NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial

Overview
NameNADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
Smed IDSMED30016302
Length (bp)3363
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (SMED30016302) t-SNE clustered cells

Violin plots show distribution of expression levels for NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (SMED30016302) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (SMED30016302) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (SMED30016302) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016302

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016302SMESG000081864.1 dd_Smed_v4_2402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016302SMESG000081864.1 dd_Smed_v4_2402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016302SMESG000081864.1 dd_Smed_v4_2402_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016302SMESG000081864.1 Contig35498newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016302SMESG000081864.1 Contig35498uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Match: NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:HGNC Symbol;Acc:HGNC:7707])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  163 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 683          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Match: NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:HGNC Symbol;Acc:HGNC:7707])

HSP 1 Score: 610.527 bits (1573), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  163 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 683          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Match: NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:HGNC Symbol;Acc:HGNC:7707])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Match: NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:HGNC Symbol;Acc:HGNC:7707])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  213 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 733          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Match: NDUFS1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:HGNC Symbol;Acc:HGNC:7707])

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Celegans
Match: nuo-5 (NADH Ubiquinone Oxidoreductase [Source:UniProtKB/TrEMBL;Acc:Q9N4Y8])

HSP 1 Score: 477.248 bits (1227), Expect = 4.656e-154
Identity = 256/516 (49.61%), Postives = 357/516 (69.19%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAG-IDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQT-QLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDS 3293
            +GTY+EK F SELSGN+ID+CPVGALTSK YAFTARPWETR   ++DVMD  GSNIV+S RT E++R+IP++N++INEEWI D+SRF+ DGLK QRLL PMI+ +   L   T W      + +   +  +    AAV G   D ESL ALKDL N  NS+ ++TEE FP  G+G  D RSNY+FN  I+ +E AD +L+VG NPRFEA  LN RIRKS++++++ VG+IG++ +LTY+Y+YLG  A  I E+  G   F K L +A  PLIIVG++ L+ +  +A+L  L  L+ KL S     K  K+ ++LQR+A Q  ALD+GY+     I +   K +Y++GADEG + +  L     ++YQGHHGD GA++AD++LPGA YTEK GTYVNTEGR+Q    AV+ PG++R DWKIIRA+ E+ G +LPYS+L E+R R+ EI+P+L +Y   E + F K+A ++A+   +  +D +P+   +++L D+Y T+ ISR SR+MA+  KA I++
Sbjct:  209 IGTYVEKFFASELSGNIIDICPVGALTSKQYAFTARPWETRKTESVDVMDATGSNIVLSHRTGELLRVIPKINDDINEEWIGDQSRFAVDGLKVQRLLTPMIRGADGQLKPAT-WEEALFTVAAKLRETPAEQK-AAVAGGLNDVESLVALKDLFNRFNSENVMTEEEFPDVGSGGSDLRSNYVFNDGIASVENADAILLVGTNPRFEAPTLNARIRKSFLYSDVQVGVIGAETELTYEYDYLGASAKAIDEILAGKGDFAKILSSATTPLIIVGAQALKGEAGAALLGKLQQLADKLGSG----KEVKVLNVLQRWAGQAGALDVGYKAGTAGIRKTPIKFLYLLGADEGKVTKANLDPSAFVVYQGHHGDAGAEMADVVLPGAAYTEKEGTYVNTEGRSQRAYPAVSPPGDARVDWKIIRAVSEVSGKSLPYSDLKEIRQRLNEIAPHLVRYRDLEASPFVKQALQLAQPTGSIDVDVSPV---LRELSDYYQTNVISRYSRSMAQARKAAIEN 715          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Fly
Match: ND-75 (gene:FBgn0017566 transcript:FBtr0071180)

HSP 1 Score: 499.204 bits (1284), Expect = 2.016e-162
Identity = 261/518 (50.39%), Postives = 356/518 (68.73%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAV 3284
            G  N   +GTY+EKLF +ELSGNVIDLCPVGALT+KPY+F ARPWE R V++IDV+D +GSNIVVS RTNEV+RI+PR NE++NEEW+ DKSRF+ DGLKRQRL+ PM++      L    W      +            IA + G+  D E+  ALKDLLN L S+++ TE+ F     G D R+NY+ NS I+G+EEAD +L+VG NPR+EA ++NTR+RK+++HNEL +  IG K+DL+YD+E LG  A ++K++  G+HAF K L+ AK+P II+G++ L+R D +AI   ++    KLK       NW  F++LQ  A+QV ALD+GY+       +AQPK+++++ AD G + RE+LP DC ++Y G HGDNGA IAD +LPGA YTEK G YVNTEGR Q+T   V+ PG +REDWKI+RAL E+ G  LPY NL ELR+R+ +++P+LT+    E A     A  ++K I        I   +++L+D+++TD+ISRAS TMAKC  AV
Sbjct:  213 GRGNDMQIGTYVEKLFLTELSGNVIDLCPVGALTNKPYSFVARPWEIRKVSSIDVLDAVGSNIVVSTRTNEVLRILPRENEDVNEEWLADKSRFACDGLKRQRLVAPMVR-MPNGELQAVEWEGALIAVAKAIKAAGG--QIAGISGQLADLEAQVALKDLLNRLGSEVVATEQGF--IAGGTDNRANYLLNSTIAGLEEADAVLLVGTNPRYEAPLVNTRLRKAYVHNELQIASIGPKIDLSYDHENLGADAALVKDVCSGAHAFSKVLEGAKKPAIIIGADLLERADGAAIHATVAEYCKKLKK-----PNWNPFNVLQTNAAQVGALDVGYKAGAQTAVKAQPKVLFLLNADAGKVTREQLPKDCFVVYIGSHGDNGASIADAVLPGAAYTEKQGIYVNTEGRPQQTLPGVSPPGMAREDWKILRALSEVVGKPLPYDNLDELRNRLEDVAPHLTRLGQLEPAGDAGAAGTISKSI----GGGAIDIKLKELRDYFMTDAISRASPTMAKCISAV 716          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Fly
Match: ND-75 (gene:FBgn0017566 transcript:FBtr0071181)

HSP 1 Score: 499.204 bits (1284), Expect = 2.016e-162
Identity = 261/518 (50.39%), Postives = 356/518 (68.73%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAV 3284
            G  N   +GTY+EKLF +ELSGNVIDLCPVGALT+KPY+F ARPWE R V++IDV+D +GSNIVVS RTNEV+RI+PR NE++NEEW+ DKSRF+ DGLKRQRL+ PM++      L    W      +            IA + G+  D E+  ALKDLLN L S+++ TE+ F     G D R+NY+ NS I+G+EEAD +L+VG NPR+EA ++NTR+RK+++HNEL +  IG K+DL+YD+E LG  A ++K++  G+HAF K L+ AK+P II+G++ L+R D +AI   ++    KLK       NW  F++LQ  A+QV ALD+GY+       +AQPK+++++ AD G + RE+LP DC ++Y G HGDNGA IAD +LPGA YTEK G YVNTEGR Q+T   V+ PG +REDWKI+RAL E+ G  LPY NL ELR+R+ +++P+LT+    E A     A  ++K I        I   +++L+D+++TD+ISRAS TMAKC  AV
Sbjct:  213 GRGNDMQIGTYVEKLFLTELSGNVIDLCPVGALTNKPYSFVARPWEIRKVSSIDVLDAVGSNIVVSTRTNEVLRILPRENEDVNEEWLADKSRFACDGLKRQRLVAPMVR-MPNGELQAVEWEGALIAVAKAIKAAGG--QIAGISGQLADLEAQVALKDLLNRLGSEVVATEQGF--IAGGTDNRANYLLNSTIAGLEEADAVLLVGTNPRYEAPLVNTRLRKAYVHNELQIASIGPKIDLSYDHENLGADAALVKDVCSGAHAFSKVLEGAKKPAIIIGADLLERADGAAIHATVAEYCKKLKK-----PNWNPFNVLQTNAAQVGALDVGYKAGAQTAVKAQPKVLFLLNADAGKVTREQLPKDCFVVYIGSHGDNGASIADAVLPGAAYTEKQGIYVNTEGRPQQTLPGVSPPGMAREDWKILRALSEVVGKPLPYDNLDELRNRLEDVAPHLTRLGQLEPAGDAGAAGTISKSI----GGGAIDIKLKELRDYFMTDAISRASPTMAKCISAV 716          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Zebrafish
Match: ino80db (INO80 complex subunit Db [Source:NCBI gene;Acc:563304])

