R LV+ ++   V   LA DWI   L+W D     I V  + +G  +T++   N +  R +V+ P+   R +FWTDWGK P+IE  GMDG+ R+ ++   L+ PNGLA+DY  + LY+ DA    I   +     RR V++   +  H   I +FED++Y +D    ++++ +K  G  +  ++ +  +PMG+   H + QP    N C+  +C +LCL + +       + C CP    L  DG+TC      F 
Sbjct: 1008 FACANGRCVPRLFLCDGYDDCHDGSDERGCGTGNVTCSPYAFTCTNRRCIPIDWRPTRLATTCRADQFTCASGNRCIPRYWICDTDNDCGDGSDERGCDMSGTCHPMQFQCPDH--RCIDNAYVCDGDSDCVDGADE---------RGCVFNC-TSYQFSCSSGDQCIATYYRCDGAFDCRDRSDEVGCP---------------TRAPGLCHNDEFQCQSDGL--CIPAGWECDGHPDCDDGSDEHPGCPPRTCAAGYL-RCDN-GNCVPESWRCDGDNDCRDGTDERDCPTPPYR---CQSPSQWLCPNHRACVDLRKVCDGNFDCPDGGDESP-----HCNEHDCSVNNGGCSHGCVQGPFGAQCTCPPGFQL--LDDTKNCADVDECDPPGSCSQQCVNEHGSFRCHCDLGYTMESDRRTCKANDRHEVLLLVPSRSQI--------YSDNITATPNVLSSVVRNGRSIVAVDFDARAGRIYWAD-------VAEDKIWSALRNGTDRQLVHKQVGLTVTENLAVDWIGKNLYWLDFVLETIEVSRL-DGSHRTVLISTNVTNPRGLVLDPRDGSRTMFWTDWGKNPRIERAGMDGRLRRTIVSSKLYWPNGLAIDYATNLLYFADAYLDFIDFCDFNGQNRRQVLASDLILQHPHAITIFEDFVYWTDRSTNRVMRANKWHGGNQSTMIYNLQQPMGLVASHSVRQPT-ATNPCLGQSCSHLCLLSPITP---FFYSCACPSGWNLGPDGRTCQKEDRPFL 1712          

HSP 2 Score: 277.33 bits (708), Expect = 2.232e-77
Identity = 235/845 (27.81%), Postives = 369/845 (43.67%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKC-SIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEAC-EIINKPLVVQCDNS----------------------------IH-------FQCENKQLCISRIYYCDGKSDCSDQSDE-KNCPDSENSKSKSQSLAD---LVKQSTIC-----------QNNEFYCGAGSTVP--------------CIAKEWRCDGSYDCPETYKDELNCSNFECSPDK-----------PNRCKTIDSCYD-NDQR-------------------------CDGYPDCTDNSDEE--FCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGN-CEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADH-MVCSHKCANYLGSYKCECFEGFYMSKDNKQCL--AVGEKFLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHL-VSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRL---GNHS----KVRSIVVHPKYRRI-FWTDWGKEPKIECMGMDGQDRK-VLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVS--SPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKT 2259
            ++C   QF C NG+CIP    CD  DNC D SDE+        C+  + FTC +   +     CD   DC +  D + C    C    +F C      CI+++ +CN  N+C D +    + C E   +P +++C  +                            +H       F+C N Q CI   + CD + DC+D +DE  +C D   +   +Q   D    +  S IC           ++    CGA +  P              CI + + CDG  DC +   +  NC+   C+  +             RC   + C D +D+R                         CDG  DC D SDE+   C  PS    +C P   F+C     C+A   VC++ NDC DGSDE+       C  N C   + N C   C N  +   C C  G+R+ + N   C DIDEC +   VCS  C N  GSY C+C  G+    + + C   +  E +L++S +  +R + +  R Y  +L +  N       + +DFD   + ++W  +        I+ + +++TG     T++   + +P GLA DW+   ++W+D   + ++V  +    RK L+      NH+      R + +HP++ R+ +WTDWG  P I  +GMDG++ K V+I   L  PNGL +DY  D ++W DA    I   NL    R   ++    H F + VFED ++ +DW+   I   HK TG+ + +++  + +P  + ++H   QP  + N C   N  C +LCL  +        F+C CPD    ++ G T
Sbjct: 2659 QQCGTSQFTCLNGRCIPFRNKCDNRDNCRDGSDELERVCAFHTCEPTD-FTCRNGRCVRYGYRCDHTNDCGDSSDEEGCAFRTCDPAAEFACTNG--RCIARSQVCNGVNNCRDNATSDEQRCPERTCQPGLLKCLTTNICVLRHYLSGGAAEWRRNDLRRPPPLPLHTCFIANEFRCGNGQ-CIPLSWVCDSEQDCTDNADEPSSCSDPGRTCPGTQFTCDSGRCIPGSWICDGDNDCGDGSDEDGRHACGARTCGPHEFTCADASPPRRRCIQRRFVCDGDADCSDALDEHQNCTRRSCTAGEFACDNGLCVHSRYRCDRRNDCGDGSDERGCTYPTCRQNQFTCENGRCIPRIFACDGDNDCGDGSDEDTHLCHQPSP---TCAP-GFFRCGAGE-CVAIHLVCNQANDCADGSDEK------GCGINECLYASINQCAHNCTNTLTSFYCSCWAGFRLMA-NGRACEDIDECNETPQVCSQLCENTAGSYFCKCAPGYVRLPNGRTCRQNSGVEPYLIFSNRYYVRNMTVGGRSYTPILQNLTN------AVALDFDRVERRLYWVDYGQR----TIERMFLNRTG---LETVMKHDLPAPEGLAIDWVGRKMYWADAVLDCLNVAELDGRYRKKLLSGCVDTNHTYCLENPRGVTLHPRFGRVLYWTDWGNTPYIARVGMDGKNNKSVVISTKLEWPNGLTIDYTTDRIFWSDAHLNYIEYANLDGSHRHTTLAGSLPHVFALTVFEDTIFWTDWNTRSIESAHKYTGEGRTMLANTTHRPFDIHVYHPYRQPPEVPNPCGSNNGGCSHLCLVAAGG----TGFQCECPDDFAAIHVGTT 3470          

HSP 3 Score: 251.906 bits (642), Expect = 6.004e-69
Identity = 215/735 (29.25%), Postives = 319/735 (43.40%), Query Frame = 1
Query:  139 QFLCQ-NGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELN-CSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDE--EFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERP--GGKSENCDKNLCKINNGNCEQKCINFYSHR-KCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDN--KQCLAV-GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKN---IFWTQFEPNPEIVQIDHLV------SKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDD-LYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHK--KTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKT 2259
            +F C+ N +CIP    C+G D+C DNSDE       CD    + C +   I     CD   DC +  D + C    CS  +F C  +   CI    +CNH NDC D SDE    CE+       Q     +FQC +   CI     CDG +DC D SDE  CP                   T C  + F C       CI   W+CDG  DC +   +EL+ C +  C+P    RC   + C  + + C+   DC D SDE  + C  P+    +     EFKC     CI    VC+  N+C D +DE     G+   C + +C       EQ C N   +   C C+PG+  ++ N   C D++EC     C   C N  G+Y+C C +G+  +  +  K+C+A      LL + K  +R+  L         S +    +   +  D+D+       +++T      +   I          S         L    I  P G+A DW+   ++W+D   + I V  +    RK L+      K  +I ++PK   ++WTDWG  PKIE   MDGQ R+ L++  L  P GLA+D+  +  +YW DAK   I         RR V+S    + F +DVFE  +Y +  +  ++ Q +K     K  IL  +      ++F +    VN++N C   TC +LCL   +  + Y    C CP  +  +   +T
Sbjct: 3648 EFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCAEITCDPLGDYRCDNHRCIPLRWRCDRYDDCGDGSDERNCAPRPCSESEFRCTNQ--RCIPGRWVCNHENDCGDNSDE--RDCEL-------QTCLPGYFQCGSGH-CIPERLKCDGSADCQDFSDESLCPTR-------------YPNGTWCPPSSFEC---DNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPPGRFRCDN-NRCIYSHEICNAVDDCGDGSDETPDKCKEPTFAPCT---EEEFKCASGR-CIPMAAVCNNYNECRDNTDETGCNQGQDRTCAERIC-------EQNCTNLPGNGFICSCRPGFTANAENRNNCDDVNECEVFGTCPQDCQNAKGTYECFCVDGYRSAAGSYGKRCIANDNSPVLLLADKVRVRKYDLTSQKQADYISNE---EDIQALDFDWDHDGTGLSMVYYTVLRSGGKFGSIKRAYLAAFSNSSENFATGINLGLRYISQPDGIAVDWVGRHIYWTDAQTSRIEVALLDGRYRKQLIN-SVLDKPATIALNPKLGMMYWTDWGVVPKIEMAWMDGQQRQHLVQGLLGWPTGLAVDHTNNGRIYWCDAKENVIESVRPDGGDRRTVISGDLGNPFTLDVFESNVYWTTRETGQVWQQNKFGSGVKSHILTVNSWLSQARVFQKHRYNVNVKNPC-KGTCSHLCL---LRPQGYT---CACPQNAQFIPGSET 4331          

HSP 4 Score: 231.491 bits (589), Expect = 2.404e-62
Identity = 216/758 (28.50%), Postives = 325/758 (42.88%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADC-DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLA---VGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEI-VQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRR--IFWTDW---GKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSP-TKSEFFRKTIXXXXXXLKPKQ 2331
            C   QF C +G CIP +  CD  ++C D+SDE       C   +    SD+  I +  +CDG+ADC D  ++ + C  + CS   F C +   +C+     C+H  DC D SDE  ++C         Q        C N   C +    CDG  +C D SDE NC                   +  C   EF C   +   C+ + +RCD   DC +   DE  C    C  ++   C +   C      CDG  DC D SDE  C + +     C P  E+ C  +  CI F++VCD   DC  G+DE        C    C     +CE +C    +   C C P + + S N   C+D D+C    VC   C N    + C+C  G Y+ +  K C A    G   LL+S    +    L    + +L   +N     + +G+D+ Y  + +FWT    N  + V +D L  +       T++   +  P  LA DWI   L+  +   + I V ++    R TL+   N  + R I + P   +  IF++DW      P++E   MDG +R  L++  L  P G+ LD+    ++WVD +   I         R+ ++S      H FDI  FE ++Y +DW   ++ +++   G   Q +  S+ +P GV + H L QP  + N C   N  C+ +C+ +       + +RC C     L  DG  C P TK   F    SV    L   Q
Sbjct:    1 CDSGQFRCGSGACIPRSWVCDSINDCSDDSDERGCSPATCTTLQFRCRSDNRCIARAFVCDGEADCADRSDEHQNCPGSTCSSSHFTCASG--HCVQSAFRCDHFQDCDDRSDE--QSC---------QYPTCAEMTCANGA-CFNTAQRCDGVVNCRDLSDEANC-------------------TARCPVGEFQC---ANERCVPQSYRCDHIDDCTDG-SDENGCVYGTCQGNQFT-CAS-GRCILQSWVCDGDDDCFDGSDERGCVSAASEERECYP-EEWPCPGSKACIPFRKVCDGRRDCPHGTDESNSTAGLACSIENCGAL--SCEYRCHASPAGGACYCPPSFVV-SNNSITCMDFDDCKMWGVCDQFCENRPAGHMCQCSPG-YLLEYGKHCRADVTSGVASLLFSNGKDLVMSDLQGRTVRVLVPSQN---RGVAVGVDYHYILRRVFWTDTMQNKVLSVNMDTLAVE-------TVLSVALDMPENLAVDWISNKLYIVESSVDRIDVTDLNGANRLTLI-AENLGRPRGIALDPTVGKGSIFFSDWDDASGNPRLERAYMDGTNRLALVRTKLGWPAGITLDFVLQRVFWVDNRFDYIESVTYDGLIRKTILSGGANVPHPFDITTFEHYVYFTDWTRMEVTRVNVFNGSDLQVVHRSNIQPYGVIVHHSLRQP-QVRNPCGPNNGGCEQICVLSHRTDNVGLGYRCKCRVGFDLQPDGLRCFPVTKFLLFSAMTSVRGIPLNQSQ 702          

HSP 5 Score: 153.68 bits (387), Expect = 6.691e-38
Identity = 121/411 (29.44%), Postives = 179/411 (43.55%), Query Frame = 1
Query: 1069 KNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDY---YFDDLYWVDAKTRKI--SVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKP--MGVKLFHQLAQPVNIENAC-----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            +N C  NNG CEQ C                                   V SH+  N    Y+C+C  GF +  D  +C  V  KFLL+S   S+R + L +   + +  P    S    +GIDFD  S+ +  +      +I Q +  +  TG +   +   S + S   LAYDW+   L+W+D     ++V+ + +  R+ +  L N    RSIVVHP    IF++DW +  KI     DG     ++   L  PNGLA+D+   +   LYWVDA   +I  S +N +  QR D +SHL AH F I +   + Y SDW    I+++ K  G + +++       M VK++    Q     NAC      N  C + C P            C CP    L  DG+ C+
Sbjct:  634 RNPCGPNNGGCEQIC-----------------------------------VLSHRTDNVGLGYRCKCRVGFDLQPDGLRCFPV-TKFLLFSAMTSVRGIPLNQSQQEDVILPVM-GSPVTFVGIDFDAASQRVIVSDTSQG-KIFQQN--LDGTGRVNLTSRDVSSVES---LAYDWVSKNLYWTDTRNRAVTVMRLIDQSRRNI--LSNLQNPRSIVVHPLQGYIFYSDWNRPAKIVRAWCDGSHATPIVNTSLGWPNGLAIDWQSPWNPKLYWVDAFFDRIEFSNFNGQNRQRLDRISHL-AHPFSISIHGGFAYFSDWRLNSIVRVQKMDGGEAVIIRQGIQYLMNVKVYDTDIQ--TGSNACNRPANPNGDCSHFCFPAPSGAR-----VCGCPYGKRLAEDGRMCA 991          

HSP 6 Score: 139.428 bits (350), Expect = 1.679e-33
Identity = 105/406 (25.86%), Postives = 179/406 (44.09%), Query Frame = 1
Query: 1072 NLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNF--LPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP---KPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFS--YLLNDGKTC 2262
            N C++NNG C+Q C              + + S+    C           C+H     LGS             D   C+   +++L++ T++SIR +RL        +S   PT+    + + +DFD     +++TQ   +  + +         +    T++ S + SP G+A+DWI+  +++SD     I  + +  G R  +  +    + R+I++ P    ++WTDW    KIE   + G  R  +I   L  PNGL LDY  + LYW DA  +KI    L T  RR+V+  +  + F + + E  +Y +DW+ + + +  K  G  ++++      +PM + +     Q     N C   N  C ++C+P    +E      C CP     YL N GK C
Sbjct: 2306 NPCRLNNGGCQQFC--------------FALPSVTTATC----------ACAH---GELGS-------------DRVSCVMPSDEYLMFVTEDSIRSMRLDPED----HSLPIPTAQVSRVAVALDFDIADGRVYFTQ---SMGLARSRISFFSLSSPSSVTVIASDLGSPDGIAFDWINRRIYYSDYANQTIGSMGLDGGNRTVVALV---PRPRAIMLDPCKGYMYWTDWSVNAKIERATLGGNFRVPIINSSLVWPNGLTLDYSENMLYWADAYRQKIERSTL-TGDRREVIVSMAVYPFALTIHEQHVYWTDWNTKSVYRATKDDGADQVVMIQNLPYRPMDIHILTASKQQ-RCSNPCNQFNGGCSHICVPGPSGVE------CQCPAQGRWYLANGGKDC 2653          

