Reverse transcriptase domain-containing protein

Overview
NameReverse transcriptase domain-containing protein
Smed IDSMED30016287
Length (bp)2756
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Reverse transcriptase domain-containing protein (SMED30016287) t-SNE clustered cells

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30016287) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Reverse transcriptase domain-containing protein (SMED30016287) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Reverse transcriptase domain-containing protein (SMED30016287) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016287

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 97

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
GABAergic neuronSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pigment cellSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000001897.1 SMESG000068881.1 SMESG000064552.1 SMESG000056926.1 SMESG000050300.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000006554.1 SMESG000005066.1 SMESG000050492.1 SMESG000070487.1 SMESG000063831.1 SMESG000047318.1 SMESG000047014.1 SMESG000030931.1 SMESG000023641.1 SMESG000013665.1 SMESG000008519.1 dd_Smed_v6_129_2dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060389.1 SMESG000060365.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig17772uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065669.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig12382uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000077556.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000043973.1 SMESG000041346.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000007021.1 SMESG000073618.1 Contig30565newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000077556.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000043973.1 SMESG000041346.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000007021.1 SMESG000073618.1 Contig30565uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000079542.1 SMESG000071441.1 SMESG000059599.1 SMESG000047025.1 SMESG000047024.1 SMESG000046893.1 SMESG000041246.1 SMESG000029087.1 SMESG000013749.1 SMESG000010825.1 SMESG000008086.1 SMESG000077611.1 SMESG000073729.1 SMESG000055578.1 SMESG000055415.1 SMESG000052110.1 SMESG000050492.1 SMESG000039167.1 SMESG000036922.1 SMESG000033763.1 SMESG000027381.1 SMESG000070487.1 SMESG000018675.1 SMESG000018320.1 SMESG000011196.1 SMESG000008519.1 Contig44875uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000073618.1 SMESG000018675.1 SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 Contig55788uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000018675.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000049778.1 SMESG000048378.1 SMESG000039792.1 SMESG000039423.1 SMESG000039356.1 SMESG000033763.1 SMESG000024543.1 SMESG000022136.1 SMESG000018320.1 SMESG000012464.1 SMESG000007021.1 SMESG000002434.1 Contig53455uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000077556.1 SMESG000018675.1 SMESG000013089.1 Contig21808newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000077556.1 SMESG000018675.1 SMESG000013089.1 Contig21808newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000077556.1 SMESG000018675.1 SMESG000013089.1 Contig21808uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000077556.1 SMESG000018675.1 SMESG000013089.1 Contig21808uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
oocyteSMED30016287SMESG000079250.1 SMESG000048159.1 SMESG000036661.1 SMESG000028496.1 Contig9971newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
vitelline glandSMED30016287SMESG000079250.1 SMESG000048159.1 SMESG000036661.1 SMESG000028496.1 Contig9971newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016287SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000053120.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig20396uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
neuronSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000013738.1 SMESG000040932.1 SMESG000029286.1 SMESG000027381.1 SMESG000018320.1 SMESG000013737.1 SMESG000079557.1 SMESG000073618.1 SMESG000050300.1 SMESG000017256.1 Contig12573newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000013738.1 SMESG000040932.1 SMESG000029286.1 SMESG000027381.1 SMESG000018320.1 SMESG000013737.1 SMESG000079557.1 SMESG000073618.1 SMESG000050300.1 SMESG000017256.1 Contig12573uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000071073.1 SMESG000050492.1 SMESG000050479.1 SMESG000040932.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000024526.1 SMESG000024525.1 SMESG000019968.1 SMESG000018320.1 SMESG000015102.1 SMESG000007021.1 SMESG000006554.1 SMESG000079557.1 SMESG000073618.1 SMESG000071198.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000011196.1 SMESG000005066.1 Contig16229newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000071073.1 SMESG000050492.1 SMESG000050479.1 SMESG000040932.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000024526.1 SMESG000024525.1 SMESG000019968.1 SMESG000018320.1 SMESG000015102.1 SMESG000007021.1 SMESG000006554.1 SMESG000079557.1 SMESG000073618.1 SMESG000071198.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000011196.1 SMESG000005066.1 Contig16229uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000003705.1 SMESG000018675.1 Contig15583uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019776.1 SMESG000019761.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010348.1 SMESG000010333.1 SMESG000010322.1 SMESG000007021.1 SMESG000056926.1 Contig15760uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020523.1 SMESG000020398.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 Contig13279newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000020523.1 SMESG000020398.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 Contig13279uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000077556.1 SMESG000067334.1 SMESG000063632.1 SMESG000054682.1 SMESG000054673.1 SMESG000049555.1 SMESG000049554.1 SMESG000049551.1 SMESG000040257.1 SMESG000015216.1 Contig14346newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000077556.1 SMESG000067334.1 SMESG000063632.1 SMESG000054682.1 SMESG000054673.1 SMESG000049555.1 SMESG000049554.1 SMESG000049551.1 SMESG000040257.1 SMESG000015216.1 Contig14346uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000039741.1 Contig12688newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000039741.1 Contig12688uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000067334.1 SMESG000060260.1 SMESG000039792.1 SMESG000039741.1 SMESG000033763.1 SMESG000026649.1 SMESG000021640.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000056926.1 SMESG000018675.1 Contig13423uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073852.1 SMESG000073851.1 SMESG000073618.1 SMESG000071859.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015102.1 SMESG000012464.1 SMESG000007021.1 SMESG000068881.1 SMESG000056926.1 SMESG000043279.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000005066.1 Contig11477uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000069110.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000018675.1 Contig48540uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000077813.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000068262.1 SMESG000067334.1 SMESG000064992.1 SMESG000064086.1 SMESG000060260.1 SMESG000050492.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000026762.1 SMESG000025022.1 SMESG000021640.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000012464.1 SMESG000011816.1 SMESG000007021.1 SMESG000000031.1 SMESG000070487.1 SMESG000068881.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000018675.1 SMESG000017256.1 SMESG000013089.1 SMESG000011196.1 SMESG000008519.1 SMESG000005066.1 Contig40604uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071434.1 SMESG000068262.1 SMESG000067334.1 SMESG000064600.1 SMESG000050479.1 SMESG000044971.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000022791.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000009106.1 SMESG000007021.1 SMESG000018675.1 Contig46895newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071434.1 SMESG000068262.1 SMESG000067334.1 SMESG000064600.1 SMESG000050479.1 SMESG000044971.1 SMESG000039792.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000022791.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000009106.1 SMESG000007021.1 SMESG000018675.1 Contig46895uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000050479.1 SMESG000016292.1 SMESG000016256.1 SMESG000015216.1 SMESG000009922.1 SMESG000016303.1 Contig44698uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000071859.1 SMESG000068262.1 SMESG000067334.1 SMESG000066808.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039356.1 SMESG000033763.1 SMESG000020398.1 SMESG000015216.1 SMESG000007021.1 Contig42381uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000068262.1 SMESG000051528.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000015216.1 SMESG000007021.1 Contig55839newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000068262.1 SMESG000051528.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000015216.1 SMESG000007021.1 Contig55839uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
whole organismSMED30016287SMESG000077556.1 SMESG000077167.1 SMESG000071434.1 SMESG000021640.1 SMESG000018675.1 Contig19453newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
