Homeobox domain-containing protein

Overview
NameHomeobox domain-containing protein
Smed IDSMED30016301
Length (bp)1137
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Homeobox domain-containing protein (SMED30016301) t-SNE clustered cells

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30016301) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Homeobox domain-containing protein (SMED30016301) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Homeobox domain-containing protein (SMED30016301) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016301

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
central nervous systemSMED30016301SMESG000002774.1 KJ934807smed_ncbi_20200123PMID:25254346
Scimone et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016301SMESG000002774.1 dd_Smed_v4_11198_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-1 (NK6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7839])

HSP 1 Score: 136.732 bits (343), Expect = 3.971e-36
Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQD 858
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++
Sbjct:  217 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASEN 319          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-2 (NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321])

HSP 1 Score: 132.494 bits (332), Expect = 1.803e-35
Identity = 62/97 (63.92%), Postives = 77/97 (79.38%), Query Frame = 1
Query:  583 LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + D+   K    D+ D++
Sbjct:  141 VLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDDD 236          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: NKX6-3 (NK6 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:26328])

HSP 1 Score: 129.798 bits (325), Expect = 1.362e-34
Identity = 85/205 (41.46%), Postives = 103/205 (50.24%), Query Frame = 1
Query:  322 TPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSAL-LWAKAGLPPNINPELW--SRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEG----------------NDDSRSQKPSSQDSGDEEGR 879
            TPHGI DIL    +A +   NS +   P         ++ + +     +  K      T     WA  G       + W   RQ       L     K+KHTRPTF+G QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS  + +S                     N+D    KP   DS DE+ R
Sbjct:   51 TPHGITDILSRPVAAPN---NSLLSGYPHVAGFGGLSSQGVYYSPQVGNFSKAGNEYPTRTRNCWADTG-------QDWRGGRQCSNTPDPLSDSIHKKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGAGAGAGGDRAPSENEDDEYNKPLDPDSDDEKIR 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: HHEX (hematopoietically expressed homeobox [Source:HGNC Symbol;Acc:HGNC:4901])

HSP 1 Score: 80.4925 bits (197), Expect = 1.276e-16
Identity = 50/117 (42.74%), Postives = 59/117 (50.43%), Query Frame = 1
Query:  532 PNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGND------DSRSQKPSSQDSG 864
            P   P LWS         L R   KRK  +  FS  Q   LEK FE  +YL+ PER RLA +L +SE QVK WFQNRR KWR+    +  S  KE  +      D R   PS Q+ G
Sbjct:  119 PLGKPLLWS-------PFLQRPLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKG 228          
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Match: TLX3 (T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc:HGNC:13532])

HSP 1 Score: 77.0258 bits (188), Expect = 3.342e-15
Identity = 40/95 (42.11%), Postives = 59/95 (62.11%), Query Frame = 1
Query:  538 INPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGN 822
            + P   +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR+++  +  ++ ++ +
Sbjct:  145 LTPFTVTRRIGHPYQ--NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAS 237          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 98.9821 bits (245), Expect = 2.329e-25
Identity = 48/78 (61.54%), Postives = 59/78 (75.64%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRS 837
            ++K +RPTF+G QI+ LE+ FEQT+YLAG +RA+LA  L MSESQVKVWFQNRRTKWRKK   D N+  K G    +S
Sbjct:   18 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAAD-NALVKRGASGDKS 94          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: cog-1 (COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2])

HSP 1 Score: 100.908 bits (250), Expect = 2.076e-24
Identity = 48/78 (61.54%), Postives = 59/78 (75.64%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRS 837
            ++K +RPTF+G QI+ LE+ FEQT+YLAG +RA+LA  L MSESQVKVWFQNRRTKWRKK   D N+  K G    +S
Sbjct:  168 QKKQSRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKKEAAD-NALVKRGASGDKS 244          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: ceh-9 (Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Prot;Acc:P56407])

HSP 1 Score: 80.4925 bits (197), Expect = 4.843e-18
Identity = 35/60 (58.33%), Postives = 47/60 (78.33%), Query Frame = 1
Query:  601 SKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRK 780
            +KRK  R TFSG+Q+F LEK FE  +YL+  +R+ LA  L ++E+QVK+WFQNRRTKW+K
Sbjct:   68 TKRKKARTTFSGKQVFELEKQFEAKKYLSSSDRSELAKRLDVTETQVKIWFQNRRTKWKK 127          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: tab-1 (pep chromosome:WBcel235:II:6803758:6804761:1 gene:WBGene00006380.1 transcript:F31E8.3b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tab-1)

HSP 1 Score: 80.8777 bits (198), Expect = 8.931e-18
Identity = 50/128 (39.06%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  469 ICKPTFGIDTSALLWAKAGLPPNINPELWSR----QFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQ 840
            +    F I+ S LL  + G    + P  WS     +    T+   R  S+RK  R  FS QQ+  LE+ FE  RYL+ PER  LA  L +SE+QVK WFQNRR K +K    D NS + +  +D+ S+
Sbjct:   72 LAAAAFPIEHSLLLAQRNG----VFPGFWSTADQIRLSNATKAYRRLSSRRK-ARTVFSDQQLQGLERRFESQRYLSTPERIELANALNLSETQVKTWFQNRRMKHKKVVRKDDNSVDDDNGNDNESE 194          
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Match: tab-1 (pep chromosome:WBcel235:II:6803758:6804863:1 gene:WBGene00006380.1 transcript:F31E8.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:tab-1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.217e-17
Identity = 51/131 (38.93%), Postives = 70/131 (53.44%), Query Frame = 1
Query:  469 ICKPTFGIDTSALLWAKAGLPPNINPELWSR----QFCQPTQLLDR---DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQ 840
            +    F I+ S LL  + G    + P  WS     +    T+   R   +CS+RK  R  FS QQ+  LE+ FE  RYL+ PER  LA  L +SE+QVK WFQNRR K +K    D NS + +  +D+ S+
Sbjct:   72 LAAAAFPIEHSLLLAQRNG----VFPGFWSTADQIRLSNATKAYRRLRLECSRRK-ARTVFSDQQLQGLERRFESQRYLSTPERIELANALNLSETQVKTWFQNRRMKHKKVVRKDDNSVDDDNGNDNESE 197          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: HGTX (gene:FBgn0040318 transcript:FBtr0075720)