HSP 1 Score: 599.742 bits (1545), Expect = 0.000e+0
Identity = 292/520 (56.15%), Postives = 390/520 (75.00%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVID 3290
            G  N   +GTY+EK+F SELSGN+IDLCPVGALTSKPYAFTARPWETR   +IDV+D +GSNIVVS R+ EVMRI+PR+NE++NEEWI+DK+RF+YDGLKRQRL  PM++D+   L++ T W  V   +      +   ++I A+ G   DAE+L ALKDLLN L+S+ L TEE FPM GAG D RSNY+ NS+I+GIEE DLLL++G NPR+EA + N RIRKSW+HNEL V ++G  VDL+Y Y +LG+   ++++++ G+H F K L  AK+P+++VGS  LQR D +AILK +S ++   +++S V + WK+ ++L R ASQVAALDLGY+P V+ I +  PK+++++GAD G + R  LP D  I+YQGHHGD GA IAD+ILPGA YTEK+GTYVNTEGR Q+T VAVT PG +REDWKI+RA+ E+ G+ LPY  L E+R R+ E+SPNL +Y+  EEAN+ K+A+E++  +   L + P+V     ++DFY+TD ISRAS TMAKC KAV +
Sbjct:  238 GRGNDMQIGTYVEKMFMSELSGNIIDLCPVGALTSKPYAFTARPWETRKTESIDVLDAVGSNIVVSTRSGEVMRILPRMNEDVNEEWISDKTRFAYDGLKRQRLTQPMVRDASGQLVS-TTWEDVLTRVAGALQGVKG-SEIGAIAGGMVDAEALVALKDLLNKLDSESLCTEEIFPMAGAGSDLRSNYLLNSRITGIEECDLLLLIGTNPRYEAPLFNARIRKSWLHNELQVAMVGHDVDLSYSYNHLGETTQVLQDIAAGTHPFCKDLGQAKKPIVVVGSSALQRDDGAAILKAVSTIAQNARASSGVEEGWKVLNVLHRVASQVAALDLGYKPGVDAIRKNPPKVLFLLGADAGCITRADLPKDSFIVYQGHHGDVGAPIADVILPGAAYTEKFGTYVNTEGRAQQTRVAVTAPGMAREDWKILRAVSELVGVTLPYDTLDEVRRRLAEVSPNLVRYDDVEEANYFKQAHELSNAVNQSLLAAPLVPPQLTVKDFYMTDPISRASPTMAKCVKAVTE 755          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Zebrafish
Match: ino80db (INO80 complex subunit Db [Source:NCBI gene;Acc:563304])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 292/520 (56.15%), Postives = 390/520 (75.00%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVID 3290
            G  N   +GTY+EK+F SELSGN+IDLCPVGALTSKPYAFTARPWETR   +IDV+D +GSNIVVS R+ EVMRI+PR+NE++NEEWI+DK+RF+YDGLKRQRL  PM++D+   L++ T W  V   +      +   ++I A+ G   DAE+L ALKDLLN L+S+ L TEE FPM GAG D RSNY+ NS+I+GIEE DLLL++G NPR+EA + N RIRKSW+HNEL V ++G  VDL+Y Y +LG+   ++++++ G+H F K L  AK+P+++VGS  LQR D +AILK +S ++   +++S V + WK+ ++L R ASQVAALDLGY+P V+ I +  PK+++++GAD G + R  LP D  I+YQGHHGD GA IAD+ILPGA YTEK+GTYVNTEGR Q+T VAVT PG +REDWKI+RA+ E+ G+ LPY  L E+R R+ E+SPNL +Y+  EEAN+ K+A+E++  +   L + P+V     ++DFY+TD ISRAS TMAKC KAV +
Sbjct:  203 GRGNDMQIGTYVEKMFMSELSGNIIDLCPVGALTSKPYAFTARPWETRKTESIDVLDAVGSNIVVSTRSGEVMRILPRMNEDVNEEWISDKTRFAYDGLKRQRLTQPMVRDASGQLVS-TTWEDVLTRVAGALQGVKG-SEIGAIAGGMVDAEALVALKDLLNKLDSESLCTEEIFPMAGAGSDLRSNYLLNSRITGIEECDLLLLIGTNPRYEAPLFNARIRKSWLHNELQVAMVGHDVDLSYSYNHLGETTQVLQDIAAGTHPFCKDLGQAKKPIVVVGSSALQRDDGAAILKAVSTIAQNARASSGVEEGWKVLNVLHRVASQVAALDLGYKPGVDAIRKNPPKVLFLLGADAGCITRADLPKDSFIVYQGHHGDVGAPIADVILPGAAYTEKFGTYVNTEGRAQQTRVAVTAPGMAREDWKILRAVSELVGVTLPYDTLDEVRRRLAEVSPNLVRYDDVEEANYFKQAHELSNAVNQSLLAAPLVPPQLTVKDFYMTDPISRASPTMAKCVKAVTE 720          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Zebrafish
Match: ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:ZFIN;Acc:ZDB-GENE-030131-478])

HSP 1 Score: 599.356 bits (1544), Expect = 0.000e+0
Identity = 292/520 (56.15%), Postives = 390/520 (75.00%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVID 3290
            G  N   +GTY+EK+F SELSGN+IDLCPVGALTSKPYAFTARPWETR   +IDV+D +GSNIVVS R+ EVMRI+PR+NE++NEEWI+DK+RF+YDGLKRQRL  PM++D+   L++ T W  V   +      +   ++I A+ G   DAE+L ALKDLLN L+S+ L TEE FPM GAG D RSNY+ NS+I+GIEE DLLL++G NPR+EA + N RIRKSW+HNEL V ++G  VDL+Y Y +LG+   ++++++ G+H F K L  AK+P+++VGS  LQR D +AILK +S ++   +++S V + WK+ ++L R ASQVAALDLGY+P V+ I +  PK+++++GAD G + R  LP D  I+YQGHHGD GA IAD+ILPGA YTEK+GTYVNTEGR Q+T VAVT PG +REDWKI+RA+ E+ G+ LPY  L E+R R+ E+SPNL +Y+  EEAN+ K+A+E++  +   L + P+V     ++DFY+TD ISRAS TMAKC KAV +
Sbjct:  203 GRGNDMQIGTYVEKMFMSELSGNIIDLCPVGALTSKPYAFTARPWETRKTESIDVLDAVGSNIVVSTRSGEVMRILPRMNEDVNEEWISDKTRFAYDGLKRQRLTQPMVRDASGQLVS-TTWEDVLTRVAGALQGVKG-SEIGAIAGGMVDAEALVALKDLLNKLDSESLCTEEIFPMAGAGSDLRSNYLLNSRITGIEECDLLLLIGTNPRYEAPLFNARIRKSWLHNELQVAMVGHDVDLSYSYNHLGETTQVLQDIAAGTHPFCKDLGQAKKPIVVVGSSALQRDDGAAILKAVSTIAQNARASSGVEEGWKVLNVLHRVASQVAALDLGYKPGVDAIRKNPPKVLFLLGADAGCITRADLPKDSFIVYQGHHGDVGAPIADVILPGAAYTEKFGTYVNTEGRAQQTRVAVTAPGMAREDWKILRAVSELVGVTLPYDTLDEVRRRLAEVSPNLVRYDDVEEANYFKQAHELSNAVNQSLLAAPLVPPQLTVKDFYMTDPISRASPTMAKCVKAVTE 720          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Xenopus
Match: znf33b (zinc finger protein 33B [Source:Xenbase;Acc:XB-GENE-5846794])