whole organismSMED30016287SMESG000077556.1 SMESG000077167.1 SMESG000071434.1 SMESG000021640.1 SMESG000018675.1 Contig19453uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016287SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30016287SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SMED30032823smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30016287SMESG000073618.1 SMESG000073174.1 SMESG000059623.1 SMESG000050300.1 SMESG000040932.1 SMESG000025201.1 SMESG000006554.1 SMESG000079557.1 SMESG000069853.1 SMESG000050880.1 SMESG000043279.1 SMESG000028068.1 SMESG000018675.1 SMESG000018320.1 SMESG000016710.1 SMESG000016088.1 SMESG000005066.1 SMESG000002984.1 SMESG000081574.1 SMESG000081529.1 SMESG000078601.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000072739.1 SMESG000071859.1 SMESG000071198.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000062504.1 SMESG000060952.1 SMESG000060260.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000047126.1 SMESG000044971.1 SMESG000043973.1 SMESG000040474.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029537.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000015216.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000007021.1 SmedASXL_018089SmedAsxl_ww_GCZZ01PMID:29158443
He et al., 2017
whole organism asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021640.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000017296.1 SMESG000017295.1 SMESG000017294.1 SMESG000018675.1 Contig18951uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000003949.1 Contig31582newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000003949.1 Contig31582uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000050479.1 SMESG000026600.1 SMESG000019968.1 SMESG000018885.1 SMESG000013089.1 SMESG000008152.1 Contig36611newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000050479.1 SMESG000026600.1 SMESG000019968.1 SMESG000018885.1 SMESG000013089.1 SMESG000008152.1 Contig36611uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000080919.1 SMESG000077556.1 SMESG000073961.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000052524.1 SMESG000044971.1 SMESG000043973.1 SMESG000042719.1 SMESG000039356.1 SMESG000021640.1 SMESG000015117.1 SMESG000012464.1 SMESG000007021.1 SMESG000064571.1 Contig20236uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000077556.1 SMESG000073618.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000021640.1 SMESG000021522.1 SMESG000018320.1 SMESG000012464.1 SMESG000007865.1 SMESG000007864.1 SMESG000007021.1 Contig20246uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081696.1 Contig17718newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081696.1 Contig17718uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000077556.1 SMESG000050479.1 SMESG000044971.1 SMESG000038481.1 SMESG000015216.1 Contig21206uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081529.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071859.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000060260.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000041949.1 SMESG000041948.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000033763.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000007021.1 SMESG000025201.1 Contig17437uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000066407.1 SMESG000053709.1 SMESG000053708.1 SMESG000046471.1 SMESG000044282.1 Contig18438uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081199.1 SMESG000076404.1 SMESG000069658.1 SMESG000068312.1 SMESG000067818.1 SMESG000067334.1 SMESG000066383.1 SMESG000061623.1 SMESG000060260.1 SMESG000056465.1 SMESG000051141.1 SMESG000044801.1 SMESG000043241.1 SMESG000042662.1 SMESG000033772.1 SMESG000033266.1 SMESG000022351.1 SMESG000012636.1 SMESG000010351.1 SMESG000009500.1 SMESG000008761.1 SMESG000008723.1 SMESG000005685.1 SMESG000003859.1 SMESG000002786.1 SMESG000001786.1 Contig37402newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081199.1 SMESG000076404.1 SMESG000069658.1 SMESG000068312.1 SMESG000067818.1 SMESG000067334.1 SMESG000066383.1 SMESG000061623.1 SMESG000060260.1 SMESG000056465.1 SMESG000051141.1 SMESG000044801.1 SMESG000043241.1 SMESG000042662.1 SMESG000033772.1 SMESG000033266.1 SMESG000022351.1 SMESG000012636.1 SMESG000010351.1 SMESG000009500.1 SMESG000008761.1 SMESG000008723.1 SMESG000005685.1 SMESG000003859.1 SMESG000002786.1 SMESG000001786.1 Contig37402uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000080770.1 SMESG000079557.1 SMESG000077556.1 SMESG000073961.1 SMESG000073618.1 SMESG000071198.1 SMESG000068262.1 SMESG000067334.1 SMESG000065333.1 SMESG000060260.1 SMESG000059844.1 SMESG000058646.1 SMESG000055266.1 SMESG000054970.1 SMESG000052813.1 SMESG000050479.1 SMESG000044971.1 SMESG000043973.1 SMESG000043769.1 SMESG000043147.1 SMESG000041246.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000037745.1 SMESG000037601.1 SMESG000036070.1 SMESG000034368.1 SMESG000033763.1 SMESG000031415.1 SMESG000029286.1 SMESG000027381.1 SMESG000021522.1 SMESG000019968.1 SMESG000019663.1 SMESG000018320.1 SMESG000015216.1 SMESG000012464.1 SMESG000010897.1 SMESG000010825.1 SMESG000009005.1 SMESG000007021.1 SMESG000005029.1 SMESG000077800.1 SMESG000054046.1 SMESG000052058.1 SMESG000025201.1 Contig34191uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000044971.1 SMESG000042620.1 SMESG000033763.1 SMESG000020071.1 SMESG000017256.1 SMESG000013089.1 Contig29023newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016287SMESG000044971.1 SMESG000042620.1 SMESG000033763.1 SMESG000020071.1 SMESG000017256.1 SMESG000013089.1 Contig29023uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016287SMESG000081574.1 SMESG000081529.1 SMESG000079557.1 SMESG000079250.1 SMESG000077556.1 SMESG000075496.1 SMESG000073961.1 SMESG000073618.1 SMESG000073174.1 SMESG000071859.1 SMESG000071198.1 SMESG000071073.1 SMESG000070153.1 SMESG000068262.1 SMESG000068028.1 SMESG000067334.1 SMESG000065567.1 SMESG000061192.1 SMESG000060952.1 SMESG000060260.1 SMESG000059623.1 SMESG000050492.1 SMESG000050479.1 SMESG000050299.1 SMESG000049776.1 SMESG000048159.1 SMESG000044971.1 SMESG000043973.1 SMESG000042620.1 SMESG000040932.1 SMESG000039792.1 SMESG000039741.1 SMESG000039356.1 SMESG000034716.1 SMESG000033763.1 SMESG000029286.1 SMESG000028614.1 SMESG000027381.1 SMESG000025022.1 SMESG000021522.1 SMESG000020398.1 SMESG000019968.1 SMESG000018320.1 SMESG000015216.1 SMESG000015117.1 SMESG000015102.1 SMESG000013389.1 SMESG000012534.1 SMESG000012464.1 SMESG000011278.1 SMESG000011147.1 SMESG000007021.1 SMESG000006554.1 SMESG000001897.1 SMESG000070487.1 SMESG000068881.1 SMESG000064552.1 SMESG000063831.1 SMESG000056926.1 SMESG000050300.1 SMESG000047318.1 SMESG000047014.1 SMESG000043279.1 SMESG000030931.1 SMESG000023641.1 SMESG000018675.1 SMESG000017256.1 SMESG000013665.1 SMESG000013089.1 SMESG000011196.1 SMESG000009621.1 SMESG000008519.1 SMESG000005066.1 dd_Smed_v4_129_2_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000035509.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:9:32480079:32481660:1 gene:ENSXETG00000011065.1 transcript:ENSXETT00000035509.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.679 bits (252), Expect = 8.501e-22
Identity = 74/241 (30.71%), Postives = 125/241 (51.87%), Query Frame = 1
Query: 1186 LYGLPKIHKDGV--PMRPVLSMVGTAQYKIAKFLDGLLKPLMRS-EFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCC-ALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYK--RYVDDIFLIFENQ-KHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTD 1887
            LY LPKIHKD +  P RP++S  G+    IA F+D  L+PL++      KDS +F+  + +LQ    +  + + DV SL+T +P    +++   +L  +  +    +D      LL+F  +   F F   ++ Q  G +MGS +AP+ A++++++ E       +   ++ K  RY+DD+F+++    +     +  +NSL   I FT   + +  I+FLDL I        T  YRKPTD
Sbjct:  105 LYTLPKIHKDNLKPPGRPIVSARGSLLQPIATFVDYYLQPLVQGMSTYIKDSGDFLDKLLQLQPLPPHVCLATMDVSSLYTVIPTNQGLEVVRDSLLRQPATNRPPID--FLIHLLQFCLTMNYFKFERSFFLQTSGTSMGSNVAPSFANLYMSNYEHTHILPNYGT-YILKLYRYIDDLFILWTGTCEQFSSMITELNSLPSPIRFTASIDTQ-QISFLDLTITLTPTGIHTTTYRKPTD 341          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000006009.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:5:91782113:91784080:1 gene:ENSXETG00000003080.1 transcript:ENSXETT00000006009.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.227e-16
Identity = 69/265 (26.04%), Postives = 130/265 (49.06%), Query Frame = 1
Query: 1111 GFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVP--MRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQ----FEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLH---KNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRK 1878
            GF  + + + ++   +LP   +    + LPK+HK   P   RP++S +G+   ++++ +D  L+PL++         + V  I  L +        + DV SL++ +P  D   +  +   E  S + +  +      ++F  ++  F F+  +Y Q  G +MG+  APT A++++   E+            K  +YKRYVDD+ LI+   +    F HF++ ++    N+ FT E   K +I+FLDL +  ++   +T I+RK
Sbjct:   46 GF-TRGIFSAKIRDYLLPKHPRIPIFHHLPKVHKKERPPIGRPIVSGIGSLNERLSELIDLYLQPLVQRLTSFVQDTKHVLQIVDLIEWDDTFAWATIDVASLYSCIPH-DRGLIAVSYHLERYSTYDVATQNFILNAIDFLLTHNFFKFDGTFYLQKCGTSMGAKFAPTYANLYMGWWEESHIYGDTLGYAHKIVLYKRYVDDLLLIWRGTE--GEFTHFVDKININDLNLKFTYEFH-KQTISFLDLSLTIRNTRIDTSIFRK 305          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Match: plppr5 (phospholipid phosphatase related 5 [Source:Xenbase;Acc:XB-GENE-983941])