HSP 1 Score: 126.716 bits (317), Expect = 5.725e-32
Identity = 56/69 (81.16%), Postives = 63/69 (91.30%), Query Frame = 1
Query:  589 DRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD 795
            D+D  K+KHTRPTFSGQQIFALEKTFEQT+YLAGPERA+LA+ LGMSESQVKVWFQNRRTKWRK+   +
Sbjct:  387 DKD-GKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERAKLAYALGMSESQVKVWFQNRRTKWRKRHAAE 454          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0306742)

HSP 1 Score: 86.6557 bits (213), Expect = 4.471e-18
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSN 801
            D  ++K  R TF+G+QIF LEK FE  +YL+  ER  +A LL ++E+QVK+WFQNRRTKW+K+    +N
Sbjct:  389 DARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNN 457          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0347151)

HSP 1 Score: 86.6557 bits (213), Expect = 4.471e-18
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSN 801
            D  ++K  R TF+G+QIF LEK FE  +YL+  ER  +A LL ++E+QVK+WFQNRRTKW+K+    +N
Sbjct:  389 DARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNN 457          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0082942)

HSP 1 Score: 86.6557 bits (213), Expect = 4.471e-18
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSN 801
            D  ++K  R TF+G+QIF LEK FE  +YL+  ER  +A LL ++E+QVK+WFQNRRTKW+K+    +N
Sbjct:  389 DARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNN 457          
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Match: NK7.1 (gene:FBgn0024321 transcript:FBtr0082941)

HSP 1 Score: 86.6557 bits (213), Expect = 4.471e-18
Identity = 36/69 (52.17%), Postives = 50/69 (72.46%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSN 801
            D  ++K  R TF+G+QIF LEK FE  +YL+  ER  +A LL ++E+QVK+WFQNRRTKW+K+    +N
Sbjct:  389 DARRKKKARTTFTGRQIFELEKMFENKKYLSASERTEMAKLLMVTETQVKIWFQNRRTKWKKQDNVTNN 457          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.1 (NK6 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-040718-178])

HSP 1 Score: 135.576 bits (340), Expect = 1.638e-36
Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQD 858
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + ++   K +S++
Sbjct:  167 ARFACSPHQNSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSETERLKGASEN 269          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.2 (NK6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-070626-1])

HSP 1 Score: 133.65 bits (335), Expect = 4.949e-36
Identity = 63/102 (61.76%), Postives = 79/102 (77.45%), Query Frame = 1
Query:  568 CQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
             Q   +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  +  K+ + ++   K SS +  D+E
Sbjct:  139 AQANMMLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMATAKKKHDSETEKMKESSDNDEDDE 239          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.3 (NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7])

HSP 1 Score: 128.257 bits (321), Expect = 7.625e-36
Identity = 65/107 (60.75%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILD 915
            +  K+KHTRPTFSG QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS T+ +S          +Q    + +GD    E +  E +K LD
Sbjct:    1 NVGKKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSATEPSS----------TQTSRGESAGDGSENEVEDEEYNKPLD 97          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: nkx6.3 (NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7])

HSP 1 Score: 128.642 bits (322), Expect = 2.928e-34
Identity = 65/107 (60.75%), Postives = 77/107 (71.96%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILD 915
            +  K+KHTRPTFSG QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS T+ +S          +Q    + +GD    E +  E +K LD
Sbjct:  147 NVGKKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSATEPSS----------TQTSRGESAGDGSENEVEDEEYNKPLD 243          
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Match: tlx2 (T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-020208-1])

HSP 1 Score: 82.0333 bits (201), Expect = 4.931e-17
Identity = 47/114 (41.23%), Postives = 68/114 (59.65%), Query Frame = 1
Query:  481 TFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGN 822
            TF    S+  +AK  L   ++P   +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR+++  +  ++ ++ N
Sbjct:  142 TFPWMESSRRFAKDRLTAALSPFSVTRRIGHPYQ--NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAN 253          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: zfand1 (zinc finger AN1-type containing 1 [Source:Xenbase;Acc:XB-GENE-1217582])

HSP 1 Score: 133.65 bits (335), Expect = 7.497e-36
Identity = 81/183 (44.26%), Postives = 106/183 (57.92%), Query Frame = 1
Query:  313 PNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFID-ICKPTFGIDTSA-LLWAKAGLPPNINPELWS--RQFC--QPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQK 843
            P  TPHGI DIL     A    S + + + P+   N    +  + F  + +    KP   +   A + W     P  +    W   R  C  Q   +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  +  K+ + ++   K
Sbjct:   58 PLGTPHGISDILSRPLGATLGSSANLLSSLPR--INGLATSTGMYFNPAAVSRYPKPLAELPGRAPIFW-----PGVMQGSPWRDPRLGCPSQAGMVLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMATAKKKHDSETEKMK 232          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: meis1 (Meis homeobox 1 [Source:Xenbase;Acc:XB-GENE-479439])

HSP 1 Score: 135.191 bits (339), Expect = 8.424e-36
Identity = 69/110 (62.73%), Postives = 83/110 (75.45%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD-SNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   + + +K K+  +  R +  S  +  D++
Sbjct:  202 ARLACGPHQGSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDTETERLKGASDNEEEDDD 310          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: znf608 (zinc finger protein 608 [Source:Xenbase;Acc:XB-GENE-491957])

HSP 1 Score: 127.102 bits (318), Expect = 1.027e-33
Identity = 68/104 (65.38%), Postives = 75/104 (72.12%), Query Frame = 1
Query:  601 SKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD-----SNSKNKEG------NDDSRSQKPSSQDSGDEEGR 879
            S++KHTRPTF+G QIFALEKTFEQT+YLAGPERARLAF LGMSESQVKVWFQNRRTKWRKKS  +     S S    G      N+D    KP   DS DE+ R
Sbjct:  132 SRKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAFSLGMSESQVKVWFQNRRTKWRKKSAVETPGLPSLSTRGPGDLTPSENEDDEYSKPLDPDSDDEKIR 235          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: soga1 (suppressor of glucose, autophagy associated 1 [Source:Xenbase;Acc:XB-GENE-6049995])