HSP 1 Score: 612.453 bits (1578), Expect = 0.000e+0
Identity = 306/523 (58.51%), Postives = 395/523 (75.53%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTY+EK+F SELSGNVIDLCPVGALTSKPYAFTARPWETR   +IDV+D LGSNIVVS R  EVMRI+P+++E+INEEWI+DK+RF+YDGLKRQRL  PMI+D K +L+  T+W  V   +      +    D+AA+ G   DAE+L ALKDLLN LNSD L TEE FP  GAG D RSNY+ NS+ISGIEEAD+LL+VG NPR+EA + N RIRKSW+HN+L VGLIGS VDLTY Y++LG+   I+KE++ G H F K+L  AK+P+++VGS  LQR+D +AI   +S ++   +S+S V ++WK+ +IL R ASQVAALDLGY+P V+ I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q T VAVT PG +REDW+IIRA+ E+ G+ LPY +   +R+R+ E+SPNL +Y+  E AN+ K+A E+AKL+  Q+ + P+V     ++DFY+TD I+RAS+TMAKC KAV +  +
Sbjct:  208 GRGNDMQVGTYVEKMFMSELSGNVIDLCPVGALTSKPYAFTARPWETRKTESIDVLDALGSNIVVSTRGGEVMRILPKMHEDINEEWISDKTRFAYDGLKRQRLTQPMIRDEKGHLV-HTSWEDVLARVAGVLQGVQG-KDVAAIAGGLVDAEALVALKDLLNRLNSDTLCTEEVFPTSGAGTDLRSNYLLNSRISGIEEADVLLLVGTNPRYEAPLFNARIRKSWLHNDLQVGLIGSSVDLTYTYDHLGESPQILKEIASGKHPFSKKLFQAKKPIVVVGSSALQRKDGTAIHAAVSTIAQNARSSSGVTEDWKVLNILHRVASQVAALDLGYKPGVDAIRKNPPKVLFLLGADAGCITRQDLPKDCFIIYQGHHGDAGAPMADVILPGAAYTEKSATYVNTEGRAQRTFVAVTPPGMAREDWRIIRAISELAGVTLPYEDHDGVRERLQEVSPNLVRYDDVEGANYFKQATELAKLVSQQILADPLVPPQLTIKDFYMTDPITRASQTMAKCVKAVTEGAQ 728          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Xenopus
Match: znf33b (zinc finger protein 33B [Source:Xenbase;Acc:XB-GENE-5846794])

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 304/523 (58.13%), Postives = 393/523 (75.14%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTY+EK+F SELSGNVIDLCPVGALTSKPYAFTARPWETR   +IDV+D LGSNIVVS R  EVMRI+P+++E+INEEWI+DK+RF+YDGLKRQRL  PMI+D K +L+  T+W  V   +      +    D+AA+ G   DAE+L ALKDLLN LNSD L TEE FP  GAG D RSNY+ NS+ISGIEEAD+LL+VG NPR+EA + N RIRKSW+HN+L VGLIGS VDLTY Y++LG+   I+KE++ G H F K+L  AK+P+++VGS  LQR+D +AI   +S ++   +S+S V ++WK+ +IL R ASQVAALDLGY+P V+ I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q T VAVT PG +REDW+IIRA+ E+ G+ LPY +   +R+R+ E+SPNL +Y+  E AN+ K+A E+  L+  Q+ + P+V     ++DFY+TD I+RAS+TMAKC KAV +  +
Sbjct:  205 GRGNDMQVGTYVEKMFMSELSGNVIDLCPVGALTSKPYAFTARPWETRKTESIDVLDALGSNIVVSTRGGEVMRILPKMHEDINEEWISDKTRFAYDGLKRQRLTQPMIRDEKGHLV-HTSWEDVLARVAGVLQGVQG-KDVAAIAGGLVDAEALVALKDLLNRLNSDTLCTEEVFPTSGAGTDLRSNYLLNSRISGIEEADVLLLVGTNPRYEAPLFNARIRKSWLHNDLQVGLIGSSVDLTYTYDHLGESPQILKEIASGKHPFSKKLFQAKKPIVVVGSSALQRKDGTAIHAAVSTIAQNARSSSGVTEDWKVLNILHRVASQVAALDLGYKPGVDAIRKNPPKVLFLLGADAGCITRQDLPKDCFIIYQGHHGDAGAPMADVILPGAAYTEKSATYVNTEGRAQRTFVAVTPPGMAREDWRIIRAISELAGVTLPYEDHDGVRERLQEVSPNLVRYDDVEGANYFKQATEL--LVSQQILADPLVPPQLTIKDFYMTDPITRASQTMAKCVKAVTEGAQ 723          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Mouse
Match: Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:MGI Symbol;Acc:MGI:2443241])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 302/523 (57.74%), Postives = 392/523 (74.95%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGNVID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +            +AA+ G   DAE+L ALKDLLN ++SD L TEE FP EGAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ G H+F + L+ AK+P++++GS  LQR D +AIL  +S +  K++  + V   WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC I+YQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI GI LPY  L ++R+R+ E+SPNL +Y+  EE N+ ++A E+AKL+  ++ + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQNFEG-NAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Mouse
Match: Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:MGI Symbol;Acc:MGI:2443241])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 302/523 (57.74%), Postives = 392/523 (74.95%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGNVID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +            +AA+ G   DAE+L ALKDLLN ++SD L TEE FP EGAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ G H+F + L+ AK+P++++GS  LQR D +AIL  +S +  K++  + V   WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC I+YQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI GI LPY  L ++R+R+ E+SPNL +Y+  EE N+ ++A E+AKL+  ++ + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQNFEG-NAVAAIAGGLVDAEALVALKDLLNKVDSDNLCTEEIFPTEGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGRHSFCEVLKDAKKPMVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPMADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Mouse
Match: Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:MGI Symbol;Acc:MGI:2443241])

HSP 1 Score: 52.7582 bits (125), Expect = 2.531e-8
Identity = 22/57 (38.60%), Postives = 41/57 (71.93%), Query Frame = 3
Query: 3063 ELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYIT 3233
            ++R+R+ E+SPNL +Y+  EE N+ ++A E+AKL+  ++ + P+V     ++DFY+T
Sbjct:    2 QVRNRLEEVSPNLVRYDDIEETNYFQQASELAKLVNQEVLADPLVPPQLTIKDFYMT 58          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Mouse
Match: Ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:MGI Symbol;Acc:MGI:2443241])

HSP 1 Score: 51.9878 bits (123), Expect = 4.142e-8
Identity = 29/60 (48.33%), Postives = 42/60 (70.00%), Query Frame = 3
Query: 2559 LIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRP 2738
            ++++GS  LQR D +AIL  +S +  K++  + V   WK+ +IL R ASQVAALDLGY+P
Sbjct:    1 MVVLGSSALQRDDGAAILVAVSNMVQKIRVTTGVAAEWKVMNILHRIASQVAALDLGYKP 60          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|P15690|NDUS1_BOVIN (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Bos taurus OX=9913 GN=NDUFS1 PE=1 SV=1)

HSP 1 Score: 611.683 bits (1576), Expect = 0.000e+0
Identity = 309/529 (58.41%), Postives = 397/529 (75.05%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 3317
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + LQ AK+P++I+GS  LQR D +AIL  +S ++ K++++S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC I+YQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +      HAV
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTHTTWEDALSRVAGMLQSFQG-NDVAAIAGGLVDAEALIALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLQEAKKPMVILGSSALQRNDGAAILAAVSNIAQKIRTSSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIQKNPPKMLFLLGADGGCITRQDLPKDCFIVYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVEGANYFQQASELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGA----HAV 721          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|P28331|NDUS1_HUMAN (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS1 PE=1 SV=3)

HSP 1 Score: 609.372 bits (1570), Expect = 0.000e+0
Identity = 305/523 (58.32%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|P0CB68|NDUS1_PONPY (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pongo pygmaeus OX=9600 GN=NDUFS1 PE=2 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 304/523 (58.13%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  P++++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARIRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPRLLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGVTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|Q0MQG2|NDUS1_PANTR (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Pan troglodytes OX=9598 GN=NDUFS1 PE=2 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 304/523 (58.13%), Postives = 394/523 (75.33%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PM+++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFEA + N R+RKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI G+ LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMVRNEK-GLLTYTSWEDALSRVAGMLQTFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEAPLFNARLRKSWLHNDLKVALIGSPVDLTYTYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Match: sp|Q4R6K9|NDUS1_MACFA (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Macaca fascicularis OX=9541 GN=NDUFS1 PE=2 SV=1)