HSP 7 Score: 103.605 bits (257), Expect = 1.659e-22
Identity = 93/332 (28.01%), Postives = 143/332 (43.07%), Query Frame = 1
Query: 1255 YKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSN--FLPI-----GIDFDYK-SKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNI--TNGMRKTLVRLGNHSKVRS------IVVHPKYRRIFWTDWGKE----PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLF--HQLAQPVNIENACI--NHTCQYLCLP 2178
            Y C C  G+ +  D + C      FL+    + I  + L            N TSN   +PI     G D D+  ++ I+W +   NP  +   H V   G  + +    + + +P GLA DWI   L++++     I V+ +      RKT++  GN+ +         I + P   R++WTD G +     K+    MDG +  VL    +   + + LD     LYW  A T  I   ++    R  VV HL +H + + V E  LY +D+D E + ++ K  G   +L+ S  P G+K    H         NAC   N  CQ LCLP
Sbjct: 1687 YSCACPSGWNLGPDGRTCQKEDRPFLIVVRSSIIFGISL----------DPNQTSNDAMVPISGISNGYDVDFDDTQFIYWVE---NPGSI---HRVKTDGTNRTQFAPSAILGAPSGLAIDWISRNLYYTNPRSQTIEVIKMDGVQNYRKTII--GNNGQTTGVGYPVGIALDPSRGRLYWTDHGSDSGVPAKVAAADMDGSNPTVLFSGNMDHVDFITLDMREQKLYWAVAGTGVIERGDVTGLNRITVVQHL-SHPWGVAVHESHLYYTDYDYEVVERVGKD-GSTPVLMRSNIP-GLKCLKVHFRDTSSGTTNACSSGNGGCQQLCLP 1997          

HSP 8 Score: 87.4261 bits (215), Expect = 1.529e-17
Identity = 89/362 (24.59%), Postives = 146/362 (40.33%), Query Frame = 1
Query: 1258 KCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRI--HSPVGLAYDWIHGLLFWSDIHFNE--ISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKIS--VYNLKTFQ-RRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKP------MG----VKLFHQLAQPVNIE----NACI--NHTCQYLC--LPTSMNLE--------NYIKFRCICPDFSYLL 2244
             C C  GF ++ D   C  + E F++ S  ++IR   +          P   T     + +D    S  ++W           I  +  K      +T+V S I      G+A DW+ G L+++++  +E  + V  +    R+ L +  +  + R + V P+ R +FW D G+ PKIE   +DG +R V++  GL +P  L +D   D +YW D    +I     +  T+Q  R+   +   +G  I  +   L   D +  K++Q  K+        S P P      +G    V +F    QP   E    N C   N  CQ  C  LP+                +  C+ P   YL+
Sbjct: 2004 ACGCSTGFQLAPDQISC-RLYESFVIVSQLSAIRGFHINSTDHSEAMVPVAGTGRNA-LHVDVHMPSGFLYWCDHGSASTYRGIRRI--KPDGSGFQTVVSSGIGPSGVAGIAVDWVAGNLYFTNVFSSETHLEVQRLDTSFRRVLFKT-SVDRPRHLAVDPRARFLFWVDAGQRPKIERAFLDGTNRSVVLDVGLLSPRSLTIDRATDWVYWADDGLDRIGRLAPDGSTWQVVREGRGYPAPYGLAI--YGSNLIWVDRNLRKVLQASKEP-----QASPPPPEVIRDNLGTLRDVTIFDPRVQPTAPELINFNPCRLNNGGCQQFCFALPSVTTATCACAHGELGSDRVSCVMPSDEYLM 2353          

HSP 9 Score: 79.337 bits (194), Expect = 3.780e-15
Identity = 86/322 (26.71%), Postives = 127/322 (39.44%), Query Frame = 1
Query:  379 PMNCISKTSLCNHNNDCSDGSD----ESPEACEIINKPLVVQCD---NSIHFQCENKQLCISRIYYCDGKSDCSDQSDE------------------KNCPDSENSKSKSQSLADLV-KQSTICQN-----NEFYCGAGSTVPCIAKEWRCDGSYDCPE-TYKDELNCSNFECSP---------------------------DKPN----------------RCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCE-QKCI 1116
            P  C S    C+H    + G      E P+    I+    V+C     S  F+C++ + CI   + CDG+ DC D SDE                   NC  S    + + +  D   ++ T+C N     N++ C       CI   W CDG  DC + + +D   C+   C+P                           D+P+                 C+T   C      C+G  DC DNSDE+ C+      ++CDP  +++C  N+ CI  +  CD+ +DCGDGSDER      NC    C  +   C  Q+CI
Sbjct: 3431 PNPCGSNNGGCSHLCLVAAGGTGFQCECPDDFAAIHVGTTVRCLARCTSTQFRCQDDERCIPIWWKCDGQRDCRDASDEPATCPHRYCPIGRFQCRDGNCTSSNLLCNGNNNCPDGSDEEDTLCFNHRCNSNQWQC---MNKRCIPAAWLCDGGPDCQDGSDEDSATCAARTCAPGQFRCNNGRCIPRSWVCDVDDDCGDGSDEPHDTCMGPSHRCDSHTEFACRTNYRCIPTWAVCNGMDDCRDNSDEQGCA-----EITCDPLGDYRC-DNHRCIPLRWRCDRYDDCGDGSDER------NCAPRPCSESEFRCTNQRCI 3737          

HSP 10 Score: 60.077 bits (144), Expect = 2.755e-9
Identity = 47/159 (29.56%), Postives = 66/159 (41.51%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNC 603
            C    F C N  CIP +  CDG ++CGD SDE   H     C+            G+  CDN+                        CI    +CN  +DC DGSDE+P+ C+   +P    C     F+C + + CI     C+  ++C D +DE  C
Sbjct: 3807 CPPSSFECDNHVCIPPSWKCDGDNDCGDGSDEELHHCLDTPCNPP----------GRFRCDNNR-----------------------CIYSHEICNAVDDCGDGSDETPDKCK---EPTFAPCTEE-EFKCASGR-CIPMAAVCNNYNECRDNTDETGC 3927          

HSP 11 Score: 57.3806 bits (137), Expect = 2.213e-8
Identity = 37/110 (33.64%), Postives = 48/110 (43.64%), Query Frame = 1
Query:  118 YKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE 447
            Y  CR+ QF C+NG+CIP    CDG ++CGD SDE                  T LC   +               C+   F C      C++   +CN  NDC+DGSDE
Sbjct: 2991 YPTCRQNQFTCENGRCIPRIFACDGDNDCGDGSDE-----------------DTHLCHQPSP-------------TCAPGFFRCGAG--ECVAIHLVCNQANDCADGSDE 3068          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Match: lrp1ab (low density lipoprotein receptor-related protein 1Ab [Source:ZFIN;Acc:ZDB-GENE-030131-7126])

HSP 1 Score: 293.893 bits (751), Expect = 9.284e-83
Identity = 232/768 (30.21%), Postives = 356/768 (46.35%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHRET-----FTCSDSNIILKTELCDGKADCDNDEDPK--ICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNC------------------------PDSENSKSKSQSLADLVKQST----ICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNF--ECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKC-INFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE--KFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDH-LVSKTGNMKP-RTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE-PKIECMGMDGQDRKVL---IKDGLWTPNGLALDYYFDDLYWVDAKTRKI--SVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILV--SSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIK-FRCICPDFSYLLNDGKTCS 2265
            +C   +F C+NG+CI E   CDG ++C DNSDE   IC H+ T     F C ++  I    LCDG  DC N ED     C    C  +QF C +   +CI  +  C+ ++DC D SDE P        PL         F C N + CI+  + CD  +DC+D SDE  C                         D++      ++  +  K +T     C  +EF C A     CI   WRCDG  DC +T  DE  C      C P     C+    C      CDG  DC DNSDEE C       + C P +      ++ C++ +++CD  +DC DGSDE        CD+  C++NNG C   C +       C C  G ++   ++  C  +D CA H+ CS +C       KC C++G+ +  D + C ++     F+++S ++ IR + L +    +L      T     I IDF     +++WT    +    +I H  +S+TG +     +V   + +P GLA DWI G ++W + + ++I V  +   MR TLV  G     R+I + P+Y  +FWTDW    P+IE + M G  R V+   +  G W PNGL +DY  + + W+DA++  I  ++Y+              +H F + +F   +Y +DW    +++ +K TG+   +V  ++ +P  + +FH   QP+   N C ++  +  C  +   L NY +   C CP    L  D +TCS
Sbjct:  826 QCHPGEFACKNGRCIQERWRCDGDNDCLDNSDEAPEIC-HQHTCPSDRFKCQNNRCIPLRWLCDGDNDCGNSEDESNTTCAARTCPPNQFSCASG--HCIPMSWKCDLDDDCGDRSDEPPSCAYPTCFPLT-------QFACNNGR-CINMNWRCDADNDCADASDEIGCNHSCSISQFKCNSGRCIPSHWTCDGDNDCGDFSDETNPNCTKLATRPPGGCHGDEFQCKADGQ--CIPLRWRCDGDTDCIDT-SDEKECDGVVRTCDPTLQFSCRDTGRCISKTWFCDGDNDCEDNSDEEGC-----ETMLCKPPSHSCANDSSICLSPKKLCDGHSDCPDGSDE-----GMLCDQ--CQVNNGGCTHNCTVAPGEGVVCSCPSGMQLGK-DKKSCDFMDYCARHLRCSQRCEQEKSIVKCGCYDGWMLMPDGENCQSLDPFVPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNT-----IAIDFHLNQSSLYWTDVVED----KIYHGKLSETGGLTSVEVVVQHGLATPEGLAVDWIAGNIYWVESNLDQIEVARLNGTMRSTLV-AGGIEHPRAIALDPRYGILFWTDWDSSFPRIEAISMSGTGRHVIHHEMGAGGW-PNGLTVDYLENRIMWIDARSDSIYSALYDGTELIEVLRGHEFLSHPFAVTLFGGEVYWTDWRTNTLVRANKWTGQNVTVVQRTNTQPFDLHVFHPTRQPM-ANNPCGDNEGRGPC--SHHCLINYNRTAACTCPHLMKLQPDKRTCS 1552          

HSP 2 Score: 282.722 bits (722), Expect = 4.401e-79
Identity = 225/768 (29.30%), Postives = 353/768 (45.96%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI------CDHRETF--------TCSDSNI-ILKTELCDGKADCDNDEDPKICVKNK----CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKN--CPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGST--------------------VPCIAKEWRCDGSY-----DCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNP--SQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINN-GNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMS-KDNKQCLAVG--EKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP--KPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C   +F C +G CI     C+   +C D SDEI      C H            +C+ +++ +L   +CDG  DC +  D K C K      CS D F C + P  CI     C+   DC DG+DE       +N  ++   D   HF+C+N + CI++ + CDG+ DC D+SDEK+  C     +     +L   +  ++   +N   C    T                    VP  A+      S      D P    ++  C+N  C          + S ++    CDG  DC D SDE    NP  S +N  C+  + F C  N  C+    +C+  +DC DGSDER      NC+ N C       C Q+C +     KC C+ G+++    +T C+D DEC     CS  C N  GS+KC C +G+     D+  C A+   E  L+++ +  +R++ L      +L    N       + +DF++  + ++WT       +++  H+      +  RT     + +P GLA DWI G L+W D   + I V  + NG+ +T++      + R++ V  +   ++W+DWG+ P I  MGMDG +R V+I   +  PNGL+LDY  + +YW DA+   I   ++    R  VVS    H F + +FED +Y +DW+ + + + HK TG  +  + S   +PM + ++H   QP    + C   N  C  LCL +        +++C CP   YL +DG+TC
Sbjct: 2582 CGADEFRCGDGSCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGDYADEKNCKKKSGSPGCSPDYFNCPSGP--CIPTAWKCDREPDCDDGADE-------LNCDMLCAVD---HFECDNGK-CITKRWMCDGEDDCGDRSDEKDAHCTFRACANIAYSALHLTIVITSHWLHNHSRCCLLPTEQSIYMRILNVSTRKHVCVCVPMHARRLSVHSSLTVSFADYPMCGPNQFRCANGRC---------LLKSSWE----CDGDFDCHDRSDEAPI-NPHCSANNSKCNDSSSFPCA-NGRCVNESMLCNNQDDCEDGSDER------NCNINECADRRISGCTQECTDLKIGYKCKCRAGFQLKDDGKT-CVDRDECRTTYPCSQTCLNSHGSFKCLCTDGYRQRVNDSTSCKAISDEEAILIFANRYYLRKVNLDGSNYTLLKQGLNNA-----VALDFEWSEQWVYWTDVTTQGSMIRRMHMNGSDTQVLHRT----SLSNPDGLAVDWIGGNLYWCDKGRDTIEVSKL-NGLYRTVLLNNGLKEPRALAVDVRGGYLYWSDWGEHPHIGRMGMDGSNRSVVIDTKITWPNGLSLDYVNNRIYWADAREDYIQFADMDGANRHTVVSEDIPHIFALSLFEDHVYWTDWETKTVNRAHKSTGADRTTLISTLHRPMDLHVYHPFRQPDVPNHPCKVNNGGCSNLCLISPGG-----QYKCACPTNFYLASDGRTC 3299          

HSP 3 Score: 270.396 bits (690), Expect = 4.209e-75
Identity = 232/730 (31.78%), Postives = 342/730 (46.85%), Query Frame = 1
Query:  127 CRRFQFLCQN-GKCIPETLHCDGHDNCGDNSDEI---CDHRE----TFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELN-CSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDG-SDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELR-LLRHYMDMLYSPKNPTSNFLPI-GIDFDYKSKNIFWTQFEPNP-EIVQI----DHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA--HGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMG--VKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLN 2247
            C + +F C+  G+CIP    CDG D+CGD SDE    C+ R      F C ++  +     CD   DC ++ D + C    CS  +F C      CI+    C+ ++DCSDGSDE         K    +CD+   FQC N   CI + + CD   DC D SDE NC             A +V+    C ++EF C   +   C    W+CDG  DC +   +    C  F+C P +  RC+    C+   ++CDG  +C D SDEE C  PS     C+  +EFKC      CI+ Q VC++ +DCGDG SDE   G  +  ++    +N    +  C +      C CKPG++  +     C D++ECA   VC+  C N  GSYKC C +  Y+   +  C A G E+ +LY   N+  E+R L  +  +M Y         + I  +D   KS  IFWT +      ++++    +H   +  +     L  S +  P G+A DW+   L+W+D   + I V  +    RKTLV  G   +  +IV+ P   +++W+DWG   KIE   MDG  R   ++  L  P GLA+D+    LYW DAK   I    L    R   V       H F I++FED++Y   + N ++ +IHK      + +++       + +FH L QP  + N C    C++LC      L N     C CP+   L+N
Sbjct: 3463 CGQEEFRCKGTGRCIPSRWKCDGDDDCGDTSDEPKEECEDRTCEPYQFRCKNNRCVPGRWQCDYDNDCGDNSDEEGCTPRPCSESEFSCANG--RCIAGRWRCDGDHDCSDGSDE---------KDCSPRCDHD-QFQCRNGH-CIPQRWRCDADIDCIDGSDEDNC-------------AAIVR---TCPHHEFQC---NNTLCKPLSWKCDGEDDCGDNSDETPEMCLKFQCPPGRQFRCRNNRVCFWAGRQCDGVDNCGDGSDEENCEKPSPKPRICNS-SEFKCGGTERKCISTQLVCNRFDDCGDGGSDEVACGGDQFVNECHRPLNPCGDDAICHDTLRGYYCECKPGFQRKATTSI-CEDVNECAQFGVCTQLCNNTKGSYKCNCSKN-YIKGLHHSCKAEGSEQMVLYIADNN--EIRSLAPNNPNMAYEQAYQGDATVRIDAMDAHVKSNRIFWTNWHMGRISMLELYPAGEHRHRRQTSGTVVDLDISGLKMPRGVAVDWVADNLYWTDSGRDVIEVAQLRGHYRKTLVS-GMIDEPHAIVLDPIRGQMYWSDWGNNAKIEQASMDGTRRHNFVEKDLQWPTGLAIDFMNQRLYWADAKLSVIGSIRLDGTDRVVAVDSKQGLLHPFSIEIFEDYIYGVTYVNNRVFRIHKFGSGTVVNITAGMSHATDIVVFHPLKQP-EVINPCEQRKCEWLC------LLNPNGATCSCPNGWALVN 4147          