HSP 1 Score: 82.4185 bits (202), Expect = 1.401e-17
Identity = 46/113 (40.71%), Postives = 64/113 (56.64%), Query Frame = 1
Query:  478 PTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKE 816
            P   + T +  +      P + P   +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L MS+SQVK WFQNRRTKWR+++  D  ++ ++
Sbjct:   65 PAVPVSTCSFSYKGTNGNPTVTPFCATRRIGHPYQ--NRTPPKRKKPRTSFSRLQICELEKRFHRQKYLASAERASLAKALRMSDSQVKTWFQNRRTKWRRQTAEDREAERQQ 175          
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Match: cebpa (CCAAT enhancer binding protein alpha [Source:Xenbase;Acc:XB-GENE-853397])

HSP 1 Score: 79.337 bits (194), Expect = 3.224e-16
Identity = 36/74 (48.65%), Postives = 50/74 (67.57%), Query Frame = 1
Query:  589 DRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKN 810
            D+  S++K TR  FS  Q+F LE TF+  RYL+  ERA LA  L ++E+QVK+WFQNRR KW+++   D  + N
Sbjct:  143 DQRSSRKKKTRTVFSRSQVFQLESTFDMKRYLSSSERAGLAASLHLTETQVKIWFQNRRNKWKRQLAADLEAAN 216          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-1 (NK6 homeobox 1 [Source:MGI Symbol;Acc:MGI:1206039])

HSP 1 Score: 137.887 bits (346), Expect = 9.459e-37
Identity = 68/109 (62.39%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++  D++
Sbjct:  218 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGTSENEEDDD 325          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-2 (NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738])

HSP 1 Score: 133.65 bits (335), Expect = 5.002e-36
Identity = 63/102 (61.76%), Postives = 78/102 (76.47%), Query Frame = 1
Query:  568 CQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
             Q   +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + D+   K    D+ D++
Sbjct:  136 AQAGGVLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDD 236          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-2 (NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738])

HSP 1 Score: 133.65 bits (335), Expect = 5.002e-36
Identity = 63/102 (61.76%), Postives = 78/102 (76.47%), Query Frame = 1
Query:  568 CQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
             Q   +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + D+   K    D+ D++
Sbjct:  136 AQAGGVLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSDAEKLKVGGSDAEDDD 236          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Nkx6-3 (NK6 homeobox 3 [Source:MGI Symbol;Acc:MGI:1921811])

HSP 1 Score: 125.946 bits (315), Expect = 2.917e-33
Identity = 64/104 (61.54%), Postives = 73/104 (70.19%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD------------SNSKNKEGNDDSRSQKPSSQDSGDEEGR 879
            K+KHTRPTF+G QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS  +            S  +    N+D    KP   DS DE+ R
Sbjct:  139 KKKHTRPTFTGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSALEPSSSTPRAPGGASGDRAASENEDDEYNKPLDPDSDDEKIR 242          
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Match: Hhex (hematopoietically expressed homeobox [Source:MGI Symbol;Acc:MGI:96086])

HSP 1 Score: 77.411 bits (189), Expect = 1.043e-15
Identity = 44/98 (44.90%), Postives = 52/98 (53.06%), Query Frame = 1
Query:  532 PNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGND 825
            P   P LWS         L R   KRK  +  FS  Q   LEK FE  +YL+ PER RLA +L +SE QVK WFQNRR KWR+    +  S  K+  D
Sbjct:  120 PLGKPLLWS-------PFLQRPLHKRKGGQVRFSNDQTVELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKDALD 210          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|O35762|NKX61_RAT (Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=10116 GN=Nkx6-1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 5.669e-36
Identity = 68/109 (62.39%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++  D++
Sbjct:  218 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGTSENEEDDD 325          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q99MA9|NKX61_MOUSE (Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 GN=Nkx6-1 PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 6.617e-36
Identity = 68/109 (62.39%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++  D++
Sbjct:  218 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGTSENEEDDD 325          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q60554|NKX61_MESAU (Homeobox protein Nkx-6.1 OS=Mesocricetus auratus OX=10036 GN=NKX6-1 PE=1 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 1.691e-35
Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQD 858
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++
Sbjct:  217 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGTSEN 319          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|P78426|NKX61_HUMAN (Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 GN=NKX6-1 PE=1 SV=2)

HSP 1 Score: 136.732 bits (343), Expect = 1.907e-35
Identity = 67/104 (64.42%), Postives = 81/104 (77.88%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQD 858
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K +S++
Sbjct:  217 ARLACTPHQGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKQDSETERLKGASEN 319          
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9C056|NKX62_HUMAN (Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 GN=NKX6-2 PE=1 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 8.659e-35
Identity = 62/97 (63.92%), Postives = 77/97 (79.38%), Query Frame = 1
Query:  583 LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + D+   K    D+ D++
Sbjct:  141 VLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAVEMASAKKKQDSDAEKLKVGGSDAEDDD 236          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: D1LX89 (Nkx6-like transcription factor OS=Saccoglossus kowalevskii OX=10224 PE=2 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.263e-36
Identity = 92/209 (44.02%), Postives = 117/209 (55.98%), Query Frame = 1
Query:  307 SAPNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTF-GIDTSALLWAKAGLPPNINPEL---WSRQFC-------------QPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD-SNSKNKEGNDDSRSQKPSSQDSGDEEGR 879
            ++P  TPHGI DIL         +  + +   P+    N   N  + F  +     KP   G  TSAL W  + +PP  +P     W+R+               Q    LD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGMSESQVKVWFQNRRTKWRK+   + + +K K+   ++ +   S  + G E  R
Sbjct:   53 TSPVATPHGINDIL--------SRPETTMLNVPRI---NTAVNAGMYFSAA-SRFSKPELPGSHTSALYWTPS-MPPVQHPNSLNSWTRERYPCQMGPHSVSTSGQGVMSLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYALGMSESQVKVWFQNRRTKWRKRHAAEMATAKKKQEETENMAGDASEAEDGSENDR 247          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1L8FED6 (Homeobox domain-containing protein OS=Xenopus laevis OX=8355 GN=nkx6-2 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 2.960e-36
Identity = 86/192 (44.79%), Postives = 112/192 (58.33%), Query Frame = 1
Query:  313 PNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSA-LLWAKAGLPPNINPELWS--RQFC--QPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            P  TPHGI DIL     A    S++ + + P+   N    +  + F  +     KP   +   A + W     P  +    W   R  C  Q   LLD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  +  K+ + ++   K SS +  D+E
Sbjct:   59 PLATPHGISDILGRPLGATLGSSSNLLTSLPR--INGLATSTGMYFNPAVSRYPKPLTELPGRAPIFW-----PGVMQSSPWRDPRLACATQAGMLLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMATAKKKHDSETEKMKESSDNEEDDE 242          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A1S3JI32 (homeobox protein Nkx-6.2 OS=Lingula unguis OX=7574 GN=LOC106173106 PE=4 SV=1)