HSP 1 Score: 57.7658 bits (138), Expect = 5.854e-8
Identity = 52/196 (26.53%), Postives = 96/196 (48.98%), Query Frame = 1
Query: 1111 GFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHK--DGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRS-EFECKDSFEFVSCIAKLQ--KRSMNDVMVSFDVCSLFTNVPLVDTIDL-CCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPF 1680
            GF    L  +EV      +K +    + LPK+HK  D V  RP+++ +G+    ++ ++D LL+PL+ S     +D+     CI ++Q  K   +    + DV SL++++    ++ L     W + +            + ++F   +  FLF+ ++Y Q  G AMG+  APT A++F+   E ++  F  + PF
Sbjct:  299 GFSNGVLTTKEVEM----LKCENPVFHVLPKVHKSLDNVKGRPIVASIGSLSENLSCYIDRLLRPLVESLPSYIRDT---TMCINQIQHLKWKPSYRWFTMDVVSLYSSID--HSLGLQAIGYWLDKERIFPKAQSDFILQAVDFLLKSNYFLFDGKFYLQRCGAAMGASFAPTYANLFMGWFE-RLYIFGDQNPF 484          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2B4RB60 (Uncharacterized protein F54H12.2 OS=Stylophora pistillata OX=50429 GN=F54H12.2 PE=4 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 3.325e-64
Identity = 160/493 (32.45%), Postives = 259/493 (52.54%), Query Frame = 1
Query:  706 RVLKFGPNHCIKNRLDETKLCAKIESLYFHIARSMKGIN-GNYVKSSLSASTMEYID----KNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXX--XXXXXXXSPQFVKLP------KGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCC--ALWNE--NDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLI------KNPKDP 2115
            R LKF     I  R+    + A  E  Y+ +   +   N      ++L   T+ YI+    K  K  +R    LK   + +I I K DKG+G+V+LD    +       + ++ +F  +P      +GR +    PL  +E   K+L+  +++ ++ + +  S+ P  S+ A LYGLPK HK+ + MRP+LS   T  + +AK+LD  LKPL  +++   D+F+F   I +L K +  +++VS+DV SLFTNVPL +TI++    A  N   N + +  L R     LL  AT    F FN   Y+Q DGVAMGSPL P +A++F++S+E  +   Q + P  Y+RYVDD   +  +      FLH +NS H ++ FT E E+ S + FL   +       ET++Y KPT+TGL    +S  + +YKR+++K ++ R+  LSS++A+     D+L ++  +  Y +  +   I   +   I      + PK+P
Sbjct:  273 RGLKF----AIPQRVSPMDVKASFEKAYWSLEPQLNDDNLKELSAATLRFVTLNYIERKSPKPPKTLLRAIEELK--GRDDIVITKPDKGSGVVVLDKTEYLRLLSEASVNDTSKFRAIPLEKPKTRGRPSKYYHPLLQKE---KILDSIVRR-ILPKTIADSVSPTGSRLAHLYGLPKTHKEPLAMRPILSATDTYNFPLAKWLDEKLKPLSLNQYTVTDNFDFTKEIHEL-KINKGEILVSYDVSSLFTNVPLDETIEILVNRAFSNNWFNTTHNLALTRTDLIDLLNVATKGQLFQFNGALYEQTDGVAMGSPLGPLLANVFMSSIEDTLER-QRKLPSYYRRYVDDTLTVMPDLATATTFLHTLNSAHTSVKFTMEVEKNSKLPFLGTELLNHAPRIETKVYVKPTNTGLLLHYQSHVDNRYKRSLLKTMLDRAHRLSSSWAHFSDECDRLKKVFARLKYPERLVNSTINTFLQSRIVGTQPTQTPKEP 753          

HSP 2 Score: 54.6842 bits (130), Expect = 3.325e-64
Identity = 47/148 (31.76%), Postives = 78/148 (52.70%), Query Frame = 3
Query: 2217 LVLPYSEGFT-NYKRKLSKQMGNLEYKIVSN------SCKV-RNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIG---MSDFRILLRSFNSYWERVICEALLIRSLDPKINVQS 2627
            +V+P+ +  + NY   + K++ NL  K+ +       S KV +++ + + K  +     +VYQF C+ C+A Y+G T  HL TRV  H R    ++I +H     SE+    +  F IL +  N + + ++ E L IR L P +NVQS
Sbjct:  759 VVIPFKDQESANY---VKKELKNLSMKVQTTVQPVFVSRKVGQDLKVREIKPQIVNQQRVVYQFQCDLCDAGYVGYTRGHLHTRVDGHKR--KASSIYKHYHERHSEVPKDLLKRFSILKKCSNKF-DCLVNEMLFIRDLKPTLNVQS 900          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2B4R879 (Reverse transcriptase domain-containing protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene22923 PE=4 SV=1)