HSP 1 Score: 608.601 bits (1568), Expect = 0.000e+0
Identity = 306/523 (58.51%), Postives = 393/523 (75.14%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   VGTYIEK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR   +IDVMD +GSNIVVS RT EVMRI+PR++E+INEEWI+DK+RF+YDGLKRQRL  PMI++ K  LLT T+W      +           D+AA+ G   DAE+L ALKDLLN ++SD L TEE FP  GAG D RSNY+ N+ I+G+EEAD++L+VG NPRFE  + N RIRKSW+HN+L V LIGS VDLTY Y++LGD   I+++++ GSH F + L+ AK+P++++GS  LQR D +AIL  +S ++ K++  S V  +WK+ +IL R ASQVAALDLGY+P V  I +  PK+++++GAD G + R+ LP DC IIYQGHHGD GA IAD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRAL EI GI LPY  L ++R+R+ E+SPNL +Y+  E AN+ ++A E++KL+  QL + P+V     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:  199 GRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQRLTEPMIRNEK-GLLTYTSWEDALSRVAGMLQSFQG-KDVAAIAGGLVDAEALVALKDLLNRVDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVVLLVGTNPRFEVPLFNARIRKSWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQDIASGSHPFSQVLKEAKKPMVVLGSSALQRNDGAAILAAVSSIAQKIRMTSGVTGDWKVMNILHRIASQVAALDLGYKPGVEAIRKNPPKVLFLLGADGGCITRQDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTEGRAQQTKVAVTPPGLAREDWKIIRALSEIAGITLPYDTLDQVRNRLEEVSPNLVRYDDIEGANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQ 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Match: R0K082 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial (Fragment) OS=Anas platyrhynchos OX=8839 GN=Anapl_00655 PE=3 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 309/529 (58.41%), Postives = 399/529 (75.43%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 3317
            G  N   VGTY+EK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR V +IDV+D LGSNIVVS RT EVMRI+PRL+E+INEEWI+DK+RF+YDGLKRQRL  PMIK+ K  L    +W  V   +      +    D+AA+VG   DAE+L ALKDLLN +NSD L TEE FP +GAG D RSNY+ N+KI+G+EEAD+LL+VG NPRFEA + N RIRKSW+HN+L V L+GS V+LTY Y++LG+   I+++++ G HAF K L  AK+P+++VGS  LQR D +AI   +S ++   ++ S V  +WK+ +IL R ASQVAALDLG++P V  I +  PK++Y++GAD G + R+ LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDW+IIRA+ E+ G+ LPY NL ++R R+ E+SPNL +Y+  EEAN+ K+A E++KL++ QL + P+V     ++DFY+TDSISRAS+TMAKC KAV++      HAV
Sbjct:  197 GRGNDMQVGTYVEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKVESIDVLDALGSNIVVSTRTGEVMRILPRLHEDINEEWISDKTRFAYDGLKRQRLTQPMIKNEK-GLFVYASWEDVLTRVAGVLQAVEG-KDVAAIVGGLVDAEALIALKDLLNRVNSDTLCTEEIFPTDGAGTDLRSNYLLNTKIAGVEEADVLLLVGTNPRFEAPLFNARIRKSWLHNDLHVALVGSPVNLTYTYDHLGESPQILQDIASGKHAFCKVLDQAKKPVVVVGSAALQRSDGAAIHAAVSTIAQNARTKSGVGSDWKVMNILHRVASQVAALDLGFKPGVEAIRKNPPKVLYLLGADSGCITRQDLPKDCFIIYQGHHGDVGAPMADVILPGAAYTEKAATYVNTEGRAQQTRVAVTPPGMAREDWRIIRAVSEMAGMTLPYENLDQIRKRLEEVSPNLVRYDDVEEANYFKQANELSKLVKQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVVEGA----HAV 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Match: U3I998 (NADH:ubiquinone oxidoreductase core subunit S1 OS=Anas platyrhynchos platyrhynchos OX=8840 GN=NDUFS1 PE=3 SV=2)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 309/529 (58.41%), Postives = 399/529 (75.43%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 3317
            G  N   VGTY+EK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR V +IDV+D LGSNIVVS RT EVMRI+PRL+E+INEEWI+DK+RF+YDGLKRQRL  PMIK+ K  L    +W  V   +      +    D+AA+VG   DAE+L ALKDLLN +NSD L TEE FP +GAG D RSNY+ N+KI+G+EEAD+LL+VG NPRFEA + N RIRKSW+HN+L V L+GS V+LTY Y++LG+   I+++++ G HAF K L  AK+P+++VGS  LQR D +AI   +S ++   ++ S V  +WK+ +IL R ASQVAALDLG++P V  I +  PK++Y++GAD G + R+ LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDW+IIRA+ E+ G+ LPY NL ++R R+ E+SPNL +Y+  EEAN+ K+A E++KL++ QL + P+V     ++DFY+TDSISRAS+TMAKC KAV++      HAV
Sbjct:  197 GRGNDMQVGTYVEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKVESIDVLDALGSNIVVSTRTGEVMRILPRLHEDINEEWISDKTRFAYDGLKRQRLTQPMIKNEK-GLFVYASWEDVLTRVAGVLQAVEG-KDVAAIVGGLVDAEALIALKDLLNRVNSDTLCTEEIFPTDGAGTDLRSNYLLNTKIAGVEEADVLLLVGTNPRFEAPLFNARIRKSWLHNDLHVALVGSPVNLTYTYDHLGESPQILQDIASGKHAFCKVLDQAKKPVVVVGSAALQRSDGAAIHAAVSTIAQNARTKSGVGSDWKVMNILHRVASQVAALDLGFKPGVEAIRKNPPKVLYLLGADSGCITRQDLPKDCFIIYQGHHGDVGAPMADVILPGAAYTEKAATYVNTEGRAQQTRVAVTPPGMAREDWRIIRAVSEMAGMTLPYENLDQIRKRLEEVSPNLVRYDDVEEANYFKQANELSKLVKQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVVEGA----HAV 719          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Match: K1RIT6 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10021398 PE=3 SV=1)

HSP 1 Score: 617.076 bits (1590), Expect = 0.000e+0
Identity = 302/511 (59.10%), Postives = 391/511 (76.52%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAV 3284
            VGTY+EKLF+SELSGNVIDLCPVGALTSKPYAFTARPWETR + ++DV+D +GSNIVVS R+ EVMRI+PR+NEEINEEWI+DK+RF+YDGLKRQRL  P +KD   NL  +T W       +S  N       IA + G   DAESL +LKDLLN L S+ L TEE FPM+GAG D RSNY+ N+ ++ IEEADL+L +G NPRFEA +LNTR+RKSWI+N+L+V L+G+KVDLTYDY++LGD   ++K+L++GSH F K+L  A RP+++VGS  LQR+D  AI   +S ++   +  S   + WK+ ++L R ASQVAALDLGY+  V+ I +  P++++M+GADEGVL R+ LP DC IIYQGHHGD GA +AD++ PGA YTEK GTYVNTEGR QET +AV+ PG +R+DWKIIRAL EI    LPY  + E+R R+ +++P+LT+Y   EEAN+ K+A E+ K I+ QL++ P+   +QKL+DFY+TDSISRAS+TMAKC +AV
Sbjct:  212 VGTYVEKLFKSELSGNVIDLCPVGALTSKPYAFTARPWETRKIESVDVLDAVGSNIVVSTRSGEVMRILPRMNEEINEEWISDKTRFAYDGLKRQRLTFPFVKDEAGNL-KKTTWEDALITASSMINNFEG-NQIAGLAGGLVDAESLVSLKDLLNRLGSEALCTEEIFPMDGAGTDLRSNYLLNTGLAAIEEADLVLFIGTNPRFEAPLLNTRVRKSWINNDLEVALVGTKVDLTYDYDHLGDSTEVLKQLADGSHPFCKKLNKALRPMVVVGSTSLQRKDGQAIHNAVSTIAQTARVQSGCGEEWKVLNVLHRVASQVAALDLGYKAGVDYIRKNPPQVLFMLGADEGVLTRDDLPKDCFIIYQGHHGDKGAAMADVVFPGAAYTEKEGTYVNTEGRAQETKLAVSPPGMARDDWKIIRALSEILEKPLPYDTIQEIRSRLEDVAPHLTRYGEAEEANYFKQANELTKTIKGQLETQPLSPPLQKLEDFYMTDSISRASQTMAKCVQAV 720          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Match: G1N8Z6 (NADH:ubiquinone oxidoreductase core subunit S1 OS=Meleagris gallopavo OX=9103 GN=NDUFS1 PE=3 SV=2)