HSP 1 Score: 142.895 bits (359), Expect = 7.002e-36
Identity = 87/190 (45.79%), Postives = 109/190 (57.37%), Query Frame = 1
Query:  310 APNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGI-DTSALLW-AKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
             PN TPHGI DIL S        +N  I   P+  S        + + +S    CKP   +   + + W   A + P    +       Q    +D+D  K+KHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K    + R+Q+  S D+ D E
Sbjct:  100 GPNSTPHGITDIL-SRPLPYGTTANLSI---PRLNSTG------MYYPQSRFPSCKPLADLPGRTPIYWPGVAAMGPQWRAQQGDSYLVQGNMSVDKD-GKKKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYALGMTESQVKVWFQNRRTKWRKKHAAEMATAKKR--QEERAQQMDSSDTEDSE 276          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: A0A3B3BG08 (NK6 homeobox 1 OS=Oryzias melastigma OX=30732 PE=4 SV=1)

HSP 1 Score: 141.739 bits (356), Expect = 2.587e-35
Identity = 86/193 (44.56%), Postives = 107/193 (55.44%), Query Frame = 1
Query:  316 NVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELW-----------SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSS 852
            + TPHGI DIL +  SA    +   +   P+  S +P     + F      +    +    + L        P   P  W           +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  S  K+ + ++   K +S
Sbjct:   83 SATPHGINDIL-NRPSAAGPPAAGLLPGLPRFSSLSPPPPPGLYFSPGAAAVAVARYPKPLAEL--------PGRTPIFWPGVMQSPHWRDARFACSPHQNSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMASAKKKQDSETERLKGAS 265          
BLAST of Homeobox domain-containing protein vs. TrEMBL
Match: G3U0A4 (Homeobox domain-containing protein OS=Loxodonta africana OX=9785 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.986e-35
Identity = 66/101 (65.35%), Postives = 80/101 (79.21%), Query Frame = 1
Query:  571 QPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            Q + LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +K K+ ++  R +  S  +  D++
Sbjct:    1 QGSILLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATKKKQDSETERLKGASENEEEDDD 100          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx6.1 (NK6 homeobox 1 [Source:NCBI gene;Acc:103045404])

HSP 1 Score: 136.732 bits (343), Expect = 8.951e-37
Identity = 69/109 (63.30%), Postives = 84/109 (77.06%), Query Frame = 1
Query:  556 SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + ++   K SS++  D++
Sbjct:  181 ARFTCSPHQNSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKQDSETERLKGSSENEEDDD 288          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx6.2 (NK6 homeobox 2 [Source:NCBI gene;Acc:103044611])

HSP 1 Score: 134.42 bits (337), Expect = 2.008e-36
Identity = 64/101 (63.37%), Postives = 80/101 (79.21%), Query Frame = 1
Query:  571 QPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
            Q + +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  +  K+ + ++   K SS +  D+E
Sbjct:  141 QASLMLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMATAKKKHDSETEKMKESSDNEDDDE 240          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: nkx6.3 (NK6 homeobox 3 [Source:NCBI gene;Acc:103024294])

HSP 1 Score: 127.872 bits (320), Expect = 5.709e-34
Identity = 85/210 (40.48%), Postives = 108/210 (51.43%), Query Frame = 1
Query:  322 TPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTF--------GIDT-SALLWAKAGLPPNINPELW--SRQFCQPTQLLD--RDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNS----KNKEGNDDSRSQ-------KPSSQDSGDEEGR 879
            TPHGI DIL  S       ++                +  + + + +      TF        G+   S+  W   G         W   RQ C  T +        ++KHTRPTFSG QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS ++ +S    + + G D S ++       KP   DS DE+ R
Sbjct:   51 TPHGISDILSRSMMGAPTNTSLIPGYSTMGSFGTTMSSPGVYYNRDYAPAGLGTFPKASAECPGMKGRSSSCWVDGGYD-------WRGGRQQCSNTDMGHPAETVGRKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSASEPSSTQANRTESGRDGSENELEDEEYNKPLDPDSDDEKIR 253          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: tlx2 (T cell leukemia homeobox 2 [Source:NCBI gene;Acc:103046147])

HSP 1 Score: 81.6481 bits (200), Expect = 4.200e-17
Identity = 47/114 (41.23%), Postives = 69/114 (60.53%), Query Frame = 1
Query:  481 TFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGN 822
            TF    S+  +AK  L  +++P   +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR+++  +  ++ ++ N
Sbjct:  140 TFPWMESSRRFAKDRLTASLSPFSVTRRIGHPYQ--NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERATLAKALKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAN 251          
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055288.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000111.1:341656:348959:-1 gene:ENSAMXG00000038858.1 transcript:ENSAMXT00000055288.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 77.0258 bits (188), Expect = 1.022e-15
Identity = 40/89 (44.94%), Postives = 57/89 (64.04%), Query Frame = 1
Query:  556 SRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGN 822
            +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR+++  +  ++ ++ N
Sbjct:  128 TRRVGHPYQ--NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAN 214          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: HMX1 (H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:5017])

HSP 1 Score: 70.8626 bits (172), Expect = 2.118e-15
Identity = 32/59 (54.24%), Postives = 43/59 (72.88%), Query Frame = 1
Query:  607 RKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            +K TR  FS  Q+F LE TF+  RYL+  ERA LA  L ++E+QVK+WFQNRR KW+++
Sbjct:    1 KKKTRTVFSRSQVFQLESTFDMKRYLSSAERAGLAASLHLTETQVKIWFQNRRNKWKRQ 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: hhex (pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-1 gene:ENSPMAG00000009445.1 transcript:ENSPMAT00000010429.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:hhex)