HSP 1 Score: 221.09 bits (562), Expect = 1.207e-63
Identity = 150/451 (33.26%), Postives = 244/451 (54.10%), Query Frame = 1
Query:  844 LSASTMEYI---------DKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXX--XXXXXXXSPQFVKLP------KGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCC--ALWNE--NDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLI------KNPKDP 2115
            LSA+T+ ++          K  K  +R    LK   + +I I K DKG+G+V+LD    +       + ++ +F  +P      +GR +    PL  +E   K+L+  +++ ++ + +  S+ P  S+ A LYGLPK HK+ + MRP+LS   T  + +AK+LD  LKPL  +++   D+F+F   I +L K +  +++VS+DV SLFTNVPL +TI++    A  N   N + +  L R     LL  AT    F FN   Y+Q DGVAMGSPL P +A++F++S+E  +   Q + P  Y+RYVDD   +  +      FLH +NS H ++ FT E E+ S + FL   +       ET++Y KPT+TGL    +S  + +YKR+++K ++ R+  LSS++A+     D+L ++  +  Y +  +   I   +   I      + PK+P
Sbjct:   26 LSAATLRFVALNYIERKSPKPPKTLLRAIEELK--GRDDIVITKPDKGSGVVVLDKTEYLRLLSEASVNDTSKFRAVPLEKPKTRGRPSKYYHPLLQKE---KILDSIVRR-ILPKTIADSVSPTGSRLAHLYGLPKTHKEPLAMRPILSATDTYNFPLAKWLDEKLKPLSLNQYTVTDNFDFTKEIHEL-KINKGEILVSYDVSSLFTNVPLDETIEILVNRAFSNNWFNTTHNLALTRTDLIDLLNVATKGQLFQFNGALYEQTDGVAMGSPLGPLLANVFMSSIEDTLER-QRKLPSYYRRYVDDTLTVMPDLATATTFLHTLNSAHTSVKFTMEVEKNSKLPFLGTELLNHAPRIETKVYVKPTNTGLLLHYQSHVDNRYKRSLLKTMLDRAHRLSSSWAHFSDECDRLKKVFARLKYPERLVNSTINTFLQSRIVGTQPTQTPKEP 468          

HSP 2 Score: 54.299 bits (129), Expect = 1.207e-63
Identity = 45/148 (30.41%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 2217 LVLPYSEGFT-NYKRKLSKQMGNLEYKIVSNSCKV-------RNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIG---MSDFRILLRSFNSYWERVICEALLIRSLDPKINVQS 2627
            +V+P+ +  + NY   + K++ NL  K+ +    V       +++ + + K  +     +VYQF C+ C+A Y+G T  HL TRV  H R    ++I +H     SE+    +  F IL +  N + + ++ E L IR L P +NVQS
Sbjct:  474 VVIPFKDQESANY---VKKELKNLSMKVQTTVQPVFVSRKVGQDLKVREIKPQIVNQQRVVYQFQCDLCDAGYVGYTRGHLHTRVDGHKR--KASSIYKHYHERHSEVPKDLLKRFSILKKCSNKF-DCLVNEMLFIRDLKPTLNVQS 615          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A0X3Q8A9 (Reverse transcriptase (RNA-dependent DNA polymerase) (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR88722 PE=4 SV=1)

HSP 1 Score: 226.483 bits (576), Expect = 4.758e-61
Identity = 159/428 (37.15%), Postives = 239/428 (55.84%), Query Frame = 1
Query:  877 NKKQNIRDFMT------LKNL-AKKNINICKFDKGNGIVIXXXXXXXXXXXXXXXSPQFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKK----KLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMR--SEFECKDSFEFVSCIAKLQKRSMNDV-MVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRK-DKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSV-KSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKD 2112
            NK+  IR  +T      LK L A ++I I + DKG GIVI++    V K++ +L+        K R+  K     DE  V+  L   +K+      +++   + + P+ +   +LYGLPKIHK+G+P+RP+L M  +  + IAK+L   LKP+ R  +    +D+FEF+  +  L   ++N   M+S DV SLFTNVP+ +T+D  C     ++ E  I      ++LL   T NV FLF+N+ Y+QIDGVAMGSPL P +A +F+  LEK   S Q  K   Y RYVDDIF I   + +V+  L+ +N  H +I FT E ER  S+ FLD+L+ R+ D      +YRK T +G Y +  SF   + KRN+V+ L  R+  + +  A+S+ + + K+  LL +NGY   F+    K  V + +K  KD
Sbjct:    2 NKRPKIRGLLTKAHIEKLKQLQANQDILITRPDKGTGIVIMNRSDYVTKMHSILSDQN-----KFREAHKEKDCTDE--VEAQLTDCLKRLHARGFLSDRDLERLRPVGTHIPRLYGLPKIHKEGLPLRPILDMRNSPYHAIAKWLAEKLKPVQRQLAPRSYRDTFEFIEDVKDL---NLNGTKMLSLDVSSLFTNVPVTETVDYLCEFLLTSEQETGI-PTNTLKELLLRCTLNVQFLFDNQLYRQIDGVAMGSPLGPLLADVFMGKLEKFQLSGQINKLRYYGRYVDDIFAIVTEETNVDELLYTVNQAHPSIKFTVEMERAGSLPFLDVLLSRRPDGSIRRSVYRKKTWSGQYMNFSSFIPLQQKRNLVRCLAQRARKICT--ADSIEEELGKIQNLLRENGYPDRFI---TKHLVARPVKPAKD 413          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2B4S5D9 (Reverse transcriptase domain-containing protein OS=Stylophora pistillata OX=50429 GN=AWC38_SpisGene11611 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.911e-60
Identity = 132/376 (35.11%), Postives = 206/376 (54.79%), Query Frame = 1
Query: 1021 SPQFVKLPK-GRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCC--ALWNE--NDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLI------KNPKDP 2115
            +PQ +  P  G K     P++  + V  M  G ++K      +  S+ P  S+ A LYGLPK HK+ + MRP+LS   T  + +AK+LD  LKPL  +++   D+F+F   I +L K +  +++VS+DV SLFTNVPL +TI++    A  N   N + +  L R     LL  AT    F FN   Y+Q DGVAMGSPL P +A++F++S+E  +   Q + P  Y+RYVDD   +  +      FLH +NS H ++ FT E E+ S + FL   +       ET++Y KPT+TGL    +S  + +YKR+++K ++ R+  LSS++A+     D+L ++  +  Y +  +   I   +   I      + PK+P
Sbjct:   20 TPQGIVFPNLGSKQA---PVEKPQLVTGM--GILEKA---GRIHDSVSPTGSRLAHLYGLPKTHKEPLAMRPILSATDTYNFPLAKWLDEKLKPLSLNQYTVTDNFDFTKEIHEL-KINKGEILVSYDVSSLFTNVPLDETIEILVNRAFSNNWFNTTHNLALTRTDLIDLLNVATKGQLFQFNGALYEQTDGVAMGSPLGPLLANVFMSSIEDTLER-QRKLPSYYRRYVDDTLTVMPDLATATTFLHTLNSAHTSVKFTMEVEKNSKLPFLGTELLNHAPRIETKVYVKPTNTGLLLHYQSHVDNRYKRSLLKTMLDRAHRLSSSWAHFSDECDRLKKVFARLKYPERLVNSTINTFLQSRIVGTQPTQTPKEP 385          

