Myosin heavy chain

Overview
NameMyosin heavy chain
Smed IDSMED30016281
Length (bp)5986
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin heavy chain (SMED30016281) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30016281) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin heavy chain (SMED30016281) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin heavy chain (SMED30016281) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016281

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 40

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30016281SMESG000056451.1 dd_Smed_v4_1434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_1434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_1434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30016281SMESG000056451.1 dd_Smed_v4_1434_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig35391newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig35391uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig30744newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig30744uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig41930newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig41930uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig44421uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016281SMESG000056451.1 Contig44421newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
body wall musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
body wall musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
body wall musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
enteric musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
enteric musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
pharynx musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 7 colorimetric in situ hybridization evidence
pharynx musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 8 colorimetric in situ hybridization evidence
pharynx musculatureSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynx radial muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynx circular muscle cellSMED30016281SMESG000056451.1 AAL78671smed_ncbi_20200123PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
dorsal-ventral muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_1434_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
body wall musculatureSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30016281SMESG000056451.1 dd_Smed_v4_432_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30016281SMESG000056451.1 dd_Smed_v6_432_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30016281SMESG000056451.1 dd_Smed_v6_1434_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH6 (myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1757.27 bits (4550), Expect = 0.000e+0
Identity = 1028/1913 (53.74%), Postives = 1396/1913 (72.97%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+     FD +   ++PD+KE ++   +    G KV  +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA   +   D +     +LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ERNYHIFYQ+LS       D LLVT +P  ++F++QGE+++  +DD EE+  TD AF +LGF+ EEK  ++K T +IM+ G MKFKQ+ REEQAE DGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQS  QV YS+GALAK++Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWLEKNKDPLNE+VV L   S   L+A+LF+        +     G KKKG SF TVS +HRE+LNKLM NL +T PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++ T+K+L+++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++KE  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+ EE+KV++L+K+K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+KE ++N  NSKIEDE  L   LQ+K+KE QARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK ++ LE   ++ + KL+E  R L +      + Q EN E+ + LE+ E+ I+QL + K     Q+E+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLGEGG+NVHE+EK RK++E+E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NHQR ++S+Q SL+AE R R E +++KKK+E D+NE+E+ L  ANR+ +E +K  K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KME+DL  +Q+++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELEGEL+ EQKR+ E+ K  RKS+RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTRPFDIRTECFVPDDKEEFVKAKILSREGGKVIAETENGKTVTVKEDQVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRGKKDNANANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELMATDSAFDVLGFTSEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNIKGKQEAHFSLIHYAGTVDYNILGWLEKNKDPLNETVVALYQKSSLKLMATLFSSYATADTGDSGKSKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPVAIPEGQFIDSRKGTEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRMQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRIKETLEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQVEEDKVNSLSKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDINQQNSKIEDEQVLALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKVRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHQRVVDSLQTSLDAETRSRNEVLRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELEGELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1926          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH7 (myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:7577])

HSP 1 Score: 1752.64 bits (4538), Expect = 0.000e+0
Identity = 1029/1913 (53.79%), Postives = 1396/1913 (72.97%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+     FD KK++++PD+K+ ++   +    G KVT +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL+ RY   +IYTYSGLFC+ VNPY+  P+YT +V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA   +   D S  KG+LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ER+YHIFYQ+LS       D LL+T +P  ++FI+QGE T+  +DD EE+  TD AF +LGF+ EEK S++K T +IM+ G MKFK + REEQAE DGT EA+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV+Y+ GALAK++Y RMF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKL+DNHLGKS NF +      G+ EAHF L HYAG V YNI GWL+KNKDPLNE+VVGL   S   L+++LF       AP E     G  KKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L+++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG L R +YKKL ++R +L +IQ NIR ++ ++ W W KL+ K+KP+L  A +E+EM    EE  +LKE  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELK+D++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +L+E+LK+K+ ELN  N++IEDE  L + LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK  + LE  +++ ++K +E  R + +  +   + Q EN E+ + L++ E+ I+QL + K     QLE+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLG  G+ +HE+EK RK++E E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ +E +K  K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KM+ADL+ +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTRPFDLKKDVFVPDDKQEFVKAKIVSREGGKVTAETEYGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKDRYGSWMIYTYSGLFCVTVNPYKWLPVYTPEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQSPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDAEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKLKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVIYATGALAKAVYERMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLFDNHLGKSANF-QKPRNIKGKPEAHFSLIHYAGIVDYNIIGWLQKNKDPLNETVVGLYQKSSLKLLSTLFANYAGADAPIE--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLARMEYKKLLERRDSLLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAEREKEMASMKEEFTRLKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMNERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKMELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH8 (myosin heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:7578])