HSP 1 Score: 72.4034 bits (176), Expect = 6.278e-15
Identity = 42/100 (42.00%), Postives = 55/100 (55.00%), Query Frame = 1
Query:  541 NPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRK-KSCTDSNSKNKEGNDDSRS 837
             P LW+         L R   KRK  +  FS +Q   LE+ FE+ +YL+  ER  LA LL +SE QVK WFQNRR KWR+ K    S+ K + G   +R+
Sbjct:  128 KPLLWA-------PFLPRPAHKRKGGQVRFSSEQTVELERKFERQKYLSPGERKGLAKLLQLSERQVKTWFQNRRAKWRRLKQELPSDGKVESGESGARA 220          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010860.1 (pep scaffold:Pmarinus_7.0:GL477006:70988:76921:1 gene:ENSPMAG00000009840.1 transcript:ENSPMAT00000010860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 6.903e-15
Identity = 35/80 (43.75%), Postives = 48/80 (60.00%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQK 843
            KR  +R  FS  Q   LEK F+  +Y+  P+R +LA +LG++++QVKVWFQNRR KWR       +SK  E   D   +K
Sbjct:   20 KRAWSRAVFSSLQRKGLEKRFQVQKYVTKPDRRQLAAMLGLTDAQVKVWFQNRRMKWR-------HSKEAEAQKDKEKEK 92          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: dlx5a (distal-less homeobox 5a [Source:NCBI gene;Acc:30569])

HSP 1 Score: 72.4034 bits (176), Expect = 2.293e-14
Identity = 40/112 (35.71%), Postives = 64/112 (57.14%), Query Frame = 1
Query:  577 TQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKIL 912
             ++++    K +  R  +S  Q+ AL++ F+QT+YLA PERA LA  LG++++QVK+WFQNRR+K++K      N +         S  P + +S    GR+ Q   S+  L
Sbjct:  192 VRMVNGKPKKIRKPRTIYSSFQLAALQRRFQQTQYLALPERAELAASLGLTQTQVKIWFQNRRSKFKK---LGKNGEMAPAQASPSSSDPMACNSPASPGRQHQQLGSAAPL 300          
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Match: tlx1 (T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-021021-2])

HSP 1 Score: 70.4774 bits (171), Expect = 4.570e-14
Identity = 35/63 (55.56%), Postives = 43/63 (68.25%), Query Frame = 1
Query:  589 DRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWR 777
            +R   KRK  R +F+  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR
Sbjct:  224 NRTPPKRKKPRTSFTRLQICELEKRFHRQKYLASAERAALAKALKMTDAQVKTWFQNRRTKWR 286          
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Match: PHO2 (Homeobox transcription factor; regulatory targets include genes involved in phosphate metabolism; binds cooperatively with Pho4p to the PHO5 promoter; phosphorylation of Pho2p facilitates interaction with Pho4p; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002264])

HSP 1 Score: 48.521 bits (114), Expect = 9.779e-7
Identity = 24/58 (41.38%), Postives = 35/58 (60.34%), Query Frame = 1
Query:  610 KHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            K TR    G+ +  L++ FE     +  ER +++ L+GM E  V++WFQNRR K RKK
Sbjct:   80 KRTRA--KGEALDVLKRKFEINPTPSLVERKKISDLIGMPEKNVRIWFQNRRAKLRKK 135          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO30887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZI0])

HSP 1 Score: 134.035 bits (336), Expect = 9.498e-39
Identity = 67/96 (69.79%), Postives = 74/96 (77.08%), Query Frame = 1
Query:  595 DCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKE--GNDDSRSQKPSSQDSGDEEG 876
            D SKRKHTRPTFSG QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   + N K KE  GN+       SS +  D EG
Sbjct:    2 DDSKRKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMNIKRKEISGNE-------SSHEESDNEG 90          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: ANTH.HBXC.NV (NK-like 20; Predicted protein [Source:UniProtKB/TrEMBL;Acc:Q0N4G2])

HSP 1 Score: 73.9442 bits (180), Expect = 5.984e-17
Identity = 34/59 (57.63%), Postives = 46/59 (77.97%), Query Frame = 1
Query:  607 RKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            +K  R TF+G+QIF LEK FE  +YL   ER+ +A LL ++E+QVK+WFQNRRTKW+K+
Sbjct:    1 KKKARTTFTGRQIFELEKQFEAKKYLTATERSDMASLLNVTETQVKIWFQNRRTKWKKQ 59          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: NK-3 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7L1])

HSP 1 Score: 75.8702 bits (185), Expect = 1.026e-15
Identity = 32/60 (53.33%), Postives = 45/60 (75.00%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            +RK +R  FS QQ+F LE+ F   +YL+GPERA LA  L ++E+QVK+WFQNRR K +++
Sbjct:  129 RRKRSRAAFSHQQVFELERRFSHQKYLSGPERADLAAALKLTETQVKIWFQNRRYKTKRR 188          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: EDO48767 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI78])

HSP 1 Score: 69.3218 bits (168), Expect = 3.018e-15
Identity = 31/60 (51.67%), Postives = 44/60 (73.33%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            ++K TR  FS  Q++ LE TF+  RYL+  ERA LA  L ++E+QVK+WFQNRR KW+++
Sbjct:    1 RKKKTRTVFSRSQVYQLESTFDMKRYLSSSERAGLASQLHLTETQVKIWFQNRRNKWKRQ 60          
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Match: NK-1 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI80])

HSP 1 Score: 73.9442 bits (180), Expect = 5.834e-15
Identity = 32/60 (53.33%), Postives = 44/60 (73.33%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            K +  R  F+ +Q+ ALE  F+ TRYL+  ER  LA  LG++E+QVK+WFQNRRTKW+K+
Sbjct:  156 KPRRARTAFTYEQLVALENKFKSTRYLSVCERLNLALSLGLTETQVKIWFQNRRTKWKKQ 215          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.1 (NK6 homeobox 1 [Source:NCBI gene;Acc:101156548])

HSP 1 Score: 139.043 bits (349), Expect = 4.493e-38
Identity = 85/194 (43.81%), Postives = 106/194 (54.64%), Query Frame = 1
Query:  316 NVTPHGIMDIL-KSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELW-----------SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSS 852
            + TPHGI DIL + S       +   +   P+  S +P     + F      +    +    + L        P   P  W           +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  S  K+ + ++   K +S
Sbjct:   61 SATPHGINDILNRPSAGGAAAPAAGILSGLPRFSSLSPPPPPGLYFSPGAAAVAVARYPKPLAEL--------PGRTPIFWPGVMQSPHWRDARFACSPHQNSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMASAKKKQDSETERLKGAS 245          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.1 (NK6 homeobox 1 [Source:NCBI gene;Acc:101156548])