HSP 4 Score: 177.563 bits (449), Expect = 2.596e-45
Identity = 141/510 (27.65%), Postives = 222/510 (43.53%), Query Frame = 1
Query:  799 CSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDE--EFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGK--SENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPK-NPTSNFLPIGIDFDYKSKNIFWTQF--EPNPEIVQIDHLVSKTGNMKPRTLVYS-RIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA-HGFDIDVFEDWLYLSDWDNE------KIIQIHK-KTGKQKILVSSPKPMGVKLFHQLAQPVNIENACI------NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            CSP +   CK   +C     RCDG  DC D SDE  E C  P++        N + C+    CI   ++CD  NDC DG DE    +  +ENC   LC+        KC        C C  G+ + + +E  C D DECA +  CS  C N  GSY C C EG+ +  D+K C A  +     +         ++  Y++    P   P +      +DF Y  +   W      P    +    L    G    R +  S  +H    +A DW+ G  ++ D   + I V N       TL+ L  ++  ++I + P   ++F+TD+G+ PK+E   MDG +   L+   +  P+G+ALD     +YW DA    I V + +   RR ++   +  H F + VFE++LY +  DN        +I++++  +   ++L    K   + ++H+  QP    + C          C  +CL  S    ++    C C     L +DGK+C
Sbjct:    5 CSPTQ-FVCKDGLTCISLGWRCDGEKDCPDGSDESPEICQKPNEMKCQ---VNHYHCLGTELCIHMSKLCDGNNDCPDGYDEGTHCREFAENCTVTLCR-------HKCAVTREGPACYCTVGHEV-TPDEKGCKDFDECAVYGTCSQNCLNTDGSYSCSCVEGYLLQPDSKSCKAKNDPVDRPAALLIANSQNVVATYLNGSIVPGLTPVATRQASAMDFSYSEEMACWVNVGDSPTESRLHCARLAGLKGFSGERVINISLNVHHVEQMAIDWLTGNFYFMDDVDDRIFVCNKQGDTCVTLLDLELYNP-KAIALDPTMGKLFFTDYGQIPKVERCDMDGGNCSKLVDSKIVFPHGIALDLVSRLVYWADAYLDYIEVVDYEGRNRRTIIQGPSVEHLFGLSVFENYLYATSIDNSNSPQNTTVIRVNRFNSTDYQVLTRVVKGGALHIYHRRRQPTGGSHPCAPDQYGKPGGCSDICLLAS----SHKTRTCRCRSGFSLGSDGKSC 497          

HSP 5 Score: 151.754 bits (382), Expect = 2.452e-37
Identity = 104/340 (30.59%), Postives = 159/340 (46.76%), Query Frame = 1
Query: 1261 CECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV-SHLNAHGFDIDVFEDWLYLSDWD--NEKIIQIHKKTGKQKILVSSPKPM---GVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C C  G+ +  D + C  +G  FLLYS    IR + L          P + TS  L +GIDF   +  I+W         +   H   +    +   ++ + +    G+A DWI G ++W D  F+ I V  +    R  ++  G   K R+I VHP    +FWT+WG+ P+IE   +DG +R VL+   +  PNG+++DY  D LYW DA+T KI   +L+T + R+VV S  N   F + VF D++Y SD    N  I +  K+     + + +   +    VK+F++  Q      A  N  C+ LCL          +  C C     L  DG +C
Sbjct: 1841 CRCTAGYNLQADQRNCEGIG-AFLLYSVHEGIRGIPLDPADKTDALVPISGTS--LAVGIDFHAGNDTIYWVDMG-----LSSIHRAKRDQTWR-EDIITNGLGRVEGIAVDWIAGNIYWIDQGFDVIEVARLNGSFRYVVISQG-LDKPRAIAVHPDKGYLFWTEWGQNPRIERSRLDGTERTVLVNVSIAWPNGISVDYEEDKLYWCDARTDKIERIDLETGENREVVLSTSNMDMFSVSVFGDYIYWSDRTHANGSIKRGSKENATDVVALRTGIGVQLKDVKVFNKERQKGTNVCARQNGGCEQLCL-----YRGKARRMCACA-HGLLAEDGVSC 2164          

HSP 6 Score: 119.013 bits (297), Expect = 2.949e-27
Identity = 115/335 (34.33%), Postives = 146/335 (43.58%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICD------HRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES--PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE-KNCPDSENSKSKSQSLADLVKQSTICQNNEFYC-GAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNC 1101
            C   +F+C+N KCIP    CD  D+CGD SDE  D          F C +        +CDG  DC +  D   C  + C   QF CRT    CI     CN  ++C DG DE   PE     N+           FQC + + CI R++ CD  +DC D SDE  NC                      C   EF C G G  +P   K    D   D  +  K+E  C +  C P +  RCK  + C     +CD   DC DNSDEE C+ P   + S     EF C  N  CIA +  CD  +DC DGSDE+    S  CD +  +  NG+C
Sbjct: 3303 CTASRFVCKNDKCIPFWWKCDTEDDCGDRSDEPADCPDFKCRPGQFQCKNGICTNPAFICDGDNDCGDGSDEANCDVHVCLPSQFKCRTT-HRCIPGIFRCNGQDNCGDGEDEKDCPEVTCAPNQ-----------FQCSSTKRCIPRVWVCDRDNDCGDGSDEPANC------------------TQMTCGQEEFRCKGTGRCIPSRWKCDGDDDCGDTSDEPKEE--CEDRTCEPYQ-FRCKN-NRCVPGRWQCDYDNDCGDNSDEEGCT-PRPCSES-----EFSCA-NGRCIAGRWRCDGDHDCSDGSDEKD--CSPRCDHDQFQCRNGHC 3594          

HSP 7 Score: 108.227 bits (269), Expect = 6.682e-24
Identity = 94/271 (34.69%), Postives = 122/271 (45.02%), Query Frame = 1
Query:  139 QFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHRET----FTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDE---SPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNC------SNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEE 903
            +F C NG CI   L CDG  +C D SDE    C  R+       C +   +   +LC+G  DC ++ D   C  + C  D+F C     +CI+  + CN   DC D SDE    P  C   ++ L VQ   S +  C +  LC+   + CDG +DC D +DEKNC      K KS S          C  + F C +G   PCI   W+CD   DC +   DELNC       +FEC   K         C      CDG  DC D SDE+
Sbjct: 2506 EFECNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNCLNGRCMETLKLCNGVNDCGDNSDEIACNNSTCGADEFRCGDG--SCIANVTRCNQVVDCDDISDEIGCGPMNCTHYHR-LGVQA--SGYVSCNSTSLCVLPAWICDGANDCGDYADEKNC------KKKSGSPG--------CSPDYFNCPSG---PCIPTAWKCDREPDCDDG-ADELNCDMLCAVDHFECDNGK---------CITKRWMCDGEDDCGDRSDEK 2744          

HSP 8 Score: 99.7525 bits (247), Expect = 2.192e-21
Identity = 93/354 (26.27%), Postives = 148/354 (41.81%), Query Frame = 1
Query: 1261 CECFEGFYMSKDNKQC-LAVGEKFLL--YSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVS--KTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISV--LNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEP------KIECMGMDGQDRKVLI--KDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN-AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSP 2268
            C C  GF +  D K C + +    LL   S    IR + +     D    P     N  P  +DF  ++  +++            + LV+  K    +  T++ + I++  G+A DW+   L+W+D     I+V  L   +  R+TL+  GN +  R+I V P +  ++WTDW ++P      KIE   MDG  R + +  K  LW PNGL+LD     LYW DA   +I    L   +R+ V      +H F +      ++ +++    + +    +    +L +   P+     +   Q  +  NAC   N  C  LCL             C C D   L  D  TC P
Sbjct:  482 CRCRSGFSLGSDGKSCKMCITNLCLLKRLSRPGIIRGMDVTGRVQDEFMIPIENLVN--PRAVDFHAETGYVYFAD--------TTNFLVARQKIDGTERETILKTNINNVEGIAVDWMGYNLYWTDDGLKTINVARLEKASQARRTLIE-GNMTHPRAIAVDPVHGFMYWTDWEEDPKGTKRGKIEHAWMDGTHRSIFVSSKTVLW-PNGLSLDIPNGILYWCDAYFDQIERIKLDGTERKVVYDGQELSHPFGLTHHGHNIFWTEYRLGTVYRYDTISRNTTVLRNERPPIFEIRTYDREQQKSGTNACHVNNGGCSILCLAVPEGRA------CACADDQLLDADNITCKP 817          

HSP 9 Score: 92.8189 bits (229), Expect = 2.797e-19
Identity = 82/328 (25.00%), Postives = 145/328 (44.21%), Query Frame = 1
Query: 1222 CSHKC-ANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWS--DIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNL--KTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILV--SSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTS 2184
            CSH C  NY  +  C C     +  D + C +   KFLLY+ +  IR + +   Y + + S   P  + +   +DF    + I+W+          I        N++  T+V + + +  GLA DWI G L+W+  D +  +I+V  + +G  KT V L    K   + +HP   +++WTD      I    MDG ++ +L       P GL++DY    LYW+ +    I+   L     +  + +         + +  D L+ +D  +E++    K+ G   +++  S+   M ++++ +  Q      +  N  C  LCLP S
Sbjct: 1522 CSHHCLINYNRTAACTCPHLMKLQPDKRTC-SEHWKFLLYARQMEIRGVDIDAPYYNFIISFTVPDIDNV-TAVDFHGAEQRIYWSDVRTQ----TIKRAFINGTNVE--TIVSADLANAHGLAVDWISGNLYWTSYDANKKQINVARM-DGSFKTAV-LQGLDKPHGLALHPIKGKMYWTD---GDTINVANMDGSEKAILHSQQK-GPVGLSIDYEESKLYWISSGNGTINRCELDGSGLEIVETMKSKLTKPSALAIMGDKLWWADQASEQLGTCSKRDGSNAVVLRNSTANVMHLRVYDRDLQKGTNPCSVNNGNCAQLCLPRS 1835          

HSP 10 Score: 92.8189 bits (229), Expect = 2.869e-19
Identity = 89/282 (31.56%), Postives = 120/282 (42.55%), Query Frame = 1
Query:  226 CDHRETFTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSI----HFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNC----SNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDER 1041
            CD +  F C++ + I     CDG ADC +  DE P  C   +C      C      C+    LCN  NDC D SDE             + C+NS      F+C +   CI+ +  C+   DC D SDE  C              +      +      Y    ST  C+   W CDG+ DC + Y DE NC     +  CSPD  N C +   C     +CD  PDC D +DE  C      ++ C   + F+C  N  CI  + +CD  +DCGD SDE+
Sbjct: 2501 CDLQTEFECNNGDCIRYHLTCDGVADCKDKSDEKPFYCTSRQCKNGYVNCLNG--RCMETLKLCNGVNDCGDNSDE-------------IACNNSTCGADEFRCGDGS-CIANVTRCNQVVDCDDISDEIGC-----------GPMNCTHYHRLGVQASGYVSCNSTSLCVLPAWICDGANDCGD-YADEKNCKKKSGSPGCSPDYFN-CPS-GPCIPTAWKCDREPDCDDGADELNC------DMLC-AVDHFEC-DNGKCITKRWMCDGEDDCGDRSDEK 2744          

HSP 11 Score: 87.4261 bits (215), Expect = 1.476e-17
Identity = 78/341 (22.87%), Postives = 142/341 (41.64%), Query Frame = 1
Query: 1261 CECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNP------TSNFLPIGIDFD-----------YKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGM-----RKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGK-EPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN-AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSS--PKPMGVKLFHQLAQPVNIENAC-------INHTCQYLCLPT 2181
            C C  G  +++D   C    + +LLYS +  ++ + L       L +P  P        N + +  D+            Y+ + IF++        +   ++     +   R ++   + S  GLAY      L+W+    + I+   +         R+T+V +      R+ V+      +FWT+W +  P I    + G + +V++   + TPNGLA+D+  + LY+ DA   KI         R  V+      H F + V+ D+++ +DW    +++ +K TG   K+L      +PMG+          N  N+C       +N  C+ LCL T
Sbjct: 2150 CACAHGL-LAEDGVSCRDY-DGYLLYSERTILKSVHLFDELN--LNAPVRPFEDPEHMKNVIALAFDYGSGPRSTSGGVPYRRRRIFFSD-------IHFGNIQQLFNDGTGRRVIVENVGSVEGLAYHRGWDSLYWTSYTTSTITRHTVDQARPGAFDRETVVTMSADDHPRAFVMDECLNLMFWTNWNELSPSIMRSFLSGANVQVIVGSNIRTPNGLAIDHRAEKLYFSDATLDKIERCEYDGSHRYVVILRSEPVHSFGLAVYGDFVFWTDWVRRAVLRANKFTGTDVKVLRGEIPQQPMGMIAL------ANDTNSCELSPCKVMNGGCEDLCLIT 2473          

HSP 12 Score: 60.077 bits (144), Expect = 2.800e-9
Identity = 36/83 (43.37%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  346 CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE 594
            CS  QF+C+   + CIS    C+   DC DGSDESPE C+   KP  ++C  + H+ C   +LCI     CDG +DC D  DE
Sbjct:    5 CSPTQFVCKDG-LTCISLGWRCDGEKDCPDGSDESPEICQ---KPNEMKCQVN-HYHCLGTELCIHMSKLCDGNNDCPDGYDE 82          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001137.1 (pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1 gene:ENSPMAG00000001008.1 transcript:ENSPMAT00000001137.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.567 bits (719), Expect = 7.263e-79
Identity = 221/724 (30.52%), Postives = 327/724 (45.17%), Query Frame = 1
Query:  163 CIPETLHCDGHDNCGDNSDE---ICDHR----ETFTCSDSNIILKTELCDGKADCDNDEDPK--ICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSP-----DKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKC-INFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK-----FLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVV-SHLNAHGFDIDVFEDWLYLSD--WDNEKIIQIHKKTGKQKILVS---SPKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLN 2247
            CI +   CDG ++C D SDE   IC       + F C ++  I    LCDG  DC  +ED     C    C  +QF C      CI     C+ +NDCSD SDE P        PL         F C N + CI+  + CD  +DC+D SDE  C ++                   C +++F C  G    CI  +W CDG  DC +   DE +   F   P     +   RC    +C     RCDG  DC D SDE+ C    +   +C+P   F CV N  CI    VCD  NDC D SDE        C   LC+ + G C   C +       C C  G ++    +T C   D CA H+ CS +C    G+ KC C++G+ +  D K C +  +      F+++ST++ IR + L  R Y  ++ S +N       I IDF +    ++WT        V     ++ TG     T+V + + +  GLA DWI G ++W D  F+ I V  + NG  + +V      K  +I VHP+   +FW++WG  P+IE   +DG +R  L+   + +PNG+++DY    LYW D +T +I   +L+T   R VV     +  F + VF   +Y SD   D+  I +  K      + +    S +   +K++++  Q     +AC   N  C+ LCL     ++ Y +  C C     L++
Sbjct:    1 CIQDQWRCDGDNDCQDGSDELPEICQQHTCISDRFKCKNNRCIPMRWLCDGDNDCGENEDESNTTCTVRTCPAEQFTCGNG--KCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLT-------QFSCNNGR-CINIRWRCDSDNDCADSSDEAGCNNT-------------------CADSQFSCKNGH---CIPSQWVCDGDNDCGDV-SDETHTCEFPARPLRQCREDEFRCAINGNCIPLRWRCDGDADCMDISDEKECDGQRR---TCNPGTHFTCVSNGICIRKAWVCDGDNDCEDNSDE------AGCHVYLCQSDKGGCSHNCTVTPVDGLVCSCPKGMQLGEDRKT-CNFTDYCARHLRCSQRCEQEKGAVKCGCYDGWRLMLDGKSCRSTADADPFVPFIIFSTRHEIRRIDLHSRDYSVLVPSLRNA------IAIDFHFGQSTLYWTDVVDVRSRVIRRAFINGTG---VETIVTTDVMNTHGLAVDWISGNIYWIDHAFDVIEVARL-NGSYRYVVVSEELDKPLAIAVHPQKGYLFWSEWGHSPRIERTLLDGTERMALVNSSIASPNGISIDYDEGKLYWCDGQTDRIERVDLETGANRHVVLVATTSDMFSVSVFGSHIYWSDRMQDSGSIKRGSKDNAADAVDLRTGISTQLNELKVYNRDRQKGVALSACKHTNGGCEDLCL-----VDEYGEVTCQCRGERTLVD 666          