HSP 1 Score: 616.69 bits (1589), Expect = 0.000e+0
Identity = 309/529 (58.41%), Postives = 397/529 (75.05%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 3317
            G  N   VGTY+EK+F SELSGN+ID+CPVGALTSKPYAFTARPWETR V +IDV+D +GSNIVVS RT EVMRI+PRL+E+INEEWI+DK+RF+YDGLKRQRL  PMIK+ K  L    +W  V   +      +    D+AA+VG   DAE+L ALKDLLN +N D L TEE FP  GAG D RSNY+ N+KI+G+EEAD+LL+VG NPRFEA + N RIRKSW+HN+L V L+GS V+LTY Y++LG+   I+++++ G HAF K L  AK+P+++VGS  LQR D +AI   +S ++   ++ S V  +WK+ +IL R ASQVAALDLG++P V  I +  PK++Y++GAD G + R+ LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKIIRA+ E+ G+ LPY NL E+R R+ E+SPNL +Y+  EEAN+ K+A E++KL++ QL + P+V     ++DFY+TDSISRAS+TMAKC KAV++      HAV
Sbjct:  200 GRGNDMQVGTYVEKMFMSELSGNIIDICPVGALTSKPYAFTARPWETRKVESIDVLDAVGSNIVVSTRTGEVMRILPRLHEDINEEWISDKTRFAYDGLKRQRLTQPMIKNEK-GLFVYASWEDVLTRVAGVLKAVQG-KDVAAIVGGLVDAEALIALKDLLNRVNCDTLCTEEIFPTTGAGTDLRSNYLLNTKIAGVEEADVLLLVGTNPRFEAPLFNARIRKSWLHNDLHVALVGSAVNLTYTYDHLGESPQILQDIASGKHAFCKVLNQAKKPVVVVGSAALQRSDGAAIHAAVSTIAQNARTKSGVGSDWKVMNILHRVASQVAALDLGFKPGVEAIRKNPPKVLYLLGADSGCITRQDLPKDCFIIYQGHHGDMGAPMADVILPGAAYTEKAATYVNTEGRAQQTRVAVTPPGMAREDWKIIRAVSELAGLTLPYENLDEIRKRLEEVSPNLVRYDDVEEANYFKQANELSKLVKQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVVEGA----HAV 722          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Match: A0A210PQI0 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT19809 PE=3 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 302/510 (59.22%), Postives = 388/510 (76.08%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKA 3281
            VGTY+EK+F+SELSGNVIDLCPVGALTSKPYAFTARPWETR V ++DVMD LGSNIV+S RTNEVMRI+PR+NEEINEEWI+D +RF+YDGLKRQRL  P +KD   NL+  T+W   F       + +    D+A + G   DAE+L A KD LN + S+ L TEE FP +GAG D RSNY+ N+KI+G+EEAD++L+VG NPRFEA +LN R+RKSWIHN+L V ++GS+VDLTYDYE+LGD   +++E++ GSH F K L  AKRP+++VGS  LQR DS AI   +S++S  +++NS+   NWK+ ++LQR A QVAALDLG++  V+ I +  PK++Y++GADEG + +E LP DC +IYQGHHGD GA +AD++ PGA YTEK GTYVNTEGR Q+T +AVT PG +R DWKIIRAL EI G  LPY  L +++ R+ E+SPNL +Y   EEAN+ K+A E+A+L + QLD+ P+   I  L DFY+T+SISRAS TMAKC  A
Sbjct:  210 VGTYVEKMFQSELSGNVIDLCPVGALTSKPYAFTARPWETRKVESVDVMDALGSNIVISTRTNEVMRILPRMNEEINEEWISDTTRFAYDGLKRQRLTSPFVKDESGNLVA-TSWEDAFIATAEKLSAVKG-EDVAGIAGGLMDAEALVAFKDFLNKMGSEGLCTEEIFPGDGAGTDLRSNYLLNTKIAGVEEADIVLLVGTNPRFEAPLLNARMRKSWIHNDLKVAMVGSQVDLTYDYEHLGDSTQVLQEIANGSHPFCKELNKAKRPMVVVGSSALQRSDSGAIHAAVSLISQSVRANSSCDDNWKVLNVLQRVAGQVAALDLGFKAGVDHIRQNPPKVLYLLGADEGAITQEDLPKDCFVIYQGHHGDIGAAMADVVFPGAAYTEKDGTYVNTEGRAQQTRMAVTPPGLARNDWKIIRALSEIVGSPLPYDKLEDVQGRLCEVSPNLIKYGDAEEANYFKQAQELAQLTKGQLDNAPLQPDISILSDFYMTNSISRASPTMAKCVTA 717          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Cavefish
Match: NDUFS1 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial [Source:NCBI gene;Acc:103040078])

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 301/523 (57.55%), Postives = 393/523 (75.14%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
            G  N   +GTY+EK+F SELSGNVID+CPVGALTSKPYAFT+RPWETR   +IDV+D +GSNIVVS R  EVMRI+PRLNE++NEEWI+DK+RF+YDGLKRQRL  PM+KD    L+T T+W      +     + S  + IAA+ G   DAESL ALKDLLN+L+S+ L TEE FPM GAG D RSNY+ N+ ISGIEEADLLL+VG NPR+EA + N RIRKSW+HNEL V L+G +VDL+Y Y +LG+ A +++E++ G H F K L  AKRP+++VGS  LQR+D +AI   +S ++ K +  S +  NWK+ ++L R ASQVAALDLGY+P V +I +  PK+++++GAD G + R++LP DC IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR+Q+T VAVT PG +REDWKIIRA+ E+ GI LPY  L E+R R+ +++PN+ +Y+  EEAN+ K+  E++K +   L S P++     ++DFY+TDSISRAS+TMAKC KAV +  +
Sbjct:   83 GRGNAMEIGTYVEKMFMSELSGNVIDICPVGALTSKPYAFTSRPWETRKTESIDVLDAVGSNIVVSTRGGEVMRILPRLNEDVNEEWISDKTRFAYDGLKRQRLTQPMVKDVSGQLVT-TSWEEALTRVAGVL-QASQGSTIAAIAGGMVDAESLVALKDLLNHLDSENLCTEEIFPMAGAGTDLRSNYLLNTSISGIEEADLLLLVGTNPRYEAPLFNARIRKSWMHNELQVALVGHEVDLSYSYNHLGNSAQVLEEIAAGKHPFNKVLAQAKRPVVVVGSAALQREDGAAIHAAVSAIAHKARVTSGIEDNWKVLNVLHRVASQVAALDLGYKPGVEVIRKNTPKVLFLLGADAGCISRKELPKDCFIIYQGHHGDVGAPMADVILPGAAYTEKCATYVNTEGRSQQTHVAVTAPGMAREDWKIIRAISELAGITLPYETLDEVRKRLAQVAPNMLRYDDVEEANYFKQVNELSKGVNQALLSEPLIPPQLTVRDFYMTDSISRASQTMAKCVKAVTEGAQ 603          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Cavefish
Match: ndufs1 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial-like [Source:NCBI gene;Acc:103033212])