HSP 2 Score: 54.299 bits (129), Expect = 1.911e-60
Identity = 45/148 (30.41%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 2217 LVLPYSEGFT-NYKRKLSKQMGNLEYKIVSNSCKV-------RNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIG---MSDFRILLRSFNSYWERVICEALLIRSLDPKINVQS 2627
            +V+P+ +  + NY   + K++ NL  K+ +    V       +++ + + K  +     +VYQF C+ C+A Y+G T  HL TRV  H R    ++I +H     SE+    +  F IL +  N + + ++ E L IR L P +NVQS
Sbjct:  391 VVIPFKDQESANY---VKKELKNLSMKVQTTVQPVFVSRKVGQDLKVREIKPQIVNQQRVVYQFQCDLCDAGYVGYTRGHLHTRVDGHKR--KASSIYKHYHERHSEVPKDLLKRFSILKKCSNKF-DCLVNEMLFIRDLKPTLNVQS 532          
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Match: A0A2B4RZL1 (Vacuolar protein sorting-associated protein 53-like OS=Stylophora pistillata OX=50429 GN=VPS53 PE=4 SV=1)

HSP 1 Score: 210.305 bits (534), Expect = 1.967e-60
Identity = 128/358 (35.75%), Postives = 202/358 (56.42%), Query Frame = 1
Query: 1081 DEEFVQKM-LNGF--IKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCC--ALWNE--NDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLI------KNPKDP 2115
            D E  +K+ LNG   +  +++ + +  S+ P  S+ A LYGLPK HK+ + MRP+LS   T  + +AK+LD  LKPL  +++   D+F+F   I +L K +  +++VS+DV SLFTNVPL +TI++    A  N   N + +  L R     LL  AT    F FN   Y+Q DGVAMGSPL P +A++F++S+E  +   Q + P  Y+RYVDD   +  +      FLH +NS H ++ FT E E+ S + FL   +       ET++Y KPT+TGL    +S  + +YKR+++K ++ R+  LSS++A+     D+L ++  +  Y +  +   I   +   I      + PK+P
Sbjct:  437 DPELAEKIDLNGEQDVFHRILPKTIADSVSPTGSRLAHLYGLPKTHKEPLAMRPILSATDTYNFPLAKWLDEKLKPLSLNQYTVTDNFDFTKEIHEL-KINKGEILVSYDVSSLFTNVPLDETIEILVNRAFSNNWFNTTHNLALTRTDLIDLLNVATKGQLFQFNGALYEQTDGVAMGSPLGPLLANVFMSSIEDTLER-QRKLPSYYRRYVDDTLTVMPDLATATTFLHTLNSAHTSVKFTMEVEKNSKLPFLGTELLNHAPRIETKVYVKPTNTGLLLHYQSHVDNRYKRSLLKTMLDRAHRLSSSWAHFSDECDRLKKVFARLKYPERLVNSTINTFLQSRIVGTQPTQTPKEP 792          

HSP 2 Score: 54.6842 bits (130), Expect = 1.967e-60
Identity = 45/148 (30.41%), Postives = 76/148 (51.35%), Query Frame = 3
Query: 2217 LVLPYSEGFT-NYKRKLSKQMGNLEYKIVSNSCKV-------RNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIG---MSDFRILLRSFNSYWERVICEALLIRSLDPKINVQS 2627
            +V+P+ +  + NY   + K++ NL  K+ +    V       +++ + + K  +     +VYQF C+ C+A Y+G T  HL TRV  H R    ++I +H     SE+    +  F IL +  N + + ++ E L IR L P +NVQS
Sbjct:  798 VVIPFKDQESANY---VKKELKNLSMKVQTTVQPVFVSRKVGQDLKVREIKPQIVNQQRVVYQFQCDLCDAGYVGYTRGHLHTRVDGHKR--KASSIYKHYHERHSEVPKDLLKRFSILKKCSNKF-DCLVNEMLFIRDLKPTLNVQS 939          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Nematostella
Match: EDO31410 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SY00])