HSP 2 Score: 276.944 bits (707), Expect = 2.012e-77
Identity = 217/730 (29.73%), Postives = 322/730 (44.11%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPE-TYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVK-NNTCIAFQRVCDKTNDCGDG-SDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLY-STKNSIREL---RLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRT----------LVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA--HGFDIDVFEDWLYLSDWDNEKIIQIHK-KTGKQKILVSS-PKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLN 2247
            K C  +QF C+N +CIP   HCD +DN                                 DC ++ D + C    CS  +F C      CI+    C+ ++DC DGSDE         K   ++C+    FQC+N   CI + + CD  +DC D SDE+NC  +                  +C  +EF C   ++  C    WRCDG  DC + + +D  +C  F+C P +  RC+    C   D+ CDG  +C D+SDEE C  P++   +C    EFKC      CI  + +C+  +DCGDG SDE   G       N C  N    E  C +      C C+PG++ ++ + + C D+DEC     CS  C N  GS+ C C E F     +       E+ ++Y +  N +R L   R    Y  +L    +   + + + +    ++  +FWT    N  +  I  +  + G  +PR+          L    + +P G+A DW+ G L+W+D   + + V  ++   RKTLV  G      +I + P   +++W+DWG   KIE   MDG  R+  +++ +  P GLA+DY    LYW D K   IS   L    R   VS      H F IDVFED +Y   + N ++ ++HK   G  + L           +FH L QP  + N C    C+ LCL       N     C CP+   L N
Sbjct:  874 KTCEPYQFRCKNNRCIPGRWHCD-YDN---------------------------------DCGDNSDEEGCTPRPCSESEFSCANG--RCIAGRWRCDGDHDCMDGSDE---------KDCSLRCEQD-QFQCQNGH-CIPQRWRCDNDADCLDGSDEENCGSAVR----------------LCPKDEFQC---NSTLCKPFSWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRCRNDRVCVSLDRVCDGINNCGDHSDEEHCGEPARGARACTA-EEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPR--VNECLSNACGFEASCHDTLQGYYCSCRPGFQWNA-SISSCEDVDECLHFGTCSQVCNNTKGSHVCSCAENFVKVHHHSCKANDSERTMIYVADNNQVRGLSPQRANARYTQVLLGDDSVRVHSMGVHV----RTARLFWT----NWHLGSISSMELRPGAGRPRSVRDDTAAVVRLEIPGLRTPSGVAVDWVAGNLYWTDSGRDVVEVAQLSGQNRKTLVS-GMIDDPHAIALDPVRGKMYWSDWGNNAKIEQASMDGTRRRNFVEERVQWPTGLAVDYMNQRLYWADTKLSVISSIRLDGTDRVVAVSIKQGLLHPFAIDVFEDHIYGVTYTNSRVFRVHKFGNGTVEFLTMGLSHATHALVFHPLKQPEAVANPCERKKCERLCLL------NPNGATCNCPNGHSLAN 1518          

HSP 3 Score: 116.316 bits (290), Expect = 1.767e-26
Identity = 145/606 (23.93%), Postives = 239/606 (39.44%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE-------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYR--IDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAV----GEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPI-GIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYS-RIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMD-GQDRKVLIKDGLWTPNGLALDYYFDDLYWVD 1890
            + C   QF C NGKCIP    CD  ++C DNSDE        C     F+C++   I     CD   DC +  D   C  N C+  QF C  K  +CI    +C+ +NDC D SDE+   CE   +PL  QC     F+C     CI   + CDG +DC D SDEK C                 ++ T      F C +     CI K W CDG  DC E   DE  C  + C  DK                               CS    HN +  P +   C    +C    ++         G D +    ++ C ++L       C Q+C       KC C  G+R  +D  +     D D     ++ S +  + +        +   +    +  +A+    G+  L ++    +R   + R +++        T++ +   G+  D+ S NI+W   +   +++++  L     N   R +V S  +  P+ +A     G LFWS+   +      + +G  +  +   + +    I +     +++W D G+  +IE + ++ G +R V++     T +  ++  +   +YW D
Sbjct:   69 RTCPAEQFTCGNGKCIPIAWKCDLDNDCSDNSDEPPSCAYPTCLPLTQFSCNNGRCINIRWRCDSDNDCADSSDEAGC-NNTCADSQFSC--KNGHCIPSQWVCDGDNDCGDVSDET-HTCEFPARPL-RQCRED-EFRCAINGNCIPLRWRCDGDADCMDISDEKECDG---------------QRRTCNPGTHFTCVSNGI--CIRKAWVCDGDNDC-EDNSDEAGCHVYLCQSDKGG-----------------------------CS----HNCTVTPVDGLVC----SCPKGMQL---------GEDRKTCNFTDYCARHL------RCSQRCEQEKGAVKCGCYDGWRLMLDGKSCRSTADADPFVPFIIFSTR--HEIRRIDLHSRDYSVLVPSLRNAIAIDFHFGQSTLYWTDVVDVRSRVIRRAFINGTGVETIVTTDVMNTHGLAVDWISGNIYW--IDHAFDVIEVARL-----NGSYRYVVVSEELDKPLAIAVHPQKGYLFWSEWGHSPRIERTLLDGTERMALVNSSIASPNGISIDYDEGKLYWCD-GQTDRIERVDLETGANRHVVLV--ATTSDMFSVSVFGSHIYWSD 586          

HSP 4 Score: 87.0409 bits (214), Expect = 1.477e-17
Identity = 183/761 (24.05%), Postives = 285/761 (37.45%), Query Frame = 1
Query:  130 RRFQFLCQNGKCIPETLHCDGHDNCG------DNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSD----GSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE-KNC------PDSENSKSKSQSLADLVK------------------QSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSE--------NCDKNLCKINNGNC--EQKCINFYSH-----RKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMD---------MLYSPKNPTSNFLPIGIDFDYKSKNIFWT-------QFEPNPEIVQIDHL--------VSKTGNMKPRTLV------YSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNG-MRKTLVRLGNHS-KVRSIVVHPKYRRIFWTDW--GKEPKIECMGMDGQDRKV---------LIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHL--NAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKI-----LVSSPKPMGVKLFHQ 2112
            R     C   +C+   L C G    G      D S+  C   E F C +   +     C+  ADCD+  D   C                 +C S+ +  N+ N C D    G+     AC  +     V      HFQ  +++ C+ R++ CD   DC D SDE  NC       D    K   + + D  K                  +   C+  +F C     +P     W CD   DC +   DE  C+   CS  + + C     C     RCDG  DC D SDE+ CS      + C+  ++F+C +N  CI  +  CD   DC DGSDE   G +          C+  LCK  +  C  E  C +         R   C P  +    N+  C+ +D   D +   + C ++     C        ++  + C A  E+F   S +    ++RLL ++ D         M        +  L     F+    +            F+ N  I   + +         S+  N    + V      + ++H     A D    +++ +D   N++  L+      R T V LG+ S +V S+ VH +  R+FWT+W  G    +E     G+ R V         L   GL TP+G+A+D+   +LYW D+    + V  L    R+ +VS +  + H   +D     +Y SDW N   I+     G ++       V  P  + V   +Q
Sbjct:  679 RCVAVRCVGARCVGVRLRCVGVRCVGSSEQGPDPSNATCADHE-FRCGNGVCLPNATRCNQLADCDDVSDEVGC---------------GTSCGSQVTQ-NNMNACLDYVVQGNQRFXCACVCVRAAAAVATCAPSHFQLTSRR-CVPRVWVCDRDDDCGDGSDEPANCTQTMCGADEFRCKGTGRCIPDRWKCDGDDDCGDGSDEPRDECEDKTCEPYQFRCKNNRCIP---GRWHCDYDNDCGDN-SDEEGCTPRPCSESEFS-CAN-GRCIAGRWRCDGDHDCMDGSDEKDCS------LRCEQ-DQFQC-QNGHCIPQRWRCDNDADCLDGSDEENCGSAVRLCPKDEFQCNSTLCKPFSWRCDGEDDCGDNSDEDADHCRAFQCPPRRQFRCRNDRVCVSLDRVCDGI---NNCGDHSDEEHCG-----EPARGARACTA--EEFKCDSLERKCIDVRLLCNHHDDCGDGGSDEMACGGDPRVNECLSNACGFEASCHDTLQGYYCSCRPGFQWNASISSCEDVDECLHFGTCSQVCNNTKGSHVCSCAENFVKVHHHSCKANDSERTMIYVAD--NNQVRGLSPQRANARYTQVLLGDDSVRVHSMGVHVRTARLFWTNWHLGSISSMELRPGAGRPRSVRDDTAAVVRLEIPGLRTPSGVAVDWVAGNLYWTDSGRDVVEVAQLSGQNRKTLVSGMIDDPHAIALDPVRGKMYWSDWGNNAKIEQASMDGTRRRNFVEERVQWPTGLAVDYMNQ 1395          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Match: LRP8 (LDL receptor related protein 8 [Source:HGNC Symbol;Acc:HGNC:6700])

HSP 1 Score: 225.713 bits (574), Expect = 3.840e-64
Identity = 140/442 (31.67%), Postives = 218/442 (49.32%), Query Frame = 1
Query:  820 RCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK--FLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA--HGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQP 2124
            RC T  SC     +CDG+ DC D SDE  C+N +   V C     F+C ++  C+  ++VCD   DC D SDE        C+ N C   NG C   C +     +C C  GY +  ++E  C D DEC    VCS  C NY G YKC+C+EG+ M    + C A   +  +L+++ +  +R + L  R Y  ++   +N       + +  +  +  I+W+      + V   H+     + +  +++        G+A DW+HG L+W+D     ++V       R+TL   G  S+ R+I V P    ++W+DWG+  KIE  GM+G  R+V++   +  PNG+ LD     LYWVD+K R +S  NL   +R +V+   +A  H F I +FED +Y +D + E I    K TG     ++     P  + ++H L QP
Sbjct:   10 RC-TDGSCVPGSSQCDGFRDCHDGSDEHDCNNTA---VDCTGPGWFRC-RSGECLQDRQVCDGKRDCHDWSDE----PLSLCNVNECATTNGGCSHTCWDRPLGYECGCPAGYEL--LDEYTCGDTDECKQPGVCSQLCINYKGGYKCDCYEGYTMDPATQACKATEHQKTYLIFANQRDVRRVDLHTRSYKQLISRTRNT------VAVAVEITANRIYWSDL--GQKQVYSAHMDEAHDSTRHTSVLGEAPVFVEGIAIDWVHGNLYWTDSKAKTVAVAKPDGSRRRTLFGQG-LSEPRAIAVDPLSGFVYWSDWGQPAKIEKAGMNGVSRQVIVSKDIEWPNGITLDLVNKRLYWVDSKLRTLSSVNLAGGERHEVMHQTDALHHPFAIAIFEDKVYWADGEKEAIYSADKHTGSGISSVVEDLHSPQDLLVYHPLLQP 431          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005337.1 (pep scaffold:Pmarinus_7.0:GL479201:36221:45319:-1 gene:ENSPMAG00000004851.1 transcript:ENSPMAT00000005337.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.295 bits (386), Expect = 2.779e-40
Identity = 94/255 (36.86%), Postives = 136/255 (53.33%), Query Frame = 1
Query: 1516 LVSKTGNMKPRTLVYSRIHSPV-GLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            ++ K  + K   +V  +  S V GLA DWIH  L+WSD  F  +SV  + +G R+ L   G   + R+IVV P    ++W+DWG+  KIE  GM+G +R  ++   +  PNG+ALD     LYWVD+K   +S  ++    R  V++  +   H F I VFED +Y +D + E I  ++K TG  + +++     P  + + H LAQP    N C    C+YLCLP          F C C D S+L  DGKTCS
Sbjct:    3 VIGKASDSKNHAVVIEQGLSFVEGLAVDWIHNTLYWSDSGFKTLSVATM-DGRRRKLFDSGLQ-EPRAIVVDPIAGWLYWSDWGEPAKIEKAGMNGANRHAIVTHDIQWPNGIALDLANRRLYWVDSKLHTLSSVDMSGQDRVTVLASYSDLLHPFSIAVFEDKVYWTDGEEEAIFSMNKFTGSGRRVLAENLHSPQDIVVVHPLAQPSG-PNRCEGSGCEYLCLPAPKVDAALPLFSCACADNSHLNPDGKTCS 254          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Match: EDO43726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXU8])

HSP 1 Score: 356.295 bits (913), Expect = 6.447e-110
Identity = 249/731 (34.06%), Postives = 354/731 (48.43%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDN--SDE-----ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCE-NKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGE-KFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDG--QDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDW--DNEKIIQIHKKTGKQKILVSSP--KPMGVKLFHQLAQPVNIENACI--NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            K C + QF C+NGKCI  T  CDG D+C D   SDE     +    + F CS+   I ++  CD + DC ++ D    V+  C+ +QF C     +CIS +  C+ +NDC+DGSDE    C   +  +         F C  +++ CI   + CDG +DC D SDE  CP +  S  +             C    F C  G    C+   WRCDG  DC +   DE  C    C+  +   C     C  + QRCDG  +C D+SDE+ C  P      C P  EFKC     CI   +VCD T DC DG DE        C+ + CK +NG+C QKC +      C C  GY++       C+DIDECA++  CS  C N  GS+KC C  G+ +  D + C A G    L+YS++ SIR + +       + S +        +G+D+DYKS  IFWT  +   E +    L   +G+++    +   +  P  +  DW    ++W+D   N I V  +T   R TL   G   + R+IVV P    ++WTDWG   +IE  GMDG    R ++I   L  PNGL +DY    LYW DA+ ++I    L    RR +      H F I VFE++LY +DW  D   + +++K TG ++ +V       M +++ H L QP  + N C   N  C +LCL  +       KF C CP+   + +DGKTC
Sbjct:   38 KTCLQDQFTCRNGKCIQATWKCDGEDDCRDGYRSDESNCGNVTCGADEFMCSNRKCISRSWTCDNQDDCGDNSDEDRNVQRTCASNQFTCSNG--DCISNSWTCDGDNDCNDGSDEKESLCASKSCKIT-------EFTCRTSRRKCIPSQWKCDGDNDCPDSSDESGCPTASVSPRR-------------CSVGMFKCRNGE---CVLGHWRCDGEKDCSDG-SDEKGCRKSNCASSEFT-CAN-GQCIPSSQRCDGTSNCRDSSDEKACVTPP----PCMP-GEFKCQSTGRCIPESKVCDGTRDCQDGEDE-----PLRCNIDECKDHNGHCSQKCNDLTLGYNCSCFSGYKLQGAR--LCVDIDECAEYGTCSQVCENRKGSFKCSCLPGYRIDGDGRTCRANGTLPSLVYSSQFSIRNVTVSGAISQAIVSGRKGV-----VGLDYDYKSNLIFWT--DAKAEKINRARL-DGSGSVEE---IVGDVKVPDDVTVDWSGRKIYWTDGEQNMIEVAELTGAHRMTLFSSG-LDEPRAIVVDPSAGYLYWTDWGYNARIERAGMDGDASTRTIIISGELGWPNGLTIDYTIKRLYWADARLKRIESSRLDGSDRRLIADIAPQHPFAITVFENYLYYTDWNRDERALRRVNKFTGGERTIVKRVLWPHMDIQVLHPLKQPY-LPNRCGDNNGGCSHLCLLAAAPR----KFSCKCPNGMNMSSDGKTC 711          