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 294/520 (56.54%), Postives = 387/520 (74.42%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVID 3290
            G  N   +GTY+EK+F SE+SGNVID+CPVGALTSKPYAFT+RPWETR   +IDV+D +GSNIVVS R  EVMRI+PRLNEE+NEEWI+DK+RF+YDGLKRQRL  PM+KDS   L+ QT W      + +    +   +++AA+ G   DAE+L ALKDLLN L+S+ L TEE FP  GAG D RSNY+ NS+I+GIEE DLLL++G NPR+EA + N R+RKSW+HNEL V L+G +VDL+Y Y +LGD   +++E++ G H F + L  +KRP+++VGS CLQR D +AIL  +S ++   + +S V + WK+ ++L R ASQVAALDLGY+P V  I +  PK+++++GAD G + R  LP D  IIYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q+T VAVT PG +REDWKI+RA+ E+ G+ LPY  L E+RDR+ E++PNL +Y+  EEAN+ K+A E++K +   L + P+V     ++DFY+TD ISRAS+TMAKC KAV +
Sbjct:  205 GRGNSMQIGTYVEKMFMSEMSGNVIDVCPVGALTSKPYAFTSRPWETRKTESIDVLDAVGSNIVVSTRGGEVMRILPRLNEEVNEEWISDKTRFAYDGLKRQRLTQPMVKDSSGQLV-QTTWEDALTRVAAMLQGVQK-SEVAAIAGGMVDAEALVALKDLLNKLDSEALCTEEVFPTAGAGTDLRSNYLMNSRIAGIEECDLLLLIGTNPRYEAPLFNARVRKSWLHNELQVALVGHEVDLSYTYNHLGDSTQVLQEIAAGKHQFCQVLAQSKRPVVVVGSSCLQRADGAAILSAVSTIAQNARVSSGVEEGWKVLNVLHRVASQVAALDLGYKPGVEAIRKNPPKVLFLLGADAGCITRVDLPKDSFIIYQGHHGDVGAPMADVILPGAAYTEKNATYVNTEGRAQQTRVAVTAPGMAREDWKILRAVSELAGVALPYDTLEEVRDRLAEVAPNLVRYDDVEEANYFKQANELSKAVNQSLLADPLVPPQLSVKDFYMTDPISRASQTMAKCVKAVTE 722          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Sea Lamprey
Match: ndufs1 (NADH:ubiquinone oxidoreductase core subunit S1 [Source:ZFIN;Acc:ZDB-GENE-030131-478])

HSP 1 Score: 592.423 bits (1526), Expect = 0.000e+0
Identity = 293/512 (57.23%), Postives = 378/512 (73.83%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXX-XXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAV 3284
            VGTYIEK+F SELSGNVIDLCPVGALTSKPY+FTARPWETR   ++DV+D +GSNIVVS R  EVMRI+PRL+E+INEEWI+DK+RF+YDGLKRQRL  PM++D +  L+    W           + +S  ++IAA+ G   DAESL ALKDLLN L+S+ L TEE FPM GAG D RSNY+ N+ I+G+EEAD+LL+VG NPR+EA + NTRIRKSW+HNEL V ++G+KVDLTY YE+LGD   ++K+L+ G+H F K L  AK+P+++VGS  LQR D +A+   +S ++   +   +     WK+ ++L R ASQVAALDLGY+  V+ + +  PK++Y++GAD   + R  LP    +IYQGHHGD GA +AD+ILPGA YTEK  TYVNTEGR Q T  A+T PG +REDWKIIRAL E+  + LPY +L E+R R+ E+SPNL +YN  EEAN+  +A EMAKL+  +L + P+      L+DFY+TDSISRAS+TMAKC KAV
Sbjct:  208 VGTYIEKMFHSELSGNVIDLCPVGALTSKPYSFTARPWETRKTESVDVLDAVGSNIVVSTRGGEVMRILPRLHEDINEEWISDKTRFAYDGLKRQRLTQPMLRDDQGRLVP-CGWEEALGRAAGALHGVSG-SEIAAIAGGLADAESLVALKDLLNKLDSESLCTEEIFPMSGAGTDLRSNYLLNTSIAGVEEADVLLLVGTNPRYEAPLFNTRIRKSWLHNELQVAVVGTKVDLTYTYEHLGDSPQVLKDLASGTHPFAKVLAAAKKPMVVVGSAVLQRGDGAAVHAAVSAIAQSARLAIAGTSPEWKVLNVLHRVASQVAALDLGYKAGVDAVRKNPPKVLYLLGADGETVTRAHLPKGSFVIYQGHHGDTGAPMADVILPGAAYTEKTATYVNTEGRAQMTHTAITPPGMAREDWKIIRALSEVAEMTLPYDSLKEVRKRLAEVSPNLVRYNDVEEANYFTQATEMAKLVNHELLNEPLQPPQLTLKDFYMTDSISRASQTMAKCVKAV 717          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Nematostella
Match: EDO49065 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI03])

HSP 1 Score: 567.77 bits (1462), Expect = 0.000e+0
Identity = 291/513 (56.73%), Postives = 377/513 (73.49%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISS--PTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAV 3284
            VGTYIEK+F+SE+SGNVIDLCPVGALTSKPYAF ARPWE R  +++DV+D +GSNIVV+ R+ EVMRI+PR+NE+INEEWI+DK+RF+YDGLKRQRL  PM+KD++ NL T   W    E L S   K++S    ++ A+ G   DAE+L A+KDL N  N + L TEE F  +GAG D RSNYI N+ ISGIE+AD+LL+VG NPR+EA ++N RIRKSW+HN+L VGL+G++VDLTYDYE+LG  A  +K++  G + F K L  +K+P+I+V ++ L   D  AI   ++ +S KLKS       W++ +++Q  ASQVAALDLGY+P V  I E  PK+V+++GAD  VL+RE LP DC I+YQGHHGD+GA +AD+ILPGA YTEK  TYVNTEGR Q+T  AVT P  +R+DWKIIRAL EI G  LPY    E+R RM EI+PNLT+Y   E+ANF   A  + +  + Q    P+   I +L+DFY+TD++SRAS+TMAKC KAV
Sbjct:  214 VGTYIEKMFKSEMSGNVIDLCPVGALTSKPYAFVARPWELRKTDSVDVLDAVGSNIVVNTRSGEVMRILPRMNEDINEEWISDKTRFAYDGLKRQRLTTPMVKDARGNL-TACTWE---EALISVAQKMTSLNGNEMVAIAGGLADAEALVAMKDLFNRYNCEGLYTEEGFSNQGAGTDLRSNYIMNTTISGIEDADVLLLVGANPRYEAPLINARIRKSWMHNDLQVGLLGTQVDLTYDYEHLGTTAETLKDILSGKNPFAKTLLKSKKPMILVANKALDGADGHAIQTLVTEMSEKLKSRKETDPEWRVLNVMQGVASQVAALDLGYKPGVQNIVEV-PKLVFLLGADGQVLRREDLPKDCFIVYQGHHGDHGAHMADVILPGAAYTEKTATYVNTEGRAQQTRRAVTPPSYARDDWKIIRALSEIAGQTLPYETQEEIRRRMTEIAPNLTRYGDVEQANFFSLALGLIQGSKAQPSKKPLTPRIAELKDFYMTDAVSRASQTMAKCVKAV 721          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Medaka
Match: NDUFS1 (NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial [Source:NCBI gene;Acc:101157518])