HSP 1 Score: 58.9214 bits (141), Expect = 1.795e-10
Identity = 26/65 (40.00%), Postives = 45/65 (69.23%), Query Frame = 1
Query: 1603 LAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIF-ENQKHVEPFLHFMNSLHKNIVFTCE 1794
            +AP+ A++F+A +E +I      KP++++RY+DDIF+I+ E +  +  F+  MNS+H+ I FT E
Sbjct:    1 MAPSYANLFMAKVENEIIDSSPVKPYLWRRYIDDIFMIWTEGEDALREFMAHMNSIHRTIKFTFE 65          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000037744.1 (pep primary_assembly:ASM223467v1:13:642935:650348:-1 gene:ENSORLG00000023582.1 transcript:ENSORLT00000037744.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 74.7146 bits (182), Expect = 3.371e-13
Identity = 64/236 (27.12%), Postives = 118/236 (50.00%), Query Frame = 1
Query: 1267 IAKFLDGLLKPLM-RSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFR-----KLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKK-IASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKG 1953
            +AK L  +L PL+  +E   ++S +F + +  LQ  S  + MVS+DV SLFT +P   T +   ++      +  + DR         +LLE   ++  F F   +Y+Q  G AM SP++P +A++++  +E++ + SF    P  + RYVDD ++  ++Q+ VE F   +N L+       E + +  +   D+L    D+H    +      +G+  + +SF   K+  +  +G
Sbjct:    1 MAKHLATILAPLVGNTEHHVRNSQDFANKVKHLQLDSA-ETMVSYDVTSLFTCIP---TTEAVISVRKRLLQDSQLQDRTNLTPDHICELLEVCLNSTYFQFRGNFYRQRHGCAMDSPISPIVANLYMEEVERRALDSFPGTTPSHWFRYVDDTWVKIKSQE-VETFTDHIN-LYITEGLREEVQTQHEVRNQDILKPLPDQHGSIRVV---LTSGVAGAGKSFSVQKFTLDWAEG 227          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046811.1 (pep primary_assembly:ASM223467v1:2:1507339:1511058:1 gene:ENSORLG00000027640.1 transcript:ENSORLT00000046811.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.248e-11
Identity = 47/159 (29.56%), Postives = 82/159 (51.57%), Query Frame = 1
Query:  883 KQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXXXXXXXXXSPQFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKK----KLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLM-RSEFECKDSFEFV 1344
            K+ I     LKN   + I I   DKG   VI+D + N           Q  ++ + R   ++L     E  ++ L   +K+    K I+++    ++PI S   ++Y  PKIHK G P+RP++  +G+  Y ++KF+  +LKPL+  +++ C++S  FV
Sbjct:   22 KEEIAAIHNLKN--NREITILPADKGRTTVIMDTEQNEK---------QMNEMLQDRNTYEVLKRDPTEAKKRKLKTILKQLQEEKKIDKQTYNHLIPIVSIIPRIYDTPKIHKPGAPLRPIIDSMGSVTYNLSKFIADILKPLLGNTDYHCENSKNFV 169          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042440.1 (pep primary_assembly:ASM223467v1:18:25084225:25091745:-1 gene:ENSORLG00000029207.1 transcript:ENSORLT00000042440.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.7734 bits (151), Expect = 9.193e-11
Identity = 27/78 (34.62%), Postives = 51/78 (65.38%), Query Frame = 1
Query: 1102 MLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLM-RSEFECKDS 1332
            +L    ++K I+++    ++P  S   ++YG PKIHK G P+RP++  +G+  Y I+KF+  +LKPL+  +++ C++S
Sbjct:   88 ILKQLQEEKKIDKQTYNHLIPTASIIPRIYGTPKIHKPGAPLRPIIDSMGSVTYNISKFIADILKPLLGNTDYHCENS 165          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028159.1 (pep primary_assembly:ASM223467v1:11:8577910:8583158:1 gene:ENSORLG00000023853.1 transcript:ENSORLT00000028159.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.003 bits (149), Expect = 1.242e-10
Identity = 25/81 (30.86%), Postives = 53/81 (65.43%), Query Frame = 1
Query: 1093 VQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLM-RSEFECKDS 1332
            ++ +L    ++K I+++    ++P  S   ++YG PKIHK G P+RP++  +G+  Y ++KF+  +LKPL+  +++ C+++
Sbjct:   89 LKTVLKQLQEEKKIDKQTYNHLIPTASIIPRIYGTPKIHKPGAPLRPIIDSMGSVTYNLSKFIANILKPLLGNTDYHCENA 169          
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027006.1 (pep primary_assembly:ASM223467v1:4:31592829:31599929:1 gene:ENSORLG00000027092.1 transcript:ENSORLT00000027006.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 59.6918 bits (143), Expect = 1.303e-9
Identity = 23/70 (32.86%), Postives = 47/70 (67.14%), Query Frame = 1
Query: 1123 KKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLM-RSEFECKD 1329
            +K I+++    ++P  +   ++YG PKIHK G P+RP++  +G+  Y ++KF+  +LKPL+  +++ C++
Sbjct:   94 EKKIDKQTYNHLIPTANIIPRIYGTPKIHKPGAPLRPIIDSMGSVTYNLSKFIADILKPLLGNTDYHCEN 163          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 382/468 (81.62%), Postives = 399/468 (85.26%), Query Frame = 1
Query:  799 ARSMKGINGNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXXXXXXXXXSPQFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKL 2202
            +RS+KGIN NYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDV VNKLNDLLNSPQFVKLPKGRKNGKL PLKDEEFVQK+LNGFI+KKLI+E+VGKSI PI SQPAKLYGLPKIHKDGVPMRPVLSM          F+           +EC                                   LV+TIDLCCALWNENDSEHHILD RAFRKL+EFATSNVNFLFN+EWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFL FENQKHVEPFLHFMNSLHKN+VFTCETERKSSIAFLDLLIQRKDK YETEIYRKPTDTGLYTSPESFCEF+YKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPC GKSECNLS+ CELSV L + KNG+KK+
Sbjct: 1486 SRSIKGINDNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKILNGFIEKKLIDEKVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM----------FV-----------YECT----------------------------------LVETIDLCCALWNENDSEHHILDGRAFRKLIEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLEFENQKHVEPFLHFMNSLHKNLVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVSLGDGKNGFKKI 1898          

HSP 2 Score: 322.398 bits (825), Expect = 0.000e+0
Identity = 151/155 (97.42%), Postives = 154/155 (99.35%), Query Frame = 3
Query: 2196 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIGMSDFRILLRSFNSYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 2660
            KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVY FTCNGCNATYIGETSRHLCTRVL+HC+LKGLTNISEHNRGCKSEIGMSDFRILLRSFN+YWERVICEALLIRSLDPKINVQSAVTTNVLNVFK
Sbjct: 1897 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEHNRGCKSEIGMSDFRILLRSFNNYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 2051          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 398/533 (74.67%), Postives = 427/533 (80.11%), Query Frame = 1
Query:  607 KLINLRKIFGISKFSVENTVINLSKIVLNDDEERVLKFGPNHCIKN-RLDETKLCAKIESLYFHIARSMKGINGNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXXXXXXXXXSPQFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKL 2202
            K +N+ K+ G +   +++    + K    DD   +  +  N  IKN   D+ K  A I  L  + +RS+KGIN NYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDV VNKLNDLLNSPQFVKLPKGRKNGKL PLKDEEFVQK+LNGFI+KKLI+E+VGKSI PI SQPAKLYGLPKIHKDGVPMRPVLSM          F+           +EC                                   LV+TIDLCCALWNENDSEHHILD RAFRKL+EFATSNVNFLFN+EWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFL FENQKHVEPFLHFMNSLHKN+VFTCETERKSSIAFLDLLIQRKDK YETEIYRKPTDTGLYTSPESFCEF+YKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPC GKSECNLS+ CELSV L + KNG+KK+
Sbjct: 1357 KGLNVHKMLGEAVIHLDDIEF-VKKNSKKDDAVDLKAYEYNIQIKNIEDDDGKNIADILHL-MNKSRSIKGINDNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKILNGFIEKKLIDEKVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM----------FV-----------YECT----------------------------------LVETIDLCCALWNENDSEHHILDGRAFRKLIEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLEFENQKHVEPFLHFMNSLHKNLVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVSLGDGKNGFKKI 1832          

HSP 2 Score: 322.783 bits (826), Expect = 0.000e+0
Identity = 151/155 (97.42%), Postives = 154/155 (99.35%), Query Frame = 3
Query: 2196 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIGMSDFRILLRSFNSYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 2660
            KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVY FTCNGCNATYIGETSRHLCTRVL+HC+LKGLTNISEHNRGCKSEIGMSDFRILLRSFN+YWERVICEALLIRSLDPKINVQSAVTTNVLNVFK
Sbjct: 1831 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEHNRGCKSEIGMSDFRILLRSFNNYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 1985          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000050479.1 (SMESG000050479.1)

HSP 1 Score: 729.939 bits (1883), Expect = 0.000e+0
Identity = 382/468 (81.62%), Postives = 399/468 (85.26%), Query Frame = 1
Query:  799 ARSMKGINGNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVIXXXXXXXXXXXXXXXSPQFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKL 2202
            +RS+KGIN NYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDV VNKLNDLLNSPQFVKLPKGRKNGKL PLKDEEFVQK+LNGFI+KKLI+E+VGKSI PI SQPAKLYGLPKIHKDGVPMRPVLSM          F+           +EC                                   LV+TIDLCCALWNENDSEHHILD RAFRKL+EFATSNVNFLFN+EWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFL FENQKHVEPFLHFMNSLHKN+VFTCETERKSSIAFLDLLIQRKDK YETEIYRKPTDTGLYTSPESFCEF+YKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPC GKSECNLS+ CELSV L + KNG+KK+
Sbjct: 2377 SRSIKGINDNYVKSSLSASTMEYIDKNKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVYVNKLNDLLNSPQFVKLPKGRKNGKLPPLKDEEFVQKILNGFIEKKLIDEKVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSM----------FV-----------YECT----------------------------------LVETIDLCCALWNENDSEHHILDGRAFRKLIEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLEFENQKHVEPFLHFMNSLHKNLVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESFCEFRYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELSVSLGDGKNGFKKI 2789          

HSP 2 Score: 323.553 bits (828), Expect = 0.000e+0
Identity = 151/155 (97.42%), Postives = 154/155 (99.35%), Query Frame = 3
Query: 2196 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKGLTNISEHNRGCKSEIGMSDFRILLRSFNSYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 2660
            KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVY FTCNGCNATYIGETSRHLCTRVL+HC+LKGLTNISEHNRGCKSEIGMSDFRILLRSFN+YWERVICEALLIRSLDPKINVQSAVTTNVLNVFK
Sbjct: 2788 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYHFTCNGCNATYIGETSRHLCTRVLDHCQLKGLTNISEHNRGCKSEIGMSDFRILLRSFNNYWERVICEALLIRSLDPKINVQSAVTTNVLNVFK 2942          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000044971.1 (SMESG000044971.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 300/367 (81.74%), Postives = 310/367 (84.47%), Query Frame = 1
Query: 1102 MLNGFIKKKLINEEVGKSILPIKSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKL 2202
            MLNGFI+KKLI+EEVGKSI PI SQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLV+TIDLCCALWNENDSEHHILDRRAFRK+LEFATSNVNFLFN+EWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKP   K     +F              FMNSLHKNIVFTCETERKSSIAFLDLLIQRKDK YETEIYRKPTDTGLYTSPES CEF                          +VDKLVELLIKNGYSKSFLLLMIKETVDKLIKN KDPC GKSECNLS+ CELSVDL + KNGYKK+
Sbjct:    1 MLNGFIEKKLIDEEVGKSIRPIGSQPAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVETIDLCCALWNENDSEHHILDRRAFRKILEFATSNVNFLFNDEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPLFIKETCRTVFA-------------FMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKQYETEIYRKPTDTGLYTSPESVCEF--------------------------NVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNSKDPCCGKSECNLSDGCELSVDLGDGKNGYKKI 328          

HSP 2 Score: 187.193 bits (474), Expect = 0.000e+0
Identity = 88/92 (95.65%), Postives = 89/92 (96.74%), Query Frame = 3
Query: 2196 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKG 2471
            KIEPKYVLVLPYSEGFTNYKRKL K +GNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLK 
Sbjct:  327 KIEPKYVLVLPYSEGFTNYKRKLGKLIGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGETSRHLCTRVLEHCRLKD 418          
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Match: SMESG000068262.1 (SMESG000068262.1)

HSP 1 Score: 585.104 bits (1507), Expect = 0.000e+0
Identity = 289/326 (88.65%), Postives = 297/326 (91.10%), Query Frame = 1
Query: 1225 MRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKL 2202
            MRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMV FDVCSLFTNVPLV+TIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFN+EWY Q+ GVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYK YVDDIFLIFENQKHVEPFLHFMNSLHKNIVFT                    K YETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSW+LSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPC GKSECNLS+ CEL+VDL + KNGYKK+
Sbjct:    1 MRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECKDSFEFVSCIAKLQKRSMNDVMVPFDVCSLFTNVPLVETIDLCCALWNENDSEHHILDRRAFRKLLEFATSNVNFLFNDEWYLQMYGVAMGSPLAPTMASIFLASLEKKIASFQFEKPFVYKWYVDDIFLIFENQKHVEPFLHFMNSLHKNIVFTY-------------------KQYETEIYRKPTDTGLYTSPESFCEFKYKRNMVKGLIYRSWALSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIKETVDKLIKNPKDPCCGKSECNLSDGCELNVDLGDGKNGYKKI 307          