HSP 2 Score: 90.1225 bits (222), Expect = 1.897e-18
Identity = 90/275 (32.73%), Postives = 115/275 (41.82%), Query Frame = 1
Query:  508 HFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYK-DELNCSNFECSPDK---PNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINE-TKCIDIDECADHMVCSHKCANYLGSYKC---ECFEGFYMSKDNKQC 1308
             F+C + Q CI   + CDG+ DCSD SDE+  P +                   C  ++F C  G    CI   W+CDG  DC + Y+ DE NC N  C  D+    NR      C      CD   DC DNSDE+   N  +   S    N+F C  N  CI+    CD  NDC DGSDE    K   C    CKI    C        S RKC+    ++ D  N+     D   C    V   +C+  +G +KC   EC  G +     K C
Sbjct:    5 QFECVSDQKCIVLRWRCDGEDDCSDGSDEQGSPKT-------------------CLQDQFTCRNGK---CIQATWKCDGEDDCRDGYRSDESNCGNVTCGADEFMCSNR-----KCISRSWTCDNQDDCGDNSDED--RNVQRTCAS----NQFTC-SNGDCISNSWTCDGDNDCNDGSDE----KESLCASKSCKITEFTCRT------SRRKCI-PSQWKCDGDNDCPDSSDESGCPTASVSPRRCS--VGMFKCRNGECVLGHWRCDGEKDC 232          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Match: EDO43938 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXB8])

HSP 1 Score: 334.339 bits (856), Expect = 3.834e-102
Identity = 247/730 (33.84%), Postives = 347/730 (47.53%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE-----ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSN---PSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK-FLLYSTKNSIRELRL-LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIK-DGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILV--SSPKPMGVKLFHQLAQPVNIENACI-NHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTK 2274
            C    F C N +C+P +  CDG ++CGD SDE      C   E F C D   I  T  CD + DC +  D + CV   C+  +F C      CI     C+H +DC DGSDE  + C+   K     C+      C N + C+ + + CDG  DC D SDE NC            L         C+ NE  C  G+   C+ + W CDG  DC +   DE  C    CS D+     T   C    Q+CDG  +C D SDE+ C      +Q    C P + F+C  +  CIA  +VCD T  C  G DER      NCD + CK  NG+C Q C N  +   C C  GY +   +   C DI+EC    +CS KC N  GS+KC C EG+ +  D ++C A+G + ++L++ +NSIR +    + Y   +   K+  +      + FD K   ++WT  +     +Q   +V  T      T+  + +  P GLA DW+   ++W+D   N I V  +      TL+  G   K  ++V+ P    I+WTDWG   KIE   MDG  RKVLI  + L  P GLA+DY    LYW+D+K   I   NL   + R V++    +   I VFED +Y +  D+ KI + +K TGK   ++  ++  P    ++H   QP       I N  C +LCL +S    N  K+ C CP   +L  DGK CS +K
Sbjct:    1 CPPSDFTCANSQCVPNSFRCDGENDCGDRSDESEPTTTCSANE-FRCDDGRCITSTFRCDREFDCTDRSDERGCVNKTCAPYEFTCAFS-GRCIPGRFRCDHRSDCLDGSDE--QNCQNAAK----TCNPVTDHTCRNGR-CVLKEWLCDGMDDCGDSSDEDNC------------LTRPTPPPVKCRKNERMCADGNG--CVHRRWICDGERDCLDG-SDEAGCGTIGCSSDEFT--CTNQKCIPLPQKCDGTDNCGDGSDEKMCRKYLFSTQPGQVC-PRDHFRCGSSTICIANSKVCDATPHCPHGEDER------NCDIDECKSFNGHCLQLCTNTKTSFYCSCFSGYELMD-DRKSCRDINECEIPGMCSQKCYNTKGSFKCSCMEGYVLEPDGRRCKALGPRPYVLFTDRNSIRLIMTDGKEYKQAVQGLKDART------LGFDVKESMLYWT--DKAATAIQKAKMVPDT---TIETVHETGLVEPAGLAIDWVGRKMYWADPGANTIEVSELDGSNTMTLISSG-LDKPSAVVLDPTEGFIYWTDWGDPAKIERASMDGTARKVLISGEHLERPAGLAIDYSTRRLYWIDSKLDVIKHCNLNGTEVRVVINTGIDNPTAITVFEDHIYWT--DSRKIYKANKFTGKNMTVLVNNAASPEDAHIYHPQRQPTASSPCAIRNGGCSHLCLISS----NKNKYSCNCPKDLFLQLDGKICSKSK 678          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Match: EDO48069 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJZ9])

HSP 1 Score: 312.383 bits (799), Expect = 2.151e-94
Identity = 224/668 (33.53%), Postives = 318/668 (47.60%), Query Frame = 1
Query:  331 CVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDES---PEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNC-------SNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFC---SNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK-FLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKP-RTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDG--QDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSP--KPMGVKLFHQLAQ-----PVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C    C+  +F C      CIS+  +C+ +NDC D SDE+   P  C                F C +K+  +SR + CDG  DC+D SDE NCP+S                S  C+++E+ C  G    CI K W CDG +DC     DE NC       S F C+  +         C     RC+G  DC DNSDE  C   S  +    S     EF+C  +  CI   +VCD + DC + +DE      +NC  N CK NNG C+  C +  +   C C+PGY++   +   C D+DECA    CS  C N  GSYKC C EG+ +  D K C A+G+K FLL++ +  IR L +       +  PK   +    I +D+D+ +  I+W+      ++++     +   N     T+V   + +P G+A DW++  L+W+D   + I V N+    R  L+  G   + R+IVV+P    +FWTDWG+EPKIE  GM+G  + R  ++   +  PN L +DY  D ++W DAK   I   NL    RR + S    H F I VF+D++Y +DW  E I + +K  GK + LV S    PM + ++ Q  Q     P    N   +HTC    LP S          C CP    LL D  TC
Sbjct:   37 CGNKTCAPHEFSCGNG--RCISQQWVCDQDNDCGDFSDENHCPPHTCR------------PNEFTCADKRCILSR-WRCDGDRDCADNSDEINCPNS----------------SQYCKSSEYQCSTGE---CIHKSWVCDGEFDCLNK-SDENNCHSSACHISQFTCANKR---------CIPMRDRCNGNNDCLDNSDEADCRMFSLLATKPPSICKDGEFQCGSSKQCIPESKVCDGSVDCTNSADE-----PDNCFINECKDNNGPCQHYCNDTKTGYFCSCRPGYKVALDDPKSCRDVDECAIPGSCSQMCFNSKGSYKCTCMEGYRLEPDKKTCKALGDKPFLLFTNRQDIRRLVMDSSDFTQVV-PKLRAA----IALDYDFATGVIYWS------DVIEASIKSAPLNNGSAVETIVNMSLLTPDGIAVDWVNRKLYWTDTGTDVIEVANLDGRERMRLITTG-LQEPRAIVVYPAIGYMFWTDWGEEPKIERCGMNGDPKTRLQIVNTNILWPNALTIDYTIDKIWWADAKEHTIECANLDGTARRVITSDSVHHPFAITVFQDYIYWTDWVKESIYKANKFNGKDRSLVCSGLYSPMDIHVYQQQKQPKFSNPCGENNGGCSHTCLLAPLPKS--------HTCHCPPNINLLEDSATC 635          

HSP 2 Score: 88.9669 bits (219), Expect = 4.167e-18
Identity = 64/168 (38.10%), Postives = 82/168 (48.81%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEI--------CDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIIN----KPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDE 594
            CR  +F C + +CI     CDG  +C DNSDEI        C   E + CS    I K+ +CDG+ DC N  D   C  + C I QF C  K   CI     CN NNDC D SDE+   C + +    KP  +  D    FQC + + CI     CDG  DC++ +DE
Sbjct:   81 CRPNEFTCADKRCILSRWRCDGDRDCADNSDEINCPNSSQYCKSSE-YQCSTGECIHKSWVCDGEFDCLNKSDENNCHSSACHISQFTCANK--RCIPMRDRCNGNNDCLDNSDEA--DCRMFSLLATKPPSICKDG--EFQCGSSKQCIPESKVCDGSVDCTNSADE 241          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Match: EDO49498 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB0])

HSP 1 Score: 303.908 bits (777), Expect = 1.932e-91
Identity = 224/689 (32.51%), Postives = 320/689 (46.44%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---------ICDHRETFTCSDSNIILKTELCDGKADC---DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG--EKFLLYSTKNSIRELRL--LRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVL---IKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNA--HGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQP 2124
            C   +F C+NG CI     CDG ++C DNSDE          C   E    +    I  +  CDG  DC   D  ++    V   CS   F C      C  +  +C+  +DC DGSDE         K           F C + + CI   + CDG  DCSD +DE+ CP                     C +++F C  G    CI+  WRCDG +DC +   DE NC+   C P +   C     C      CDG  DC D SDE  C   S  N      + ++C   + CIA  +VCD   DC D SDE PG     C  + C  NNG C Q C++     +C C+PG+ + S N+T C DI+EC +   CS +C N  GS+ C+C +G+ +  D ++C A      FL +ST+  IR+L L   + Y   +   +N       IGIDFD++ K ++W+        V      + TG      L+   + +  G+A DWI   L+WSD+  + I V  +    R+ L+     S  R +V+      +FWTDWG  P++E   +DG +R V+   IK  +W PNGL LD     +YW+DAK   I         +R V+S      H F + +FED+LY +DW N+ ++++ K  G+   L+S+   KPM +   H L QP
Sbjct:    1 CSAGKFTCKNGHCISLRWKCDGENDCVDNSDEDEYAGCAEWSCRASEFRCQASRKCIPLSWRCDGDYDCLAPDLSDEANCSVATNCSASMFRCANG--QCKPRDWVCDGFDDCGDGSDE---------KGCANHSCTPAQFSCPSGR-CIPLRWRCDGDGDCSDGADERGCPPKN------------------CTDSQFSCSNGQ---CISLAWRCDGDHDCADK-SDERNCTGKTCKPFE-FACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGN------DRWRCSNTSRCIAKSQVCDGRVDCPDASDEGPG-----CGLDQCHSNNGGCAQLCMDVPEGVQCSCRPGFTLASDNKT-CEDINECLNSSSCSQRCFNTRGSFSCKCVQGYRLEPDKRRCKAADSIRPFLYFSTRREIRKLGLPPSQSYTFAVRRLRN------TIGIDFDWREKRLYWSDVYKK---VISRSYFNGTGR---EDLITDALITAEGVAVDWIGRNLYWSDMRSDRIEVSTLEGKWRRVLLSEDVESP-RGLVLDSNAGYLFWTDWGTSPRVERSWLDGSNRFVISFGIKI-VW-PNGLTLDLATKRVYWIDAKLDHIVSCEYDGSSKRIVLSGSRQINHPFAMTLFEDYLYWTDWQNKHVLRVSKLHGENVTLLSAGVSKPMDIHAVHPLRQP 627          

HSP 2 Score: 66.2402 bits (160), Expect = 4.039e-11
Identity = 41/117 (35.04%), Postives = 56/117 (47.86%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESP 453
            K C   QF C NG+CI     CDG  +C D SDE       C   E    +  + I +  +CDG+ DC +  D   C    C  D++ C +    CI+K+ +C+   DC D SDE P
Sbjct:  162 KNCTDSQFSCSNGQCISLAWRCDGDHDCADKSDERNCTGKTCKPFEFACANGRHCIQRKWICDGENDCGDRSDEVDCGLESCGNDRWRC-SNTSRCIAKSQVCDGRVDCPDASDEGP 277          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Match: EDO49499 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGB1])

HSP 1 Score: 303.908 bits (777), Expect = 5.656e-90
Identity = 234/711 (32.91%), Postives = 328/711 (46.13%), Query Frame = 1
Query:  112 QYYKRCRRFQFLC-QNGKCIPETLHCDGHDNCGDNSDE------ICDHRETFTCSDSNIILKTELCDGKADC-DNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQL------CISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG--EKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN-AHGFDIDVFEDWLYLSDWDNEKIIQIHKKT--GKQKILVSSPKPMGVKLFHQLAQPVNIENAC--INHTCQYLCLPT 2181
            Q  K C    F C  +GKCIP++  CDG  +C D+SDE       C  +E F C++  + L  + CDG+ DC     D + C    C+   F+C     +CI +  LC+   +C DGSDE                 N   F C   +       CI+  + CDG +DC D SDE NC                      C   +F C  G    CI K   CDG  DC +   +  NCS   C P    +C     C +   RCDG  DC D SDE  C        +C P +E+ C+  + CI   RVCD TNDCGD  DE       +C K        NC Q+C+      +C C PGY I S +   C DI+EC+    C H C N  GSYKC C EG+ + + +  C  VG  + +L++S    IR++ L     D+L   +N T     I +DFD+  K ++WT    N    Q     S +      T++ + +  PVGLA DW+   L++ +     I V  +   MR +L+   + SK R I V P+   +FWTDW +  +IE   MDG  R +L K  ++  N L LDY    +YWV+A    I   +    +RR+V  + +  H F I ++ + L+ SDW    II I+K T  G  K++ +   PMG+++ H   QP  + N C   N  CQ LCL T
Sbjct:   38 QQAKNCGSRHFKCVSDGKCIPKSWRCDGEMDCPDSSDEEGCVNRTCSSKE-FNCNNQCVPLSWK-CDGEKDCRPGGFDEEGCEPVTCASTYFLCPNSS-HCIPRRWLCDGLAECEDGSDEK----------------NCQKFTCAPDKFACASGGCIASRWVCDGDNDCGDNSDELNC------------------TRLTCPPTKFLCANGM---CIPKSAVCDGENDCGDMSDEPSNCSAHICDPKLEFQCAN-GRCINKKWRCDGMKDCADGSDESTCGEG-----TCRP-DEWHCIGTSRCIPLSRVCDGTNDCGDNYDEGSHCLDLDCKKK-------NCSQRCVQTPRGGECRCFPGYTI-SKDLITCKDINECSSIGRCDHFCYNTPGSYKCACDEGYVLERPH-TCKPVGPYKPWLIFSNCKDIRQVSLDGTQYDLLI--RNLTR---AISVDFDWLEKKVYWTDVRENAIYRQNYTWASSS---FATTVIRTGLAMPVGLAVDWVGRNLYFVESSVRRIYVSKLDGSMRTSLITT-DLSKPRGIAVDPRVGYLFWTDW-EAHRIERANMDGSSRVILAKTNVYWANTLTLDYTLQTVYWVEAHLDYIGAMSYDGLKRREVRHNGDIIHPFGIAIYRNELFFSDWVRHAIISINKFTGNGTTKLVSNLEVPMGLQILHPSRQPA-MPNPCSPSNCGCQQLCLVT 681          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Match: ldlrb (low-density lipoprotein receptor [Source:NCBI gene;Acc:101161779])