HSP 1 Score: 139.043 bits (349), Expect = 6.775e-37
Identity = 85/194 (43.81%), Postives = 106/194 (54.64%), Query Frame = 1
Query:  316 NVTPHGIMDIL-KSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELW-----------SRQFCQPTQ---LLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSS 852
            + TPHGI DIL + S       +   +   P+  S +P     + F      +    +    + L        P   P  W           +R  C P Q   LLD+D  KRKHTRPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKK   +  S  K+ + ++   K +S
Sbjct:  181 SATPHGINDILNRPSAGGAAAPAAGILSGLPRFSSLSPPPPPGLYFSPGAAAVAVARYPKPLAEL--------PGRTPIFWPGVMQSPHWRDARFACSPHQNSVLLDKD-GKRKHTRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKHAAEMASAKKKQDSETERLKGAS 365          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.2 (NK6 homeobox 2 [Source:NCBI gene;Acc:101156349])

HSP 1 Score: 134.42 bits (337), Expect = 1.984e-36
Identity = 64/102 (62.75%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  568 CQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEE 873
             Q   +LD+D  K+KH+RPTFSGQQIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRK+   +  S  K+ + ++   K SS++  D+E
Sbjct:  144 AQANIMLDKD-GKKKHSRPTFSGQQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKRHAAEMASAKKKHDSETEKMKESSENEDDDE 244          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: nkx6.3 (NK6 homeobox 3 [Source:NCBI gene;Acc:101175486])

HSP 1 Score: 123.635 bits (309), Expect = 1.631e-32
Identity = 56/68 (82.35%), Postives = 63/68 (92.65%), Query Frame = 1
Query:  601 SKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNS 804
            S++KHTRPTFSG QIFALEKTFEQT+YLAGPERARLA+ LGM+ESQVKVWFQNRRTKWRKKS ++  S
Sbjct:  147 SRKKHTRPTFSGHQIFALEKTFEQTKYLAGPERARLAYSLGMTESQVKVWFQNRRTKWRKKSASEPTS 214          
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000004940.2 (T cell leukemia homeobox 3 [Source:NCBI gene;Acc:101161249])

HSP 1 Score: 79.337 bits (194), Expect = 2.134e-16
Identity = 47/122 (38.52%), Postives = 68/122 (55.74%), Query Frame = 1
Query:  457 SFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGN 822
             F  +C P  G       +AK  +   + P   +R+   P Q  +R   KRK  R +FS  QI  LEK F + +YLA  ERA LA  L M+++QVK WFQNRRTKWR+++  +  ++ ++ N
Sbjct:  123 GFGGLCFPWIGNR-----FAKDRISAALVPFAVTRRIGHPYQ--NRTPPKRKKPRTSFSRVQICELEKRFHRQKYLASAERAALAKSLKMTDAQVKTWFQNRRTKWRRQTAEEREAERQQAN 237          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000002774.1 (SMESG000002774.1)

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 347/347 (100.00%), Postives = 347/347 (100.00%), Query Frame = 1
Query:   25 MTSTWDKSSFISFCHTPSSLIIPTSNQHSLQYPSICHLSSFRLPLTSPADDKCLTSPIMNPVWTLMREKDQFNGHXXXXXXXXXXXXXXXXXDKSAPNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILDFTNCGFSSINEPIQNDQETGIDFTKPNHNNQMSNILVMSDFAFMNPRKEN 1065
            MTSTWDKSSFISFCHTPSSLIIPTSNQHSLQYPSICHLSSFRLPLTSPADDKCLTSPIMNPVWTLMREKDQFNGHNFNISSSSSPNHSNARSDKSAPNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILDFTNCGFSSINEPIQNDQETGIDFTKPNHNNQMSNILVMSDFAFMNPRKEN
Sbjct:    1 MTSTWDKSSFISFCHTPSSLIIPTSNQHSLQYPSICHLSSFRLPLTSPADDKCLTSPIMNPVWTLMREKDQFNGHNFNISSSSSPNHSNARSDKSAPNVTPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILDFTNCGFSSINEPIQNDQETGIDFTKPNHNNQMSNILVMSDFAFMNPRKEN 347          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000023118.1 (SMESG000023118.1)

HSP 1 Score: 131.339 bits (329), Expect = 1.685e-35
Identity = 82/163 (50.31%), Postives = 92/163 (56.44%), Query Frame = 1
Query:  322 TPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQF---CQPTQLLD--RDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD 795
            TPHGIMDIL                                    S I+  KP F    S L  AK   PP INP   S+     C  T++     D ++RKHTRPTFSGQQIFALEK FEQT+YLAGPER RLA+LLGMSESQVKVWFQNRRTKWRK+S  +
Sbjct:   69 TPHGIMDIL------------------------------------SRIENPKPEF---YSTLNTAK---PPLINPIKKSKSENSNCSDTRISSPINDSNRRKHTRPTFSGQQIFALEKKFEQTKYLAGPERTRLAYLLGMSESQVKVWFQNRRTKWRKRSAAE 189          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000023118.1 (SMESG000023118.1)

HSP 1 Score: 131.339 bits (329), Expect = 2.096e-35
Identity = 84/163 (51.53%), Postives = 95/163 (58.28%), Query Frame = 1
Query:  322 TPHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDICKPTFGIDTSALLWAKAGLPPNINPELWSRQF---CQPTQLLD--RDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKKSCTD 795
            TPHGIMDIL            S+I+        NP                KP F    S L  AK   PP INP   S+     C  T++     D ++RKHTRPTFSGQQIFALEK FEQT+YLAGPER RLA+LLGMSESQVKVWFQNRRTKWRK+S  +
Sbjct:   78 TPHGIMDIL------------SRIE--------NP----------------KPEFY---STLNTAK---PPLINPIKKSKSENSNCSDTRISSPINDSNRRKHTRPTFSGQQIFALEKKFEQTKYLAGPERTRLAYLLGMSESQVKVWFQNRRTKWRKRSAAE 198          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000021901.1 (SMESG000021901.1)