HSP 1 Score: 1742.24 bits (4511), Expect = 0.000e+0
Identity = 1010/1911 (52.85%), Postives = 1396/1911 (73.05%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-----APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  ++     FD+K ++++ + KE Y+  T++   G KVTVKT+ G T  V++D +  MNPPK+  IEDMA +T L++  V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +A   +K  D+  K +G+LEDQI+ ANP+LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+ S       + LL+T +P  ++F++QGE+T+  +DD+EE+  TD A  ILGF+ EEK+S++K T ++M+ G MKFKQ+ REEQAE DGT  A+K ++L  +N+ DL++A+  P+VKVGNEYVTKGQ+  QV  ++GALAK++Y +MF W+VTR+N+ LDTK  RQ+FIGVLDIAGFEIFDFN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKP+GI SILEEECMFPKA+D + K KLYD HLGKS NF +      G+ EAHF L HYAG+V YNITGWL+KNKDPLN++VVGL   S    +ASLF     A A+ + K G KKKG SF TVS + RE+LNKLM NL ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  +AIP+G F++ K+ ++K+L +I +D   Y+ G+TKVFFKAG L  LE++RDEKL+ +I+  QA  RG+LMR +Y+K+  +R AL  IQ N+R ++ ++ W W KLF K+KP+L  A  E+EM    EE +K K+E  K+E  +KELEE+ VTLL+ KNDL LQ+Q+E DSLADAEE+  +L+  K  +E +IKE+ +   EEE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE   D+E  K +L+E+L++KE E++   SKIEDE  +   LQ+KIKELQARI+EL E++EAER +RAKAEK +  L  ELEEISERLEE GGAT AQ +LNKKREAE  KL+RDLEEA +QHE  +  +RKK  D+  E  +Q+D LQ+ K K+E+EKSEL+ + +DLSS  E+++K KGNLEK  ++LE  VS+L+ K +E  R + +      R Q E  E  + L++ ++ ++QL ++KQ    Q+EE K  LE+E++AK  L   L+++  D D LRE  EEEQEGK+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KC+ LEK K RLQ E+EDL++DVER+N   + L+KKQ+N DK++ EW++KY E+Q ELE S +ESR++S E+FK+K+  E S DQ+E+LRRENKNL  EI DLTEQ+ EGG+ +HE+EK +K++E E+ E+Q ALEEAE++LE EE K  R QLE++Q + E +R++AEK+EE +  ++NH R +E+MQ++L+AE+R R +A+++KKK+E D+NE+E+ L+ ANRL +E  +N +  Q  L E Q  +++    +E + EQLA+ ER+  ++  E+EE+    +  E++RK+AE E  +A +++     QN+S + TK+K+E D++ +Q+++EE    +R A E+ KKAI D   + +E+K+EQ+ +   E+ +KNLE  +K+LQ +L+EAE   LKGGKK + KLE R+RELEGE++ EQKR+ E  K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQAK+K+YKRQ EEAEE +  NL+K+RK+Q E+E++EERAD AE  + KLR K+
Sbjct:   18 YLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSTIQSKEGGKVTVKTEGGATLTVREDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKDESGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFTPEEKVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFSLIHYAGTVDYNITGWLDKNKDPLNDTVVGLYQKSAMKTLASLFSTYASAEADSSAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQIITRTQAVCRGFLMRVEYQKMLQRREALFCIQYNVRAFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEEEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLSKEKKALQETHQQTLDDLQAEEDKVNILTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDMENDKQQLDEKLEKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELGEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVELNKKREAEFQKLRRDLEEATLQHEAMVAALRKKHADSMAELGEQIDNLQRVKQKLEKEKSELKMETDDLSSNAEAISKAKGNLEKMCRSLEDQVSELKTKEEEQQRLINDLTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKHQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERSNAACAALDKKQRNFDKVLSEWKQKYEETQAELEASQKESRSLSTELFKVKNVYEESLDQLETLRRENKNLQQEISDLTEQIAEGGKQIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHTRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKETQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELWATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLSKFRKLQHELEEAEERADIAESQVNKLRVKS 1927          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH1 (myosin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:7567])