HSP 1 Score: 375.555 bits (963), Expect = 2.352e-115
Identity = 251/731 (34.34%), Postives = 366/731 (50.07%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNI---------ILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKF--LLYSTKNSIRELRLLRH--YMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISV--YNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENACINH--TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            C   Q  C NG+C+     CDG D+CGD +DE+     + TC  S           + K+  CDGKADC N  D K C   +C  D+F C      CIS + +C+++NDCSDGSDE+       +KP      N + FQC N  +C+  ++ CDG  DC+D SDE   P++   K          K +  C  +EF C  G    CI   WRCDG  DC +   DELNCS   C   +  +C    SC   + +C+   DC+D SDE  CS       +CD  +EFKC  +  CI+ + VCDKT DC DGSDE       +C  N C   NG C   C +      C C  GY++ + ++  C DI+ECA+   CS  C N  GSYKC+C  G+ +   +  C A       LL++T++ +R++ L+ H  Y+ ++   KN  +      +D D   K ++W+       + +I  L     + KP T++ S I +P G+A DW+HG ++W+D     ISV +     RKTL+R  N  K R+I + P    ++WTDWG   KIE  G++G  R  L+ + + +PNG+ LD     LYWVD+K   +     N  T  R  V++   +H F + VFED ++ +D     I    + TG+    ++     P  + L+H L QP+ I N C +   +C++LCLP         K+ C CPD   L  D ++C
Sbjct:   30 CSSSQLKCGNGRCVTRRWICDGTDDCGDGTDELLSTCASKTCLPSQFNCGAPINQCVPKSWHCDGKADCSNGADEKNCTVKQCKNDEFRCANG--QCISLSFVCDNDNDCSDGSDET-----TCSKPTC----NPLSFQC-NNSVCVPSLWRCDGDEDCADGSDEW--PETCGGK----------KPAAKCSVSEFECANGQ---CIPGSWRCDGGIDC-DDRSDELNCSRPVCLEGQ-FQCGD-GSCLQGNLKCNSVRDCSDGSDETDCS------TACDAPSEFKC-SSGECISMENVCDKTKDCSDGSDE----PESSCGINECSTANGGCSHHCNDLKIGFNCSCPAGYKLKA-DQRNCEDINECAEADTCSQICINLPGSYKCDCEWGYKIDPVSNTCKAESGTVPALLFTTRHDVRKI-LVDHSEYVQVIPGLKNAAA------LDMDMAQKTLYWSDVS----LKKIFRLNLADSSSKPVTVIDSGIETPEGIAVDWVHGNIYWTDSTLKTISVASTDGTKRKTLIRE-NLDKPRAITIDPVNNFVYWTDWGHHAKIEKSGLNGAGRVALVTENIVSPNGITLDMVNQRLYWVDSKLHTVFSIDVNGGTRHRVVVINQRPSHPFSLTVFEDKVFWTDTGLRGIYSASRLTGRNLTQIAGDLDHPEDIILYHNLKQPIGI-NWCNSGKDSCEFLCLPAPQANTTSPKYSCACPDDMSLGPDMRSC 705          

HSP 2 Score: 65.4698 bits (158), Expect = 2.632e-10
Identity = 41/121 (33.88%), Postives = 58/121 (47.93%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEI 468
             +C   +F C NG+CIP +  CDG  +C D SDE+   R       F C D + +     C+   DC +  D   C     +  +F C +    CIS  ++C+   DCSDGSDE   +C I
Sbjct:  194 AKCSVSEFECANGQCIPGSWRCDGGIDCDDRSDELNCSRPVCLEGQFQCGDGSCLQGNLKCNSVRDCSDGSDETDCSTACDAPSEFKCSSG--ECISMENVCDKTKDCSDGSDEPESSCGI 312          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 365.54 bits (937), Expect = 7.141e-111
Identity = 249/736 (33.83%), Postives = 363/736 (49.32%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHR----ETFTC--SDSNIILKTELCDGKADCDNDEDPKICVKNK--CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS--HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIE----NACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            K C    F C+NG+C+P    CDG   C D SDE   IC  +    E F C  + S  +  +  CDG+ DC+N  D + C  +   C+   F CR     CI  T +C+ +NDC D SDE     E  + P   Q      F+C N + CI  ++ CDG  DC D+SDE          S  +       Q   C   EF CG+G    C+   W+CDG  DC +   DE NC    C PD+  +C    +C    ++C+   DC D SDE  C N ++    CD   +F+C KN  CI   +VCD   DC D SDE P    + C  N C  NNG C   C +     +C C  GY++  +++  C DIDEC +   CS  C NY G YKCEC+EG+ M   +K C AVG   +L+++ ++ IR + LLR  Y  ++ + KN       + +D D  +  +FW     + +I      ++K  +   +  +   +HSP GLA DW+H  ++W+D     ISV       RK L+     S+ R+I V P    ++W+DWG+  KIE  GM+G DR+VL+ D +  PNG+ LD     LYWVD+K   +S  +L    R+ ++S  H   H F + VFED ++ +D + E I  +++ TG    K+      P+ + +FH+  QP   +     +  N  C+YLCL      ++  K+ C CPD   L  D + C+
Sbjct:   13 KTCATTDFTCKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPPEKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG--KCIGPTFVCDGDNDCGDSSDE-----EKCSSPTCGQ----HEFRCNNSE-CIPALWSCDGDPDCKDKSDE----------SAERCSRGKEPQKPRCPVGEFQCGSGE---CVHMNWKCDGDADCKDK-SDEANCPLLTCRPDE-FQCGD-GTCIHGTKQCNKVHDCPDYSDEAGCVNITK----CDGPRKFRC-KNGECIDSSKVCDNVKDCKDWSDEPP----KECGLNECADNNGGCSHICRDRRIGHECDCPSGYKL--LDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDPASKTCKAVGNSPYLMFTNRHEIRRIDLLRSEYTQVVPTLKNA------VALDVDVSTNKMFWCDLY-HRKIYSA--YINKASDSSQQVTLIDSLHSPEGLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIAT-ELSEPRAIAVDPHQGFMYWSDWGEHAKIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDLSGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEYLCLKAPQITDHSPKYTCACPDGMELGPDMRRCA 699          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Match: vldlr (very low density lipoprotein receptor [Source:NCBI gene;Acc:100125475])

HSP 1 Score: 361.688 bits (927), Expect = 3.549e-110
Identity = 261/861 (30.31%), Postives = 399/861 (46.34%), Query Frame = 1
Query:  124 RCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTCSDSNIILKTELCDGKADCDN--DEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSI----HFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQ-------------------------SLADLVKQSTI---CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLN--AHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSS--PKPMGVKLFHQLAQPVNIENAC----INHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQL 2559
             C   QF C NG+CIP    CDG D+C D SDE    ++T     F C +   + K   CDG+ DC++  DE  +IC    C +++F C      CI  +  C+   DC +G DE             V C N       F C + + CIS+ + C+ + DC D SDE +C  S    S+ Q                         SL+   +  T    C ++E  C +G    CI K+WRCDG  DC +   DE NC    C PD+  +C+   SC    ++C+G  DCTD SDE  C N SQ    C    +FKC ++  CI   +VC+K  DC D SDE      + C+ N C +NNG C   C +     +C C PG ++  I+   C DI+EC +  +CS  C N  G YKCEC  G+ M      C AVG E  L+++ +  +R L L R  Y  ++   +N       + +D D+  + IFW       +      ++ K G++     V   + +PVG+A DWI+   +W+D+    ISV N    ++K L   G      SI V P    ++W+DWG+  KIE  GM+G DR+VL++  +  PNG+ LD     LYWVD+K   +   +L    R+ V+      AH F + VFED ++ +D +N+ I   +K +G   + ++S    P  + ++H+L Q ++  N C    +N  C ++CLP     ++  K+ C+CP+   L  DG  C P  +      +  ++       + + V             +  V    G   +RN+  R  +++ NF+NP Y +    +L I +      +   Y  +
Sbjct:   32 ECETNQFQCGNGRCIPSIWQCDGEDDCTDGSDEKSCVQKTCAEVDFVCRNGQCVPKRWHCDGEPDCEDGSDESLEICHMRTCRVNEFSCGAGTTQCIPVSWKCDGEKDCDNGDDE-------------VNCGNITCSPSEFTCTSGR-CISQNFVCNSEDDCGDGSDEVDCAPSSCGPSEFQCGNSSCIPASWVCDDDVDCQDQSDESLSRCGRHPTPPAKCSSSEMQCLSGE---CIHKKWRCDGDPDCKDG-SDEANCPVRTCGPDQ-FKCED-GSCIPGSRQCNGIRDCTDGSDEVDCKNLSQ----CSGPEKFKC-RSGECIDMSKVCNKVRDCPDWSDE----PIKECNVNECLLNNGGCSHICKDMVIGFECDCTPGLQL--IDHKTCGDINECMNPGICSQICINLKGGYKCECHNGYQMDPTTGVCKAVGKEPCLIFTNRRDVRRLGLERKEYTQIVKQQRNA------VALDADFNQQTIFWADLG---QKAIFSTVLDKRGDVGTHKTVIENVQTPVGIAVDWIYRNFYWTDLGTKTISVSNFNGTIQKVLFNQGLKEPA-SIAVDPLSGFLYWSDWGEPAKIEKSGMNGVDRQVLVETDIQWPNGITLDLIKGRLYWVDSKLHMLCSVDLNGDNRKKVLQSPEYLAHPFALTVFEDRVFWTDGENQAIYGANKFSGSDVVTLASNLNDPQDIIVYHELIQ-LSGTNWCTERGVNGGCSFMCLPAPQVNKHSPKYTCVCPEGQELAADGFRCRPEANGSTSIQVDSTARGSAGAWAILPVL------------LLAVAGAAGYLTWRNWQLRN-QKSMNFDNPVYLKTTEEDLNIDITRHGANVGHTYPAI 837          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 364.77 bits (935), Expect = 4.474e-110
Identity = 249/736 (33.83%), Postives = 363/736 (49.32%), Query Frame = 1
Query:  121 KRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDE---ICDHR----ETFTC--SDSNIILKTELCDGKADCDNDEDPKICVKNK--CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS--HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIE----NACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            K C    F C+NG+C+P    CDG   C D SDE   IC  +    E F C  + S  +  +  CDG+ DC+N  D + C  +   C+   F CR     CI  T +C+ +NDC D SDE     E  + P   Q      F+C N + CI  ++ CDG  DC D+SDE          S  +       Q   C   EF CG+G    C+   W+CDG  DC +   DE NC    C PD+  +C    +C    ++C+   DC D SDE  C N ++    CD   +F+C KN  CI   +VCD   DC D SDE P    + C  N C  NNG C   C +     +C C  GY++  +++  C DIDEC +   CS  C NY G YKCEC+EG+ M   +K C AVG   +L+++ ++ IR + LLR  Y  ++ + KN       + +D D  +  +FW     + +I      ++K  +   +  +   +HSP GLA DW+H  ++W+D     ISV       RK L+     S+ R+I V P    ++W+DWG+  KIE  GM+G DR+VL+ D +  PNG+ LD     LYWVD+K   +S  +L    R+ ++S  H   H F + VFED ++ +D + E I  +++ TG    K+      P+ + +FH+  QP   +     +  N  C+YLCL      ++  K+ C CPD   L  D + C+
Sbjct:   80 KTCATTDFTCKNGQCLPSKWRCDGEPECADGSDEADAICSRQTCPPEKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG--KCIGPTFVCDGDNDCGDSSDE-----EKCSSPTCGQ----HEFRCNNSE-CIPALWSCDGDPDCKDKSDE----------SAERCSRGKEPQKPRCPVGEFQCGSGE---CVHMNWKCDGDADCKDK-SDEANCPLLTCRPDE-FQCGD-GTCIHGTKQCNKVHDCPDYSDEAGCVNITK----CDGPRKFRC-KNGECIDSSKVCDNVKDCKDWSDEPP----KECGLNECADNNGGCSHICRDRRIGHECDCPSGYKL--LDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDPASKTCKAVGNSPYLMFTNRHEIRRIDLLRSEYTQVVPTLKNA------VALDVDVSTNKMFWCDLY-HRKIYSA--YINKASDSSQQVTLIDSLHSPEGLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIAT-ELSEPRAIAVDPHQGFMYWSDWGEHAKIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDLSGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEYLCLKAPQITDHSPKYTCACPDGMELGPDMRRCA 766          
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Match: lrp8 (low-density lipoprotein receptor-related protein 8 [Source:NCBI gene;Acc:101167610])

HSP 1 Score: 345.51 bits (885), Expect = 2.371e-103
Identity = 250/732 (34.15%), Postives = 364/732 (49.73%), Query Frame = 1
Query:  127 CRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRET-----FTC--SDSNIILKTELCDGKADCDNDEDPKICVKNK--CSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVG-EKFLLYSTKNSIRELRLLR-HYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVS--HLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGK--QKILVSSPKPMGVKLFHQLAQPVNIE----NACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCS 2265
            C   QF C NG+CIP    CD  D+C DNSDE    R+T     F C  + S  +  +  CDG+ DC+N  D + C  +   C+   F CR     CI  T +C+ +NDC D SDE     E  + P   Q +    F+C N + CI  ++ CDG  DC D+SDE          S  +       Q   C   EF CG+G    C+   W+CDG  DC +   DE NC    C PD+  +C    +C    ++C+   DC D SDE  C N ++    CD   +F+C KN  CI   +VCD   DC D SDE P    + C  N C  NNG C   C +     +C C  GY++  +++  C DIDEC +   CS  C NY G YKCEC+EG+ M   +K C AVG   +L+++ ++ IR + LLR  Y  ++ + KN       + +D D  +  +FW     + +I      ++K  +   +  +   +HSP GLA DW+H  ++W+D     ISV       RK L+     S+ R+I V P    ++W+DWG+  KIE  GM+G DR+VL+ D +  PNG+ LD     LYWVD+K   +S  +L    R+ ++S  H   H F + VFED ++ +D + E I  +++ TG    K+      P+ + +FH+  QP   +     +  N  C+YLCL      ++  K+ C CPD   L  D + C+
Sbjct:   43 CETGQFQCSNGRCIPSLWRCDDDDDCSDNSDEENCRRQTCPPEKFDCGGAASKCVSLSWRCDGERDCENGADEEQCAADAKACASKDFQCRNG--KCIGPTFVCDGDNDCGDSSDE-----EKCSSPTCGQHE----FRCNNSE-CIPALWSCDGDPDCKDKSDE----------SAERCSRGKEPQKPRCPVGEFQCGSGE---CVHMNWKCDGDADCKDK-SDEANCPLLTCRPDE-FQCGD-GTCIHGTKQCNKVHDCPDYSDEAGCVNITK----CDGPRKFRC-KNGECIDSSKVCDNVKDCKDWSDEPP----KECGLNECADNNGGCSHICRDRRIGHECDCPSGYKL--LDKKTCGDIDECENPDACSQICINYKGDYKCECYEGYEMDPASKTCKAVGNSPYLMFTNRHEIRRIDLLRSEYTQVVPTLKNA------VALDVDVSTNKMFWCDLY-HRKIYSA--YINKASDSSQQVTLIDSLHSPEGLAVDWVHKNIYWTDSGNKSISVATGDGRKRKVLIAT-ELSEPRAIAVDPHQGFMYWSDWGEHAKIEKAGMNGVDRQVLVSDHIEWPNGITLDLSNRRLYWVDSKLHLLSSVDLSGGNRKVLLSSHHHLGHPFALTVFEDRVFWTDLEEEAIYSVNRLTGHDVAKVAEDLNNPLDLVVFHEQRQPKAPDTCNMGSLPNGGCEYLCLKAPQITDHSPKYTCACPDGMELGPDMRRCA 725          
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Match: SMESG000013396.1 (SMESG000013396.1)