HSP 1 Score: 80.8777 bits (198), Expect = 4.652e-17
Identity = 36/60 (60.00%), Postives = 47/60 (78.33%), Query Frame = 1
Query:  604 KRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            K+K +R TFSG+QI  LEK FE  +YL+  ERA LA  L ++E+QVK+WFQNRRTKW+K+
Sbjct:  146 KKKKSRTTFSGRQICELEKQFELKKYLSSAERAELASSLNVTETQVKIWFQNRRTKWKKQ 205          
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Match: SMESG000033792.1 (SMESG000033792.1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.152e-15
Identity = 35/76 (46.05%), Postives = 49/76 (64.47%), Query Frame = 1
Query:  556 SRQFCQPTQLLDRDCSKRKHTRPTFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKWRKK 783
            SR F +    + R    +K TR  FS  Q+F LE TF+  RYL+  ER+ LA  L ++E+QVK+WFQNRR KW+++
Sbjct:  177 SRMFSKELLRIKR----KKKTRTVFSRNQVFQLESTFDMKRYLSSSERSSLAHALQLTETQVKIWFQNRRNKWKRQ 248          
The following BLAST results are available for this feature:
BLAST of Homeobox domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NKX6-13.971e-3664.42NK6 homeobox 1 [Source:HGNC Symbol;Acc:HGNC:7839][more]
NKX6-21.803e-3563.92NK6 homeobox 2 [Source:HGNC Symbol;Acc:HGNC:19321][more]
NKX6-31.362e-3441.46NK6 homeobox 3 [Source:HGNC Symbol;Acc:HGNC:26328][more]
HHEX1.276e-1642.74hematopoietically expressed homeobox [Source:HGNC ... [more]
TLX33.342e-1542.11T cell leukemia homeobox 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cog-12.329e-2561.54COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
cog-12.076e-2461.54COG-1B [Source:UniProtKB/TrEMBL;Acc:G5EGF2][more]
ceh-94.843e-1858.33Homeobox protein ceh-9 [Source:UniProtKB/Swiss-Pr... [more]
tab-18.931e-1839.06pep chromosome:WBcel235:II:6803758:6804761:1 gene:... [more]
tab-11.217e-1738.93pep chromosome:WBcel235:II:6803758:6804863:1 gene:... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HGTX5.725e-3281.16gene:FBgn0040318 transcript:FBtr0075720[more]
NK7.14.471e-1852.17gene:FBgn0024321 transcript:FBtr0306742[more]
NK7.14.471e-1852.17gene:FBgn0024321 transcript:FBtr0347151[more]
NK7.14.471e-1852.17gene:FBgn0024321 transcript:FBtr0082942[more]
NK7.14.471e-1852.17gene:FBgn0024321 transcript:FBtr0082941[more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.11.638e-3664.42NK6 homeobox 1 [Source:ZFIN;Acc:ZDB-GENE-040718-17... [more]
nkx6.24.949e-3661.76NK6 homeobox 2 [Source:ZFIN;Acc:ZDB-GENE-070626-1][more]
nkx6.37.625e-3660.75NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7][more]
nkx6.32.928e-3460.75NK6 homeobox 3 [Source:ZFIN;Acc:ZDB-GENE-070810-7][more]
tlx24.931e-1741.23T cell leukemia homeobox 2 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zfand17.497e-3644.26zinc finger AN1-type containing 1 [Source:Xenbase;... [more]
meis18.424e-3662.73Meis homeobox 1 [Source:Xenbase;Acc:XB-GENE-479439... [more]
znf6081.027e-3365.38zinc finger protein 608 [Source:Xenbase;Acc:XB-GEN... [more]
soga11.401e-1740.71suppressor of glucose, autophagy associated 1 [Sou... [more]
cebpa3.224e-1648.65CCAAT enhancer binding protein alpha [Source:Xenba... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nkx6-19.459e-3762.39NK6 homeobox 1 [Source:MGI Symbol;Acc:MGI:1206039][more]
Nkx6-25.002e-3661.76NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738][more]
Nkx6-25.002e-3661.76NK6 homeobox 2 [Source:MGI Symbol;Acc:MGI:1352738][more]
Nkx6-32.917e-3361.54NK6 homeobox 3 [Source:MGI Symbol;Acc:MGI:1921811][more]
Hhex1.043e-1544.90hematopoietically expressed homeobox [Source:MGI S... [more]
back to top
BLAST of Homeobox domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O35762|NKX61_RAT5.669e-3662.39Homeobox protein Nkx-6.1 OS=Rattus norvegicus OX=1... [more]
sp|Q99MA9|NKX61_MOUSE6.617e-3662.39Homeobox protein Nkx-6.1 OS=Mus musculus OX=10090 ... [more]
sp|Q60554|NKX61_MESAU1.691e-3564.42Homeobox protein Nkx-6.1 OS=Mesocricetus auratus O... [more]
sp|P78426|NKX61_HUMAN1.907e-3564.42Homeobox protein Nkx-6.1 OS=Homo sapiens OX=9606 G... [more]
sp|Q9C056|NKX62_HUMAN8.659e-3563.92Homeobox protein Nkx-6.2 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Homeobox domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
D1LX892.263e-3644.02Nkx6-like transcription factor OS=Saccoglossus kow... [more]
A0A1L8FED62.960e-3644.79Homeobox domain-containing protein OS=Xenopus laev... [more]
A0A1S3JI327.002e-3645.79homeobox protein Nkx-6.2 OS=Lingula unguis OX=7574... [more]
A0A3B3BG082.587e-3544.56NK6 homeobox 1 OS=Oryzias melastigma OX=30732 PE=4... [more]
G3U0A42.986e-3565.35Homeobox domain-containing protein OS=Loxodonta af... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.18.951e-3763.30NK6 homeobox 1 [Source:NCBI gene;Acc:103045404][more]
nkx6.22.008e-3663.37NK6 homeobox 2 [Source:NCBI gene;Acc:103044611][more]
nkx6.35.709e-3440.48NK6 homeobox 3 [Source:NCBI gene;Acc:103024294][more]
tlx24.200e-1741.23T cell leukemia homeobox 2 [Source:NCBI gene;Acc:1... [more]
ENSAMXT00000055288.11.022e-1544.94pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HMX12.118e-1554.24H6 family homeobox 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
hhex6.278e-1542.00pep scaffold:Pmarinus_7.0:GL476649:273574:289580:-... [more]
ENSPMAT00000010860.16.903e-1543.75pep scaffold:Pmarinus_7.0:GL477006:70988:76921:1 g... [more]
dlx5a2.293e-1435.71distal-less homeobox 5a [Source:NCBI gene;Acc:3056... [more]
tlx14.570e-1455.56T cell leukemia homeobox 1 [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PHO29.779e-741.38Homeobox transcription factor; regulatory targets ... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO308879.498e-3969.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTH.HBXC.NV5.984e-1757.63NK-like 20; Predicted protein [Source:UniProtKB/T... [more]
NK-31.026e-1553.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487673.018e-1551.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
NK-15.834e-1553.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkx6.14.493e-3843.81NK6 homeobox 1 [Source:NCBI gene;Acc:101156548][more]
nkx6.16.775e-3743.81NK6 homeobox 1 [Source:NCBI gene;Acc:101156548][more]
nkx6.21.984e-3662.75NK6 homeobox 2 [Source:NCBI gene;Acc:101156349][more]
nkx6.31.631e-3282.35NK6 homeobox 3 [Source:NCBI gene;Acc:101175486][more]
ENSORLT00000004940.22.134e-1638.52T cell leukemia homeobox 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Homeobox domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000002774.10.000e+0100.00SMESG000002774.1[more]
SMESG000023118.11.685e-3550.31SMESG000023118.1[more]
SMESG000023118.12.096e-3551.53SMESG000023118.1[more]
SMESG000021901.14.652e-1760.00SMESG000021901.1[more]
SMESG000033792.11.152e-1546.05SMESG000033792.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016301 ID=SMED30016301|Name=Homeobox domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1137bp
TCATTATAGTATTCAGCAGTCATTATGACGTCTACCTGGGATAAGTCAAG
CTTCATTAGTTTTTGTCACACTCCATCATCCTTAATAATTCCAACTTCAA
ACCAACATTCTCTTCAGTATCCATCCATTTGTCACTTATCGTCTTTTCGT
TTGCCATTAACTAGTCCTGCAGATGATAAATGTTTAACCTCTCCAATTAT
GAATCCAGTTTGGACTCTGATGCGTGAAAAAGATCAATTCAATGGACACA
ATTTCAATATCTCATCATCCTCGTCTCCAAATCACAGTAATGCAAGATCT
GATAAATCTGCTCCCAATGTCACTCCTCATGGTATCATGGATATTCTCAA
AAGCTCTCAATCGGCAGACGATGAAAAATCCAATTCTCAAATCGACACCG
AACCGAAACAACAGTCAAACAATCCATGTCAAAACCGATCTATCGAATTT
GAGAAATCTTTTATCGACATTTGTAAACCGACTTTCGGCATTGACACATC
AGCTTTGCTGTGGGCGAAAGCCGGCTTGCCGCCAAACATAAATCCGGAAT
TATGGTCTCGACAATTCTGCCAACCAACTCAACTACTCGACAGAGATTGC
AGCAAACGGAAACATACTCGCCCCACGTTTTCCGGTCAGCAGATTTTTGC
TCTCGAGAAAACCTTCGAACAGACTCGATATCTTGCCGGTCCAGAAAGAG
CAAGATTGGCGTTCTTATTAGGAATGTCTGAAAGTCAAGTCAAAGTTTGG
TTTCAAAACAGACGCACAAAATGGAGAAAGAAAAGTTGCACTGACAGCAA
CAGTAAAAACAAAGAAGGAAACGACGATAGCAGAAGTCAAAAGCCGAGTT
CTCAAGATAGCGGTGATGAAGAAGGGCGAGAGAGTCAACATTCCGAGTCT
AGCAAAATCCTCGATTTCACAAACTGCGGATTCTCAAGCATCAACGAACC
AATCCAGAACGACCAAGAAACTGGAATAGATTTCACAAAACCAAATCACA
ACAATCAGATGTCAAATATTCTTGTAATGTCGGACTTTGCATTTATGAAT
CCGAGAAAGGAGAACTAGATATTATAACGATGTAAATATGAATTTCAAGA
AAGATAAAATGTAGATTAAATAAATGAGATATAACGG
back to top