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 292/521 (56.05%), Postives = 385/521 (73.90%), Query Frame = 3
Query: 1731 GNQNLY*VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDS 3293
            G  N   +GTY+EK+F SELSGNVID+CPVGALTSKPYAFTARPWETR   +IDV+D +GSNIVVS R  EVMR++PRL+E+INEEWI+DK+RF+YDGLKRQRL  PM+KD+   L T T+W      +      +    ++  + G   DAE+L ALKDLLN L+S+ L TEE FPM GAG D RSNY+ NS+I+GIEE+DLLL+VG NPR+EA + N RIRKSW+HNEL V ++G  VDLTY Y++LG++  ++ +L+ G+H F + L TAKRP+++VGS  LQR+D +AIL  +S ++   +++S V   WK+ ++L R ASQVAALDLGY+  V+ I +  PK+++++GAD G + R  LP   LIIYQGHHGD GA +ADIILPGA YTEK GTYVN EGR+Q T VAVT PG +REDWK+IRA+ E+ G+ LPY  L E+R R+ E++PNL +Y+  EEAN+ K+A E+A+ +   L + P+V      +DFY+TD ISRAS+TMAKC KA+ + 
Sbjct:  203 GRGNELQIGTYVEKMFMSELSGNVIDICPVGALTSKPYAFTARPWETRKTESIDVLDAVGSNIVVSTRGGEVMRVMPRLHEDINEEWISDKTRFAYDGLKRQRLTQPMVKDAAGQL-TPTSWEDALTRVAGALQSVQG-KEVGGIAGGLVDAEALVALKDLLNRLDSENLCTEELFPMAGAGTDLRSNYLLNSRIAGIEESDLLLLVGTNPRYEAPLFNARIRKSWLHNELRVAVVGHNVDLTYTYDHLGEETSVLTQLANGTHPFCQVLATAKRPVVVVGSGALQREDGAAILSAVSTIAQNARTSSGVEDGWKVLNVLHRVASQVAALDLGYKAGVDAIRKNPPKVLFLLGADAGCVTRADLPQGSLIIYQGHHGDVGAPMADIILPGAAYTEKSGTYVNIEGRSQHTKVAVTAPGMAREDWKVIRAVSELAGVTLPYDTLDEVRSRLAEVAPNLVRYDDVEEANYFKQANELAQAVNQNLVAAPLVPPQVSAKDFYMTDPISRASQTMAKCVKALTEG 721          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000041488.1 (pep primary_assembly:ASM223467v1:21:22888450:22891578:1 gene:ENSORLG00000030457.1 transcript:ENSORLT00000041488.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 162.155 bits (409), Expect = 1.026e-44
Identity = 99/258 (38.37%), Postives = 138/258 (53.49%), Query Frame = 3
Query: 2526 FFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYE 3299
              + +  AK P+++VGS CLQR+        +    S +  N++V   WKI ++L R ASQVAALDLGY+P V +I E  PK+++++GAD G    +    +    Y GHHGD GA IADIILPGA YTEK GTYVNTEG              +REDW+IIR                 +R+R+ E+SPNL   +   EAN  K+  E+   + T+    PIV     ++DFY+TD          +C +AV +  +
Sbjct:    4 LLQAVAEAKHPVVVVGSSCLQRE----YGAAVMAAVSSIAQNAHVEDTWKIVNVLHRVASQVAALDLGYKPGVKIIRENPPKVLFLLGADSGSSTFQYFTYN----YPGHHGDVGAPIADIILPGAAYTEKCGTYVNTEGL-------------AREDWRIIR-----------------VRNRLAEVSPNLVGNDNIVEANCAKQVAELFNALLTE----PIVPPQLTVRDFYMTDH--------GQCVRAVTEGAQ 211          
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Planmine SMEST
Match: SMESG000081864.1 (SMESG000081864.1)

HSP 1 Score: 1006.9 bits (2602), Expect = 0.000e+0
Identity = 522/522 (100.00%), Postives = 522/522 (100.00%), Query Frame = 3
Query: 1752 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTAXXXXXXXXXXXXXVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDXXXXXXXXXXXXXXXXXXXXVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 3317
            VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTALKDLLNNLNSDLLVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDSSAILKYLSILSSKLKSNSNVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV
Sbjct:  210 VGTYIEKLFRSELSGNVIDLCPVGALTSKPYAFTARPWETRTVNTIDVMDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLLHPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESLTALKDLLNNLNSDLLVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLLIVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYIIKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDSSAILKYLSILSSKLKSNSNVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGADEGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEGRTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISPNLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSISRASRTMAKCSKAVIDSYEKELHAV 731          
The following BLAST results are available for this feature:
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NDUFS10.000e+058.32NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
NDUFS10.000e+058.32NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
NDUFS10.000e+058.32NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
NDUFS10.000e+058.32NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
NDUFS10.000e+058.32NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nuo-54.656e-15449.61NADH Ubiquinone Oxidoreductase [Source:UniProtKB/... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ND-752.016e-16250.39gene:FBgn0017566 transcript:FBtr0071180[more]
ND-752.016e-16250.39gene:FBgn0017566 transcript:FBtr0071181[more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ino80db0.000e+056.15INO80 complex subunit Db [Source:NCBI gene;Acc:563... [more]
ino80db0.000e+056.15INO80 complex subunit Db [Source:NCBI gene;Acc:563... [more]
ndufs10.000e+056.15NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
znf33b0.000e+058.51zinc finger protein 33B [Source:Xenbase;Acc:XB-GEN... [more]
znf33b0.000e+058.13zinc finger protein 33B [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Ndufs10.000e+057.74NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
Ndufs10.000e+057.74NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
Ndufs12.531e-838.60NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
Ndufs14.142e-848.33NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P15690|NDUS1_BOVIN0.000e+058.41NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
sp|P28331|NDUS1_HUMAN0.000e+058.32NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
sp|P0CB68|NDUS1_PONPY0.000e+058.13NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
sp|Q0MQG2|NDUS1_PANTR0.000e+058.13NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
sp|Q4R6K9|NDUS1_MACFA0.000e+058.51NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
R0K0820.000e+058.41NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
U3I9980.000e+058.41NADH:ubiquinone oxidoreductase core subunit S1 OS=... [more]
K1RIT60.000e+059.10NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
G1N8Z60.000e+058.41NADH:ubiquinone oxidoreductase core subunit S1 OS=... [more]
A0A210PQI00.000e+059.22NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFS10.000e+057.55NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
ndufs10.000e+056.54NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ndufs10.000e+057.23NADH:ubiquinone oxidoreductase core subunit S1 [So... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490650.000e+056.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
NDUFS10.000e+056.05NADH-ubiquinone oxidoreductase 75 kDa subunit, mit... [more]
ENSORLT00000041488.11.026e-4438.37pep primary_assembly:ASM223467v1:21:22888450:22891... [more]
back to top
BLAST of NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000081864.10.000e+0100.00SMESG000081864.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016302 ID=SMED30016302|Name=NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3363bp
ATTAAAAACCGATTAATCGGTTTTTACTGTTACAATAGTTTTTACAATCA
CTAACACCAATATTTAGTGAGATAAGTCTTCTATAATAGGGATGGCGAAA
CTCTTTTGGTTCGCATGTTAGAACTTTAAAAATATTTGTAACAGCACTGC
CAGCGTGCCACATAATGTTTATAAGAAAAAGTAAACTTAAAAATTATGCC
ATTATCTACCAACTACTAGTATACTTGTAGTGTACACAAGACAAAATCGA
GTCGCAGCAGAATTCTCAAACAACTTTTTAATTGAATTGCACATTTGATT
TTTTAGTGGAACACTTAAAAGTTCATCGCGTAATACCAGTGTTACACGGA
ACACGCTTTGAGAACCAAGGATCTGCGGTAATGAAACGACGCCTCATAAA
CATAAAAACCAAAGTGCTAAGCATCTTTGAAGATTTAAAAACCAAGAAAT
CATAGAATTGCTGTCTAACTTTTAATGATAACAATAGATAGTTCGATCTA
TTTAAAAGGGCTAATAATCATAATGTAAAAATTAGTAGTGAGACATCCGA
TGCCGATTACGAAGCTGCTCAAGACTTCATTGAACAATAAGATGCTTTGA
ATAGAAAATTAGACTTCACAATTGGACAAATTTGCAATTTTTACTGCATT
ATACTGAAAAAGTGTCTGTGCGTAGCTATATCTGCAAACAAGCGAAAAAA
CCATATAACACTATTAAAATAACCTTTTACTACCCATTAATTTCCATTCA
AGCAAAAAACATGGATGACACAACTTATCCTTTGTGGTTGATTCATAAAA
ATTATTTATAACTGAGGTAGAAAAATATTGTCACTTAATGACAACCACCG
CATATAGGAGATCGACATCCAAACATAAAGCTTTGTATTTTCGCTCTAGT
ACTAATATCATCCTACAACCTGTGGATCAGGGAGCTATTGCTACTTTTAA
AGCCTATCGTTTAAAAATTACATTTGTGCAAGGCACTAGTACAATAAAAG
AGGCGAAGACTTTTCAAAATTTTATCTTTCATACAATAAATATAGGAAAG
AAGTTACCTCAACATGAATGTTCAGAATATGGAAAAAATTCACAAAACTG
TTTGAACCTGTTTCTCTTTCCATGTACGAAAAAGAAAAAAATGGTGACTA
TTACTAATCCAATCGTACAACTTAGTGAATGACTAAACTTCGACGTTTAT
AATGAAGACATTAACTAACGGATCGATAATGATTCGGAAAATCTTACCAA
TGCATAATTATTTGATTTTAAAACTTAAATGGTTGCGGAAAGGAAATTGA
TGAAAGCGAATCAATCCATAGAACCGCGGGAAAAATTGTATTTAAAGAAA
TGTCTGCTGCTTTTCAAAAGTATTTAAAAATAATGAAATATTTTTAAATG
TGAACCGCGGATTCAAGGTAATTTCATCTGCTACCTAGAAAAACGAACAC
AGAAATTGCATAGAAAAAAATAGGATGCGTTCAATCAAAACTTAGATACT
TATTTTAAAAATATTTACACTACTTTACCTCAAATTGAAGATAAAGAAAT
GTATTGTACTTATCTAATAAATACGAATTACGAGAGTGCTTAATTTGTTT
TAAATAAAAATATGGATTTATTTAAACTAAACAAATTAAAATTTAATAAT
AATTGGACTAACTAGAATAAATTGAAAATATTAAAAAAATTTATAATTTA
CGAAATGTATCGATTATACAAAAATTTATTGGAAACCAAAATCTTTATTA
GGTTGGCACATATATTGAAAAACTATTTCGAAGCGAATTATCTGGAAATG
TTATTGATCTTTGTCCAGTTGGAGCTCTTACTTCTAAGCCGTATGCATTT
ACTGCTAGACCGTGGGAGACAAGGACAGTTAATACTATTGATGTTATGGA
TGGTTTAGGATCAAATATTGTAGTATCAATGCGGACAAACGAGGTTATGC
GGATTATACCTAGACTTAATGAAGAAATTAATGAAGAGTGGATTAATGAT
AAATCACGATTCTCTTATGATGGACTAAAACGACAACGATTATTGCATCC
AATGATAAAAGATTCAAAAACAAATTTGCTGACTCAAACAAACTGGATGA
GTGTGTTTGAAATACTTAATTCTCATTTTAATAAAATTAGTTCCCCTACT
GATATTGCAGCAGTTGTTGGAAGATTCTGTGATGCCGAATCTCTTACTGC
GTTAAAAGATTTATTAAATAACTTGAACAGTGATTTGTTAGTCACTGAAG
AATCATTTCCAATGGAAGGAGCTGGCATTGATTTCCGTTCAAATTATATA
TTTAATTCCAAAATTTCTGGAATAGAAGAAGCTGATCTTCTTTTGATTGT
TGGATGTAATCCTAGATTTGAAGCCTCAGTTCTTAATACGAGAATTAGAA
AGTCATGGATTCACAATGAATTAGATGTAGGACTCATTGGTAGTAAAGTT
GACTTAACTTATGATTATGAATATTTAGGAGATAAAGCTTATATAATTAA
AGAATTATCTGAAGGGAGTCATGCGTTTTTTAAAAGACTACAAACTGCAA
AACGACCACTTATTATAGTTGGAAGCGAGTGTTTACAACGCCAAGATTCT
TCTGCAATATTGAAATACCTGTCTATTCTCAGTTCTAAATTAAAATCAAA
TTCTAACGTTCCCAAAAATTGGAAAATTTTCAGTATTTTACAACGATTTG
CCAGCCAAGTAGCAGCGTTAGATTTAGGTTATCGACCTGATGTTAATTTA
ATTTATGAAGCTCAACCTAAAATAGTTTATATGATGGGTGCCGATGAAGG
CGTTTTAAAAAGAGAGAAATTACCAGTCGATTGTTTGATAATATATCAAG
GGCACCATGGTGATAATGGAGCTAAAATTGCTGATATCATTCTTCCCGGA
GCCACATATACTGAAAAATACGGAACCTATGTAAATACCGAAGGGAGAAC
CCAAGAAACTTGTGTTGCGGTTACATGTCCTGGTGAATCAAGAGAAGATT
GGAAAATAATCCGTGCTTTGGGAGAAATTTGTGGAATTAATTTACCTTAT
TCTAATCTTTTAGAATTACGTGATCGTATGTGGGAAATTTCACCAAATTT
AACTCAATATAATATGTGCGAAGAAGCAAATTTTAATAAAGAAGCTTACG
AAATGGCAAAATTAATTCAAACACAACTTGATTCTACTCCTATAGTTTCA
TCCATTCAAAAGCTTCAAGACTTTTATATTACTGATAGCATTAGCAGAGC
TTCACGAACGATGGCTAAGTGTAGTAAAGCAGTTATTGATAGTTATGAAA
AAGAATTACATGCGGTTTAGTGAAATTAAATGAGTTCTAGCATATAATAA
AGCTTAATATGGC
back to top