HSP 1 Score: 1665.97 bits (4313), Expect = 0.000e+0
Identity = 852/860 (99.07%), Postives = 858/860 (99.77%), Query Frame = 1
Query:   55 MKYXXXXXXXXXXXXXXXXQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTIXXXXXXLKPKQSRVNVYXXXXXXXXXXXXXXXXXXXXXXAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN 2634
            MKYLLISCLV SIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSL DLVKQSTICQNNEFYCG+GSTVPCIAKEWRCDGSYDCPETY+DELNC+NFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDE+FCSNPSQH+VSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLV+SRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISVSSSSLKPKQSRVNVYLIVGLVITIVLLISLVLVGLGIAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN
Sbjct:    1 MKYLLISCLVFSIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNCGDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSIDQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLTDLVKQSTICQNNEFYCGSGSTVPCIAKEWRCDGSYDCPETYRDELNCTNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEKFCSNPSQHDVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVHSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINHTCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISVSSSSLKPKQSRVNVYLIVGLVITIVLLISLVLVGLGIAMYRNYIRRVIKRATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQSDGGLQMVATN 860          
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 249.98 bits (637), Expect = 6.257e-71
Identity = 183/568 (32.22%), Postives = 281/568 (49.47%), Query Frame = 1
Query:  646 DLVKQSTICQNNEFY-CGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV-SCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCK-INNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQ-CLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPK-NPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSP------VGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQR-RDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLFHQLAQPVNIEN-----ACIN---HTCQYLCLP---TSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            D+V  +  C ++++  C   + V CI+K+W CDG+ DC E+ KDE NC    C  ++   C +   C      CDG   C D SDE  C    +H + SCD  ++F C K+   CI    VCDK N+CG   DE PG   +NC +N CK I NG C   C NF+++ KC C  GY++   N T C+DIDEC A    C+  C N  GSY+C C++G+  ++ N + C+       +  T N  R+L +  +     Y P  N   + + I +D     + +FW Q + N ++ Q    +      K R L +  +           +++DW+ GLLFW+      I V N T+ +   L+  G  +  RSI V P    ++W D G +   P+IE + M+  +R+VL+   L  P  L +D     LYW D     I+  NL T    + ++S+   + F I VFE+ ++ +DW   +II I K T     +L    KP+ +++ +++ QP   E+     AC+    H C ++CLP    S+N     K++C+CP  S L  D  TC
Sbjct:   14 DVVLGNENCTSSDYLNCEDINAVNCISKDWWCDGNQDC-ESGKDESNCPPKVCLENEF-LCHSGTQCIPKLLLCDGTFHCVDKSDERNCM---KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQ-QSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENP-RSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 573          
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 249.595 bits (636), Expect = 6.449e-71
Identity = 183/568 (32.22%), Postives = 281/568 (49.47%), Query Frame = 1
Query:  646 DLVKQSTICQNNEFY-CGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV-SCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCK-INNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQ-CLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPK-NPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSP------VGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQR-RDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLFHQLAQPVNIEN-----ACIN---HTCQYLCLP---TSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            D+V  +  C ++++  C   + V CI+K+W CDG+ DC E+ KDE NC    C  ++   C +   C      CDG   C D SDE  C    +H + SCD  ++F C K+   CI    VCDK N+CG   DE PG   +NC +N CK I NG C   C NF+++ KC C  GY++   N T C+DIDEC A    C+  C N  GSY+C C++G+  ++ N + C+       +  T N  R+L +  +     Y P  N   + + I +D     + +FW Q + N ++ Q    +      K R L +  +           +++DW+ GLLFW+      I V N T+ +   L+  G  +  RSI V P    ++W D G +   P+IE + M+  +R+VL+   L  P  L +D     LYW D     I+  NL T    + ++S+   + F I VFE+ ++ +DW   +II I K T     +L    KP+ +++ +++ QP   E+     AC+    H C ++CLP    S+N     K++C+CP  S L  D  TC
Sbjct:   14 DVVLGNENCTSSDYLNCEDINAVNCISKDWWCDGNQDC-ESGKDESNCPPKVCLENE-FLCHSGTQCIPKLLLCDGTFHCVDKSDERNCM---KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQ-QSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENP-RSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 573          
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Match: SMESG000034068.1 (SMESG000034068.1)

HSP 1 Score: 249.595 bits (636), Expect = 6.514e-71
Identity = 183/568 (32.22%), Postives = 281/568 (49.47%), Query Frame = 1
Query:  646 DLVKQSTICQNNEFY-CGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNV-SCDPFNEFKCVKNN-TCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCK-INNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQ-CLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSPK-NPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSP------VGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVDAKTRKISVYNLKTFQR-RDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLFHQLAQPVNIEN-----ACIN---HTCQYLCLP---TSMNLENYIKFRCICPDFSYLLNDGKTC 2262
            D+V  +  C ++++  C   + V CI+K+W CDG+ DC E+ KDE NC    C  ++   C +   C      CDG   C D SDE  C    +H + SCD  ++F C K+   CI    VCDK N+CG   DE PG   +NC +N CK I NG C   C NF+++ KC C  GY++   N T C+DIDEC A    C+  C N  GSY+C C++G+  ++ N + C+       +  T N  R+L +  +     Y P  N   + + I +D     + +FW Q + N ++ Q    +      K R L +  +           +++DW+ GLLFW+      I V N T+ +   L+  G  +  RSI V P    ++W D G +   P+IE + M+  +R+VL+   L  P  L +D     LYW D     I+  NL T    + ++S+   + F I VFE+ ++ +DW   +II I K T     +L    KP+ +++ +++ QP   E+     AC+    H C ++CLP    S+N     K++C+CP  S L  D  TC
Sbjct:   14 DVVLGNENCTSSDYLNCEDINAVNCISKDWWCDGNQDC-ESGKDESNCPPKVCLENE-FLCHSGTQCIPKLLLCDGTFHCVDKSDERNCM---KHEIKSCDSISQFDCNKDGEICIPISEVCDKKNNCGRNQDEEPGNSVDNCQRNDCKLIPNGGCSHFCTNFFTYIKCHCPLGYKLQPDNRT-CVDIDECSASPSKCNQICKNTPGSYECSCYDGYRQNQHNSEYCITKEGDRSILITLNGGRQLMIDLNTGSHFYKPLYNSHESLVNIDVDLHQSPQTMFWIQ-QSNGKLGQSKIDLKVNNIEKYRFLNHKNLSDDHIGQLCTDMSFDWLRGLLFWTSSIEKIIYVTNTTSNVTSVLLNQGLENP-RSIAVDPINTGVYWIDLGTKKSSPRIEMVLMNTDNRRVLVSKNLRQPLDLLIDLQERKLYWSDIDPGSINFINLDTPNNPKTIISNKLLYPFSIAVFENNIFWTDWRQNQIISIDKITSDSYTVLAKVVKPLAIQVLNKVIQPKIHESDVTSHACLKNRMHGCSHICLPFPSNSINPNEGPKYKCLCPKDSKLQGDKLTC 573          
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Match: SMESG000062507.1 (SMESG000062507.1)

HSP 1 Score: 157.147 bits (396), Expect = 1.120e-39
Identity = 146/543 (26.89%), Postives = 239/543 (44.01%), Query Frame = 1
Query:  670 CQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKC--VKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKCINFYSHRKCLCKPGYRIDSINETKCIDIDEC-ADHMVCSHKCANYLGSYKCECFEGFYMSKDNKQCLAVGEK---------------FLLYSTKNSIRELRLLRHYMDMLYSPKNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHSKVRSIVVHPKYRRIFWTDWGKE---PKIECMGMDGQDRKVLIKDGLWTPNGLALDYYFDDLYWVD--------AKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLYLSDWDNEKIIQIHKKTGKQ-KILVSSPKPMGVKLF-----HQLAQPVN---IENAC--INHTCQYLCLP 2178
            C  ++ YCG  S   CI+K W CD + DC +   DE+NC    C  ++  +C   D C   ++ CDG  DC +N DE  C+N +    SC+    + C   K   CI  + +C+   +C    D       ENC  + CK +   C   CIN YS   C C P   +   N   C  I++C  +  VC   C +   SY C C++G+  ++++++C+   E+                 +++     +   + R   D+     N   N +       +K   +  ++ +  P  + +D  +S   N +   +    + S    A D    LLF++D + + I V+N+T+  +  +V    +    +IV+ P   R+FW D G E   PKI+   MDG  +  L++  +  P  LA+D     LYW D             +S  N+KTF    V++    H F I +F + +Y SD    KI   HK TGK  K++    KP+ +++       QL + +N   I   C  + +TC+  CLP
Sbjct:   21 CLQDDHYCGKNSFFQCISKLWVCDYNQDCDDN-SDEVNCPPMICDKNQF-KCPDSDLCIPREKLCDGVNDCIENEDEWNCTNIN----SCNEKTHYNCGNTKKLECIKIEDICNTNINCSTNKDSL-----ENCKADFCKTSENTCSHICINKYSSFTCDCPPDMELSEDNRN-CKHINKCFKNPEVCHQGCQDNGKSYNCFCYDGY--TENDQKCVPTTEENEINLLYSSFSSIYSVSIFNLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHKDNVLQVSKLQNWP--LNVDLYLSSISNKQNIEMNLKNL-SAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPF-NIVIDPVMGRLFWIDLGNENNGPKIKMANMDGSFQYTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNIKTFS---VLAIEYFHPFSIFIFGNRIYWSDLKEHKIYSAHKITGKDVKVIDKRVKPINLRIISKESNRQLIKKINEHKIGKYCSGVINTCRGSCLP 542          