protein sequence of SMED30016301-orf-1

>SMED30016301-orf-1 ID=SMED30016301-orf-1|Name=SMED30016301-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=348bp
MTSTWDKSSFISFCHTPSSLIIPTSNQHSLQYPSICHLSSFRLPLTSPAD
DKCLTSPIMNPVWTLMREKDQFNGHNFNISSSSSPNHSNARSDKSAPNVT
PHGIMDILKSSQSADDEKSNSQIDTEPKQQSNNPCQNRSIEFEKSFIDIC
KPTFGIDTSALLWAKAGLPPNINPELWSRQFCQPTQLLDRDCSKRKHTRP
TFSGQQIFALEKTFEQTRYLAGPERARLAFLLGMSESQVKVWFQNRRTKW
RKKSCTDSNSKNKEGNDDSRSQKPSSQDSGDEEGRESQHSESSKILDFTN
CGFSSINEPIQNDQETGIDFTKPNHNNQMSNILVMSDFAFMNPRKEN*
back to top
Aliases
The feature 'Homeobox domain-containing protein' has the following synonyms
Synonym
nkx6-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000103central nervous system
PLANA:0002032epidermal cell
Vocabulary: molecular function
TermDefinition
GO:0043565sequence-specific DNA binding
GO:0003677DNA binding
Vocabulary: INTERPRO
TermDefinition
IPR020479Homeobox_metazoa
IPR000047HTH_motif
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 217..228
score: 39.01
coord: 242..251
score: 73.73
coord: 232..242
score: 51.41
IPR000047Helix-turn-helix motifPRINTSPR00031HTHREPRESSRcoord: 224..233
score: 49.9
coord: 233..249
score: 57.8
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 193..257
e-value: 2.6E-22
score: 90.1
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 196..252
e-value: 2.1E-20
score: 72.3
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 193..253
score: 19.5
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 196..254
e-value: 9.91102E-19
score: 76.8984
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 194..257
e-value: 1.9E-23
score: 83.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 114..136
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..96
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 253..292
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 253..294
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 80..136
NoneNo IPR availablePANTHERPTHR24340FAMILY NOT NAMEDcoord: 139..279
NoneNo IPR availablePANTHERPTHR24340:SF35GTX/NKX6B-LIKE HOMEODOMAIN PROTEINcoord: 139..279
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 228..251
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 180..253