protein sequence of SMED30016302-orf-1

>SMED30016302-orf-1 ID=SMED30016302-orf-1|Name=SMED30016302-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=475bp
MDGLGSNIVVSMRTNEVMRIIPRLNEEINEEWINDKSRFSYDGLKRQRLL
HPMIKDSKTNLLTQTNWMSVFEILNSHFNKISSPTDIAAVVGRFCDAESL
TALKDLLNNLNSDLLVTEESFPMEGAGIDFRSNYIFNSKISGIEEADLLL
IVGCNPRFEASVLNTRIRKSWIHNELDVGLIGSKVDLTYDYEYLGDKAYI
IKELSEGSHAFFKRLQTAKRPLIIVGSECLQRQDSSAILKYLSILSSKLK
SNSNVPKNWKIFSILQRFASQVAALDLGYRPDVNLIYEAQPKIVYMMGAD
EGVLKREKLPVDCLIIYQGHHGDNGAKIADIILPGATYTEKYGTYVNTEG
RTQETCVAVTCPGESREDWKIIRALGEICGINLPYSNLLELRDRMWEISP
NLTQYNMCEEANFNKEAYEMAKLIQTQLDSTPIVSSIQKLQDFYITDSIS
RASRTMAKCSKAVIDSYEKELHAV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
Vocabulary: INTERPRO
TermDefinition
IPR006656Mopterin_OxRdtase
IPR015405NuoG_C
IPR006963Mopterin_OxRdtase_4Fe-4S_dom
IPR015155PFU
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0008637apoptotic mitochondrial changes
GO:0042773ATP synthesis coupled electron transport
GO:0045333cellular respiration
GO:0046034ATP metabolic process
GO:0051881regulation of mitochondrial membrane potential
GO:0072593reactive oxygen species metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
GO:0016651oxidoreductase activity, acting on NAD(P)H
GO:0051536iron-sulfur cluster binding
GO:0003954NADH dehydrogenase activity
GO:0008137NADH dehydrogenase (ubiquinone) activity
GO:0009055electron carrier activity
GO:0046872metal ion binding
GO:00515372 iron, 2 sulfur cluster binding
GO:00515394 iron, 4 sulfur cluster binding
Vocabulary: cellular component
TermDefinition
GO:0005739mitochondrion
GO:0005743mitochondrial inner membrane
GO:0005747mitochondrial respiratory chain complex I
GO:0005758mitochondrial intermembrane space
GO:0016020membrane
GO:0043209myelin sheath
GO:0070469respiratory chain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006656Molybdopterin oxidoreductasePFAMPF00384Molybdopterincoord: 48..377
e-value: 6.6E-62
score: 209.9
IPR015405NADH-quinone oxidoreductase, chain G, C-terminalPFAMPF09326NADH_dhqG_Ccoord: 408..459
e-value: 4.5E-14
score: 52.9
NoneNo IPR availableGENE3DG3DSA:3.40.50.740coord: 306..413
e-value: 2.8E-16
score: 61.8
NoneNo IPR availablePANTHERPTHR11615:SF259coord: 1..467
NoneNo IPR availablePANTHERPTHR11615NITRATE, FROMATE, IRON DEHYDROGENASEcoord: 1..467
NoneNo IPR availableSUPERFAMILYSSF53706Formate dehydrogenase/DMSO reductase, domains 1-3coord: 1..405
IPR006963Molybdopterin oxidoreductase, 4Fe-4S domainPROSITEPS516694FE4S_MOW_BIS_MGDcoord: 1..48
score: 15.464