HSP 2 Score: 60.8474 bits (146), Expect = 3.695e-9
Identity = 140/546 (25.64%), Postives = 202/546 (37.00%), Query Frame = 1
Query:  343 KCSIDQFMC-RTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNSIHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLVKQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECSPDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNEFKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCEQKC--------INFYSHRKCL--------CKPGYRIDSI----NETKCIDIDECADHMV----CSHKCANYLGSYKCECF----EGFYMSKDNKQCLAVGEKFL-LYSTK-NSIRELRLLRHYMDMLYSPKNPTSN----------FLPIGIDFDYKSKNIFWTQF--EPNPEIVQIDHLVSKTGNMKPRTLVYSRIHSPVGLAYDWIHGLLFWSD--------IHFNEISVLNITNGMRKTLVRLG-NHSKVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIK 1824
            KC  D   C +     CISK  +C++N DC D SDE       +N P ++ CD +  F+C +  LCI R   CDG +DC +  DE NC +  +   K+                 + CG    + CI  E  C+ + +C  T KD L              CK  D C  ++  C     C +      C  P    +S D  N   C   N C     VC +   C D       GKS NC    C       +QKC        IN                  P Y+   I    ++   +D++   + MV      HK  N L   K + +    + +  S  NKQ + +  K L  +ST  +  R L     Y D      N TS           + P  I  D     +FW     E N   +++ ++    G+ +  TL+   I  P  LA D     L+W+D        I  N +S LNI     KT   L   +    SI +     RI+W+D  +        + G+D KV+ K
Sbjct:   20 KCLQDDHYCGKNSFFQCISKLWVCDYNQDCDDNSDE-------VNCPPMI-CDKN-QFKCPDSDLCIPREKLCDGVNDCIENEDEWNCTNINSCNEKTH----------------YNCGNTKKLECIKIEDICNTNINC-STNKDSL------------ENCKA-DFCKTSENTCSHI--CINKYSSFTCDCPPDMELSEDNRN---CKHINKCFKNPEVCHQG--CQD------NGKSYNC---FCYDGYTENDQKCVPTTEENEINLLYSSFSSIYSVSIFNLNPHYKAKEIFRGQDDIFSLDVNLNRNEMVFYSSLVHK-DNVLQVSKLQNWPLNVDLYLSSISNKQNIEMNLKNLSAFSTALDPARNLLFFTDYNDSSIYVMNLTSFDKIKIVDKDCYFPFNIVIDPVMGRLFWIDLGNENNGPKIKMANM---DGSFQ-YTLLEKEIKKPKFLAIDIEEQRLYWTDHFPSAIKYIDINSLSQLNI-----KTFSVLAIEYFHPFSIFIFG--NRIYWSDLKEHKIYSAHKITGKDVKVIDK 498          
The following BLAST results are available for this feature:
BLAST of low-density lipoprotein receptor-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LDLR1.129e-11133.73low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR1.340e-11133.73low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR3.539e-11133.73low density lipoprotein receptor [Source:HGNC Symb... [more]
LDLR5.130e-11133.64low density lipoprotein receptor [Source:HGNC Symb... [more]
LRP42.428e-10733.91LDL receptor related protein 4 [Source:HGNC Symbol... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
T13C2.64.162e-8531.48pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
T13C2.64.176e-8531.48pep chromosome:WBcel235:II:6783427:6788255:1 gene:... [more]
lrp-11.166e-8031.02Low-density lipoprotein receptor-related protein ... [more]
lrp-21.653e-6729.57Low-density lipoprotein RecePtor related [Source:... [more]
rme-23.656e-5226.30Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LpR11.217e-9832.03gene:FBgn0066101 transcript:FBtr0301471[more]
LpR11.660e-9832.24gene:FBgn0066101 transcript:FBtr0301470[more]
LpR13.150e-9832.03gene:FBgn0066101 transcript:FBtr0301467[more]
LpR24.703e-9830.33gene:FBgn0051092 transcript:FBtr0113384[more]
LpR24.356e-9731.81gene:FBgn0051092 transcript:FBtr0113386[more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldlra1.196e-11634.10low density lipoprotein receptor a [Source:ZFIN;Ac... [more]
ldlrb3.713e-11133.04low density lipoprotein receptor b [Source:ZFIN;Ac... [more]
vldlr1.100e-11030.44very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr5.937e-11030.08very low density lipoprotein receptor [Source:ZFIN... [more]
vldlr6.325e-11030.21very low density lipoprotein receptor [Source:ZFIN... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pigs4.081e-12134.03phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigs8.354e-12134.83phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigs9.605e-12134.83phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigs1.690e-12034.83phosphatidylinositol glycan anchor biosynthesis cl... [more]
pigs4.800e-12034.78phosphatidylinositol glycan anchor biosynthesis cl... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ldlr1.149e-11434.60low density lipoprotein receptor [Source:MGI Symbo... [more]
Vldlr1.409e-10931.62very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr5.229e-10931.15very low density lipoprotein receptor [Source:MGI ... [more]
Vldlr8.383e-10931.74very low density lipoprotein receptor [Source:MGI ... [more]
Lrp43.418e-10733.64low density lipoprotein receptor-related protein 4... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q99087|LDLR1_XENLA2.943e-11934.42Low-density lipoprotein receptor 1 OS=Xenopus laev... [more]
sp|P35951|LDLR_MOUSE8.037e-11434.60Low-density lipoprotein receptor OS=Mus musculus O... [more]
sp|P20063|LDLR_RABIT1.258e-11233.83Low-density lipoprotein receptor (Fragment) OS=Ory... [more]
sp|Q99088|LDLR2_XENLA5.147e-11234.33Low-density lipoprotein receptor 2 OS=Xenopus laev... [more]
sp|P01130|LDLR_HUMAN5.421e-11133.73Low-density lipoprotein receptor OS=Homo sapiens O... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S6KMH20.000e+099.88Uncharacterized protein OS=Schmidtea mediterranea ... [more]
W5MM697.371e-12235.09Low density lipoprotein receptor OS=Lepisosteus oc... [more]
A0A3Q3LTV14.515e-11934.82Low density lipoprotein receptor a OS=Mastacembelu... [more]
A0A484CKQ08.038e-11935.16Uncharacterized protein OS=Perca flavescens OX=816... [more]
A0A2I4B9F98.894e-11934.70low-density lipoprotein receptor OS=Austrofundulus... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vldlr3.383e-11331.86very low density lipoprotein receptor [Source:NCBI... [more]
vldlr3.796e-11331.64very low density lipoprotein receptor [Source:NCBI... [more]
ldlra5.562e-11334.74low density lipoprotein receptor [Source:NCBI gene... [more]
ldlra8.595e-11334.74low density lipoprotein receptor [Source:NCBI gene... [more]
vldlr4.185e-11231.16very low density lipoprotein receptor [Source:NCBI... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lrp2a2.786e-9430.29low density lipoprotein receptor-related protein 2... [more]
lrp1ab9.284e-8330.21low density lipoprotein receptor-related protein 1... [more]
ENSPMAT00000001137.17.263e-7930.52pep scaffold:Pmarinus_7.0:GL476464:95621:179961:-1... [more]
LRP83.840e-6431.67LDL receptor related protein 8 [Source:HGNC Symbol... [more]
ENSPMAT00000005337.12.779e-4036.86pep scaffold:Pmarinus_7.0:GL479201:36221:45319:-1 ... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO437266.447e-11034.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439383.834e-10233.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480692.151e-9433.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494981.932e-9132.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494995.656e-9032.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ldlrb2.352e-11534.34low-density lipoprotein receptor [Source:NCBI gene... [more]
lrp87.141e-11133.83low-density lipoprotein receptor-related protein 8... [more]
vldlr3.549e-11030.31very low density lipoprotein receptor [Source:NCBI... [more]
lrp84.474e-11033.83low-density lipoprotein receptor-related protein 8... [more]
lrp82.371e-10334.15low-density lipoprotein receptor-related protein 8... [more]
back to top
BLAST of low-density lipoprotein receptor-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013396.10.000e+099.07SMESG000013396.1[more]
SMESG000034068.16.257e-7132.22SMESG000034068.1[more]
SMESG000034068.16.449e-7132.22SMESG000034068.1[more]
SMESG000034068.16.514e-7132.22SMESG000034068.1[more]
SMESG000062507.11.120e-3926.89SMESG000062507.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016312 ID=SMED30016312|Name=low-density lipoprotein receptor-like|organism=Schmidtea mediterranea sexual|type=transcript|length=2978bp
TATTCTTTTAAAAATCAAGGTTAATCGTGCGATTTGTCGCCAAACCATAA
AACTATGAAATATTTGTTGATAAGTTGTCTTGTAATTTCGATTGTTTGTG
TCGTGTCAAGTCAATATTATAAACGATGCAGAAGATTTCAATTTCTTTGC
CAGAATGGAAAGTGTATTCCAGAAACACTGCATTGTGATGGACATGATAA
TTGTGGAGACAATTCCGATGAGATCTGCGATCATCGTGAAACATTTACTT
GCAGTGACTCCAATATCATTCTGAAAACTGAGCTGTGTGATGGCAAAGCC
GATTGTGACAATGATGAAGACCCTAAAATTTGCGTAAAAAATAAATGTTC
CATTGATCAGTTCATGTGTCGGACGAAGCCTATGAATTGCATCTCAAAGA
CATCATTGTGCAACCATAACAATGATTGTAGCGATGGGTCAGATGAATCT
CCAGAAGCTTGTGAAATCATCAACAAGCCACTTGTGGTTCAATGTGATAA
TTCCATACATTTTCAATGTGAAAACAAGCAACTCTGTATATCTCGCATTT
ACTATTGTGACGGAAAATCAGATTGTTCCGATCAGAGTGATGAAAAAAAT
TGTCCAGATTCTGAAAATTCCAAATCCAAATCTCAATCTCTAGCGGATTT
AGTGAAACAATCAACAATATGTCAAAATAATGAATTTTATTGTGGAGCTG
GCTCTACTGTACCCTGCATAGCCAAGGAGTGGCGCTGTGATGGTTCATAT
GACTGTCCGGAAACCTACAAGGATGAATTGAATTGTTCCAATTTCGAATG
CTCTCCTGATAAACCGAACAGGTGCAAAACTATTGATTCCTGTTATGACA
ATGATCAACGTTGTGATGGATATCCGGATTGCACAGATAATTCGGACGAG
GAATTTTGCAGTAACCCCTCGCAACATAATGTCAGTTGTGATCCATTTAA
TGAGTTCAAATGTGTCAAAAACAATACCTGTATTGCATTTCAAAGGGTTT
GTGATAAAACTAACGACTGTGGTGATGGATCGGATGAACGGCCTGGTGGT
AAATCAGAAAATTGTGACAAGAATCTCTGCAAAATAAATAATGGTAACTG
TGAGCAGAAATGTATAAATTTCTATTCACATCGAAAATGTTTGTGTAAAC
CGGGCTACCGCATTGATTCAATCAACGAGACGAAGTGCATAGACATAGAT
GAATGTGCTGACCATATGGTTTGCTCACACAAATGTGCGAATTATTTGGG
ATCTTACAAATGTGAATGTTTTGAAGGCTTCTATATGAGTAAAGACAATA
AGCAATGCCTGGCAGTCGGAGAGAAATTCCTTCTCTATTCCACTAAAAAT
TCGATTCGAGAATTGAGATTGCTTCGACACTATATGGACATGCTCTACAG
CCCCAAAAACCCCACTTCCAATTTCTTGCCCATTGGTATAGATTTCGATT
ACAAATCAAAAAATATATTTTGGACTCAGTTTGAACCGAATCCAGAAATA
GTTCAAATCGACCATTTGGTTTCCAAAACTGGCAACATGAAGCCCCGAAC
CCTGGTTTATAGTAGAATTCATTCACCGGTCGGCCTGGCGTACGATTGGA
TACATGGGCTTCTGTTTTGGAGCGATATTCATTTCAATGAGATCTCAGTT
CTTAATATTACTAATGGCATGCGAAAGACCCTTGTCAGACTCGGCAATCA
TTCGAAGGTTAGGTCGATTGTCGTTCATCCGAAATACAGGCGAATTTTTT
GGACGGATTGGGGCAAAGAACCGAAGATCGAATGTATGGGAATGGATGGA
CAGGACAGGAAAGTTCTTATCAAAGATGGACTCTGGACTCCAAATGGATT
GGCTTTGGATTATTATTTTGATGACCTTTATTGGGTTGATGCTAAAACTC
GAAAGATCAGTGTTTATAATTTAAAAACGTTTCAACGGAGAGATGTTGTT
AGTCACTTAAATGCCCACGGATTTGACATAGATGTCTTTGAAGATTGGCT
TTATCTTAGCGATTGGGATAACGAGAAAATCATTCAAATACACAAGAAAA
CCGGCAAGCAAAAGATTTTGGTTTCATCACCTAAGCCGATGGGAGTAAAG
TTATTTCACCAGTTAGCCCAACCTGTAAATATTGAAAATGCCTGCATCAA
CCATACGTGTCAATATCTCTGTTTACCAACCTCTATGAATTTGGAAAACT
ATATAAAATTCCGATGCATTTGTCCGGATTTTTCATATTTATTGAATGAC
GGAAAGACATGTTCGCCCACTAAATCAGAGTTCTTCCGTAAGACTATTTC
CGTATCCAGCTCTTCTTTGAAACCGAAACAAAGCCGAGTCAATGTTTATT
TGATAGTGGGGCTTGTAATTACCATTGTTCTGTTGATTTCCCTTGTGTTG
GTCGGGCTTGGCATTGCCATGTATCGGAATTACATTCGTCGAGTCATTAA
ACGGGCGACTAACTTCAACAACCCGACTTATTATCAGCACAAAAACTCCA
ACTTAGAGATACAGTTATTTAATGAAGACCCAGTGATGTCAGATATCTAT
GATCAACTACCCGATTCCTCACATGCTAATAGCTTAATACCTCAAAATCA
ATCTGACGGTGGTCTCCAAATGGTGGCGACCAACTGAAATTGTACCCGTT
GAAAGGTGATAAATATATTTTTGTGAATTTTTGGTCAAACGCCGAAATTT
TTATTTCATGATTCCAAATCTTCTCCCGTAATATTTATGAAGCAATCAGG
CGTATCCAGAATGCGTTGATTCGAAATTGAAAGGGTAAAGTGCAGCAATG
TGTGTGTGCATGTTTAGTATTGTTTTTGTATCAATATTTTGTTATATTTA
TTGTTTTAGTTATTATTTAATAATAATATATTATTATTATTTATGAAATA
ATACATTTTTTCTGTGTTTTGATAATATTTTCAATGTATTTTGATGTGTA
AATAAATTGATAGTGATTTTGTTTAAAT
back to top

protein sequence of SMED30016312-orf-1

>SMED30016312-orf-1 ID=SMED30016312-orf-1|Name=SMED30016312-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=861bp
MKYLLISCLVISIVCVVSSQYYKRCRRFQFLCQNGKCIPETLHCDGHDNC
GDNSDEICDHRETFTCSDSNIILKTELCDGKADCDNDEDPKICVKNKCSI
DQFMCRTKPMNCISKTSLCNHNNDCSDGSDESPEACEIINKPLVVQCDNS
IHFQCENKQLCISRIYYCDGKSDCSDQSDEKNCPDSENSKSKSQSLADLV
KQSTICQNNEFYCGAGSTVPCIAKEWRCDGSYDCPETYKDELNCSNFECS
PDKPNRCKTIDSCYDNDQRCDGYPDCTDNSDEEFCSNPSQHNVSCDPFNE
FKCVKNNTCIAFQRVCDKTNDCGDGSDERPGGKSENCDKNLCKINNGNCE
QKCINFYSHRKCLCKPGYRIDSINETKCIDIDECADHMVCSHKCANYLGS
YKCECFEGFYMSKDNKQCLAVGEKFLLYSTKNSIRELRLLRHYMDMLYSP
KNPTSNFLPIGIDFDYKSKNIFWTQFEPNPEIVQIDHLVSKTGNMKPRTL
VYSRIHSPVGLAYDWIHGLLFWSDIHFNEISVLNITNGMRKTLVRLGNHS
KVRSIVVHPKYRRIFWTDWGKEPKIECMGMDGQDRKVLIKDGLWTPNGLA
LDYYFDDLYWVDAKTRKISVYNLKTFQRRDVVSHLNAHGFDIDVFEDWLY
LSDWDNEKIIQIHKKTGKQKILVSSPKPMGVKLFHQLAQPVNIENACINH
TCQYLCLPTSMNLENYIKFRCICPDFSYLLNDGKTCSPTKSEFFRKTISV
SSSSLKPKQSRVNVYLIVGLVITIVLLISLVLVGLGIAMYRNYIRRVIKR
ATNFNNPTYYQHKNSNLEIQLFNEDPVMSDIYDQLPDSSHANSLIPQNQS
DGGLQMVATN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR001881EGF-like_Ca-bd_dom
IPR000742EGF-like_dom
IPR000033LDLR_classB_rpt
IPR0110426-blade_b-propeller_TolB-like
IPR018097EGF_Ca-bd_CS
IPR023415LDLR_class-A_CS
IPR000152EGF-type_Asp/Asn_hydroxyl_site
IPR013032EGF-like_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0005764lysosome
GO:0005768endosome
GO:0005769early endosome
GO:0005770late endosome
GO:0005794Golgi apparatus
GO:0005886plasma membrane
GO:0005905clathrin-coated pit
GO:0009986cell surface
GO:0016020membrane
GO:0016021integral component of membrane
GO:0034362low-density lipoprotein particle
Vocabulary: biological process
TermDefinition
GO:0006629lipid metabolic process
GO:0006810transport
GO:0006869lipid transport
GO:0006897endocytosis
GO:0008202steroid metabolic process
GO:0008203cholesterol metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPRINTSPR00261LDLRECEPTORcoord: 159..180
score: 46.01
coord: 35..56
score: 51.22
coord: 69..90
score: 31.82
coord: 219..240
score: 31.37
coord: 261..282
score: 43.68
coord: 307..328
score: 50.33
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 97..138
e-value: 5.1E-10
score: 49.3
coord: 146..185
e-value: 3.7E-10
score: 49.7
coord: 205..246
e-value: 1.0E-6
score: 38.3
coord: 61..95
e-value: 0.69
score: 5.5
coord: 24..60
e-value: 1.8E-10
score: 50.8
coord: 248..287
e-value: 2.5E-4
score: 30.4
coord: 294..339
e-value: 3.9E-8
score: 43.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPFAMPF00057Ldl_recept_acoord: 206..244
e-value: 1.7E-8
score: 34.5
coord: 97..136
e-value: 3.5E-7
score: 30.3
coord: 294..329
e-value: 1.9E-7
score: 31.2
coord: 146..183
e-value: 3.6E-9
score: 36.7
coord: 23..56
e-value: 6.7E-9
score: 35.8
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 205..245
score: 10.012
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 24..59
score: 12.65
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 57..94
score: 8.788
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 97..137
score: 11.863
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 248..286
score: 11.125
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 146..184
score: 12.85
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 294..338
score: 12.038
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 295..329
e-value: 6.42258E-6
score: 41.4234
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 206..244
e-value: 7.41443E-5
score: 38.727
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 152..183
e-value: 6.99278E-7
score: 44.1198
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 256..285
e-value: 9.20482E-5
score: 38.3418
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 98..131
e-value: 1.80101E-5
score: 40.2678
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 25..56
e-value: 2.78721E-9
score: 51.0534
IPR001881EGF-like calcium-binding domainSMARTSM00179egfca_6coord: 338..379
e-value: 0.027
score: 14.5
coord: 380..419
e-value: 3.0E-9
score: 46.7
IPR001881EGF-like calcium-binding domainPFAMPF07645EGF_CAcoord: 380..418
e-value: 7.9E-7
score: 29.2
IPR000742EGF-like domainSMARTSM00181egf_5coord: 696..737
e-value: 29.0
score: 10.7
coord: 341..379
e-value: 2.7
score: 17.0
coord: 383..419
e-value: 0.0049
score: 26.1
IPR000033LDLR class B repeatSMARTSM00135LY_2coord: 629..670
e-value: 1.4
score: 17.2
coord: 586..628
e-value: 2.0E-8
score: 44.0
coord: 498..540
e-value: 2.6E-8
score: 43.6
coord: 541..585
e-value: 4.6E-11
score: 52.8
IPR000033LDLR class B repeatPFAMPF00058Ldl_recept_bcoord: 562..603
e-value: 1.8E-10
score: 41.1
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 606..648
score: 7.766
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 518..561
score: 8.439
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 562..605
score: 16.027
IPR000033LDLR class B repeatPROSITEPS51120LDLRBcoord: 469..517
score: 7.07
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 386..421
e-value: 7.3E-12
score: 47.2
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 341..385
e-value: 7.3E-10
score: 40.7
NoneNo IPR availablePANTHERPTHR24270:SF21LOW-DENSITY LIPOPROTEIN RECEPTORcoord: 18..743
NoneNo IPR availablePANTHERPTHR24270FAMILY NOT NAMEDcoord: 18..743
NoneNo IPR availableCDDcd00054EGF_CAcoord: 380..410
e-value: 2.30407E-4
score: 37.231
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.822
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 342..388
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 378..425
NoneNo IPR availableSUPERFAMILYSSF63825YWTD domaincoord: 426..687
NoneNo IPR availableTMHMMTMhelixcoord: 764..786
NoneNo IPR availableTMHMMTMhelixcoord: 3..22
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 291..330
e-value: 3.0E-9
score: 38.9
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 248..290
e-value: 1.1E-5
score: 27.1
coord: 142..188
e-value: 4.0E-11
score: 44.5
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 103..137
e-value: 1.2E-8
score: 36.7
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 22..59
e-value: 3.0E-11
score: 44.9
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 60..102
e-value: 9.8E-6
score: 27.6
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 205..247
e-value: 2.6E-10
score: 41.8
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 203..245
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 21..57
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 298..329
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 91..133
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 149..183
IPR011042Six-bladed beta-propeller, TolB-likeGENE3DG3DSA:2.120.10.30coord: 422..738
e-value: 3.1E-81
score: 275.0
IPR013032EGF-like, conserved sitePROSITEPS01186EGF_2coord: 403..418
IPR018097EGF-like calcium-binding, conserved sitePROSITEPS01187EGF_CAcoord: 380..403
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 161..183
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 37..58
IPR000152EGF-type aspartate/asparagine hydroxylation sitePROSITEPS00010ASX_HYDROXYLcoord: 394..405