HSP 2 Score: 80.1073 bits (196), Expect = 1.178e-15
Identity = 38/42 (90.48%), Postives = 39/42 (92.86%), Query Frame = 3
Query: 2196 KIEPKYVLVLPYSEGFTNYKRKLSKQMGNLEYKIVSNSCKVR 2321
            KIEPKYVLVLPYSEGFTNYKRKL K +GNLEYKIVSNSCK R
Sbjct:  306 KIEPKYVLVLPYSEGFTNYKRKLGKLIGNLEYKIVSNSCKAR 347          
The following BLAST results are available for this feature:
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000035509.18.501e-2230.71pep primary_assembly:Xenopus_tropicalis_v9.1:9:324... [more]
ENSXETT00000006009.11.227e-1626.04pep primary_assembly:Xenopus_tropicalis_v9.1:5:917... [more]
plppr55.854e-826.53phospholipid phosphatase related 5 [Source:Xenbase... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2B4RB603.325e-6432.45Uncharacterized protein F54H12.2 OS=Stylophora pis... [more]
A0A2B4R8791.207e-6333.26Reverse transcriptase domain-containing protein OS... [more]
A0A0X3Q8A94.758e-6137.15Reverse transcriptase (RNA-dependent DNA polymeras... [more]
A0A2B4S5D91.911e-6035.11Reverse transcriptase domain-containing protein OS... [more]
A0A2B4RZL11.967e-6035.75Vacuolar protein sorting-associated protein 53-lik... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO314101.795e-1040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000037744.13.371e-1327.12pep primary_assembly:ASM223467v1:13:642935:650348:... [more]
ENSORLT00000046811.11.248e-1129.56pep primary_assembly:ASM223467v1:2:1507339:1511058... [more]
ENSORLT00000042440.19.193e-1134.62pep primary_assembly:ASM223467v1:18:25084225:25091... [more]
ENSORLT00000028159.11.242e-1030.86pep primary_assembly:ASM223467v1:11:8577910:858315... [more]
ENSORLT00000027006.11.303e-932.86pep primary_assembly:ASM223467v1:4:31592829:315999... [more]
back to top
BLAST of Reverse transcriptase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000050479.10.000e+081.62SMESG000050479.1[more]
SMESG000050479.10.000e+074.67SMESG000050479.1[more]
SMESG000050479.10.000e+081.62SMESG000050479.1[more]
SMESG000044971.10.000e+081.74SMESG000044971.1[more]
SMESG000068262.11.178e-1588.65SMESG000068262.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016287 ID=SMED30016287|Name=Reverse transcriptase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2756bp
AAAAAAATTTAAAATTTAAAATTAATTTAAAATATATTTTTAAAAATATT
TATTTATTAAAAAATTAAATTAATAAAAAATAATTTGTTTAAATTAAATG
TTAATTCATAATATTTTTAGTTGGTTTTGTGTACCTGAAGATGACAGTTA
TGCTGTCGAAATATATCGTACGAAGAGTTTTTTATTGGCGTTATCTTTTA
ATTAAATCGTTGCCAAATTTATTTAATTATTTATTTATAAATCATGCTGC
AGCTGTTCCAATATTTATGAAGGTTTATGAAGGTTTATAACTCCCTCAAA
AGAAAGGAACTAGACATTAGTTTTCTTGAGACTTGTTTAGAAGAAAAGAT
GATTCCTTCGTTCATTTTTAAAATGAAACTAAGTGATTGTCTTTCTAGTA
AAGATGTCCAATTAATACATAGAAGAACGTTAAGAAGAATGTTGGAATCA
GAGAAAATAAGGAGAACTTCCATTGATAAAAAACTAACAAATATTGGATT
AATGTTAAATAATGCTACGAATGAGTTTTGTTTAGAAGGATGTGTAGAAT
GGTGTATCAAAAATTCGATTGTGCAAATAAAATCTAAAGAGGATGCTCAT
ATTAAAAAATTGATTAATTTGAGAAAAATATTTGGGATTTCTAAATTTAG
TGTGGAGAATACTGTGATAAATTTGAGTAAAATAGTGTTGAATGATGATG
AAGAGCGTGTTTTAAAATTTGGTCCAAATCACTGTATTAAGAATCGCTTG
GATGAAACAAAATTGTGTGCAAAAATTGAAAGTTTATATTTTCATATAGC
CCGATCGATGAAAGGCATTAATGGTAATTATGTGAAGAGCTCGTTAAGTG
CAAGTACGATGGAGTATATCGATAAAAACAAAAAGCAGAATATTAGGGAT
TTTATGACTTTAAAAAACTTAGCTAAAAAAAATATAAATATCTGTAAGTT
TGACAAAGGAAATGGGATAGTTATTCTTGACCATGATGTGAATGTAAATA
AGTTGAATGATTTGTTAAATTCTCCTCAGTTTGTGAAATTACCAAAGGGT
CGGAAGAATGGAAAATTGCTTCCTCTTAAGGATGAAGAGTTTGTACAAAA
AATGTTAAATGGTTTTATTAAGAAGAAGCTTATTAATGAAGAGGTAGGTA
AGTCTATTCTTCCAATAAAATCGCAGCCAGCAAAACTATATGGGCTTCCA
AAAATCCATAAAGATGGTGTACCTATGAGACCAGTTTTGTCGATGGTTGG
TACTGCCCAGTATAAAATAGCAAAGTTTTTAGATGGATTATTAAAACCGT
TAATGCGATCAGAGTTTGAATGTAAGGATAGCTTTGAGTTTGTTTCTTGT
ATTGCAAAGCTACAAAAACGAAGTATGAATGATGTTATGGTTTCGTTTGA
TGTTTGTAGTTTGTTTACGAATGTGCCACTGGTTGATACAATTGACTTAT
GCTGTGCGTTGTGGAATGAAAATGATTCGGAACATCACATTTTGGATAGA
AGGGCATTTCGTAAACTTCTTGAATTTGCTACTTCAAATGTCAATTTTCT
TTTCAATAATGAATGGTATCAACAAATAGATGGAGTCGCTATGGGTTCCC
CTTTAGCACCAACGATGGCATCAATATTTTTGGCTAGTTTGGAAAAGAAA
ATTGCTTCTTTCCAATTTGAAAAACCTTTTGTTTATAAAAGGTATGTGGA
TGATATTTTTCTTATATTTGAAAACCAGAAACATGTAGAACCGTTTTTGC
ATTTTATGAACAGTTTACATAAAAACATTGTATTCACATGTGAAACGGAG
AGAAAGTCATCAATTGCGTTTTTGGATTTGTTAATTCAACGCAAAGATAA
ACATTATGAGACAGAGATTTATAGAAAACCAACTGATACTGGTCTTTATA
CTTCTCCAGAAAGCTTTTGTGAATTTAAGTATAAGAGAAATATGGTGAAA
GGATTGATTTATCGTTCATGGTCTTTATCTTCTACTTTTGCTAATTCGGT
AAAAAGTGTTGATAAATTGGTTGAGTTGTTGATAAAGAATGGATATTCTA
AATCATTTTTATTGTTGATGATAAAAGAAACTGTTGATAAATTGATTAAA
AATCCTAAGGATCCATGTTTTGGAAAGTCTGAGTGTAATTTGTCAAATGA
GTGTGAATTGAGTGTTGATCTAAATAATAGTAAAAATGGATATAAAAAAT
TGAGCCTAAATATGTGTTAGTATTGCCGTACTCTGAAGGTTTTACAAATT
ATAAAAGGAAGTTAAGTAAACAGATGGGAAATTTAGAGTATAAGATCGTC
TCTAATTCGTGTAAGGTACGCAATATGTTTATTAATAAATCAAAAACTCC
GGTTGGATTGTGTTCTGATCTCGTTTATCAATTTACATGTAATGGGTGTA
ATGCCACATACATTGGAGAGACTTCCCGTCATCTCTGTACTCGAGTTCTA
GAGCATTGTCGATTGAAGGGTTTGACCAATATTAGTGAGCACAATAGAGG
CTGTAAAAGTGAAATAGGAATGTCTGATTTTAGAATTTTGTTGAGAAGTT
TTAATAGTTATTGGGAACGAGTGATATGTGAAGCATTGCTGATAAGGTCA
TTGGATCCAAAGATTAATGTGCAAAGTGCTGTGACTACGAATGTTTTGAA
TGTTTTTAAATAGTTTACGTATGTTAAATCATGTTTGTTTTTTTAATATT
ATTAAAATAATTGAAAATTTTAAATTACATTAATTTTTAAAAATTAGAAT
ATAAGT
back to top

protein sequence of SMED30016287-orf-1

>SMED30016287-orf-1 ID=SMED30016287-orf-1|Name=SMED30016287-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=130bp
MGNLEYKIVSNSCKVRNMFINKSKTPVGLCSDLVYQFTCNGCNATYIGET
SRHLCTRVLEHCRLKGLTNISEHNRGCKSEIGMSDFRILLRSFNSYWERV
ICEALLIRSLDPKINVQSAVTTNVLNVFK*
back to top

protein sequence of SMED30016287-orf-2

>SMED30016287-orf-2 ID=SMED30016287-orf-2|Name=SMED30016287-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=648bp
MKVYNSLKRKELDISFLETCLEEKMIPSFIFKMKLSDCLSSKDVQLIHRR
TLRRMLESEKIRRTSIDKKLTNIGLMLNNATNEFCLEGCVEWCIKNSIVQ
IKSKEDAHIKKLINLRKIFGISKFSVENTVINLSKIVLNDDEERVLKFGP
NHCIKNRLDETKLCAKIESLYFHIARSMKGINGNYVKSSLSASTMEYIDK
NKKQNIRDFMTLKNLAKKNINICKFDKGNGIVILDHDVNVNKLNDLLNSP
QFVKLPKGRKNGKLLPLKDEEFVQKMLNGFIKKKLINEEVGKSILPIKSQ
PAKLYGLPKIHKDGVPMRPVLSMVGTAQYKIAKFLDGLLKPLMRSEFECK
DSFEFVSCIAKLQKRSMNDVMVSFDVCSLFTNVPLVDTIDLCCALWNEND
SEHHILDRRAFRKLLEFATSNVNFLFNNEWYQQIDGVAMGSPLAPTMASI
FLASLEKKIASFQFEKPFVYKRYVDDIFLIFENQKHVEPFLHFMNSLHKN
IVFTCETERKSSIAFLDLLIQRKDKHYETEIYRKPTDTGLYTSPESFCEF
KYKRNMVKGLIYRSWSLSSTFANSVKSVDKLVELLIKNGYSKSFLLLMIK
ETVDKLIKNPKDPCFGKSECNLSNECELSVDLNNSKNGYKKLSLNMC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0003964RNA-directed DNA polymerase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000074oocyte
PLANA:0000099neuron
PLANA:0000136whole organism
PLANA:0000231vitelline gland
PLANA:0000463cholinergic neuron
PLANA:0000464GABAergic neuron
PLANA:0002075pigment cell
PLANA:0002089reproductive organ
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000305GIY-YIG_endonuc
IPR000477RT_dom
Vocabulary: biological process
TermDefinition
GO:0006278RNA-dependent DNA biosynthetic process