HSP 1 Score: 1719.9 bits (4453), Expect = 0.000e+0
Identity = 1001/1898 (52.74%), Postives = 1390/1898 (73.23%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFAN--VXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD+K ++++ D KE ++  TV+   G KVT KT+ G T  VK D +  MNPPK+  IEDMA +T L++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA   V    KK++    K +G+LEDQI+ ANP+LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ++S       + LL+T +P  ++F++QGE+T+  +DD+EE+  TD A  ILGF+ +E++S++K T ++M+ G MKFKQ+ REEQAE DGT  A+K ++L  +N+ DL++A+  P+VKVGNEYVTKGQ+  QV  ++GALAK++Y++MF W+VTR+N+ LDTK  RQ+FIGVLDIAGFEIFDFN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D + K KLY+ HLGKS NF +   P  G+ EAHF L HYAG+V YNI GWL+KNKDPLNE+VVGL   S    +A LF            GK G KKKG SF TVS + RE+LNKLM NL ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ ++K+L +I +D   Y+ G+TKVFFKAG L  LE++RDEKL+ LI+  QA  RG+L R +Y+K+ ++R ++  IQ N+R ++ ++ W W KL+ K+KP+L  A  E+EM    EE EK KEE  KTE  +KELEE+ VTL+Q KNDL LQ+Q E DSLADAEE+  +L+  K  +E +IKE+ +   +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE   D+E  K +L+E+LK+KE E++G  SKIEDE  L   LQ+KIKELQARI+ELEE++EAER +RAKAEK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE++ +I+DL+S +E+++K KGNLEK  +ALE  +S+++ K +E  R + +      R Q E+ E  + L++ ++ ++QL + KQ    Q+EE K+ LE+E +AK+ L   L+++  D D LRE  EEEQE K+++QR + K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KC+ LEK K RLQ E+EDL+IDVER N   + L+KKQ+N DK++ EW++K  E+  ELE S +ESR++S E+FK+K+  E S DQ+E+L+RENKNL  EI DLTEQ+ EGG+ +HE+EK +K++E E+ ELQ ALEEAE++LE EE K  R QLE++Q + E +R++AEK+EE +  ++NH R +ESMQ++L+AE+R R +A+++KKK+E D+NE+E+ L+ ANR+ +E  +N +  Q  L + Q  +++    +E + EQLA+ ER+  ++  E+EE++   +  E++RK+AE E  +A +++     QN+S + TK+K+E D++ +Q ++E+    AR A E+ KKAI D   + +E+K+EQ+ +   E+ +KNLE  +K+LQ +L+EAE   LKGGKK + KLE R+RELEGE++ EQKR+VE  K  RK +R++KE++YQ +ED+KN  R+Q L++ LQAK+K+YKRQ EEAEE + VNL+K+R+IQ E+E++EERAD AE  + KLR K+
Sbjct:   32 FDAKTSVFVVDPKESFVKATVQSREGGKVTAKTEAGATVTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEVTSGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQIMSNKKPDLIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIEILGFTSDERVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQNLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYDKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYEQHLGKSNNF-QKPKPAKGKPEAHFSLIHYAGTVDYNIAGWLDKNKDPLNETVVGLYQKSAMKTLALLFVGATGAEAEAGGGKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQLITRTQAMCRGFLARVEYQKMVERRESIFCIQYNVRAFMNVKHWPWMKLYFKIKPLLKSAETEKEMANMKEEFEKTKEELAKTEAKRKELEEKMVTLMQEKNDLQLQVQAEADSLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEMSGLQSKIEDEQALGMQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNMETVSKAKGNLEKMCRALEDQLSEIKTKEEEQQRLINDLTAQRARLQTESGEYSRQLDEKDTLVSQLSRGKQAFTQQIEELKRQLEEEIKAKSALAHALQSSRHDCDLLREQYEEEQEAKAELQRAMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKESRSLSTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKSELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQMKRNHIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQAILKDTQLHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQIQGEMEDIIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNVEAVKGLRKHERKVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNVNLSKFRRIQHELEEAEERADIAESQVNKLRVKS 1928          
BLAST of Myosin heavy chain vs. Ensembl Human
Match: MYH2 (myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:7572])

HSP 1 Score: 1709.12 bits (4425), Expect = 0.000e+0
Identity = 994/1900 (52.32%), Postives = 1385/1900 (72.89%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFAN--VXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAED--------XXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD+K ++++ + KE ++  T++   G KVTVKT+ G T  VK D +  MNPPK+  IEDMA +T L++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA   V    KK++    K +G+LEDQI+ ANP+LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV+ Q K ER+YHIFYQ+ S       + LL+T +P  + F++QGE+++  +DD+EE+  TD A  ILGF++EEK+S++K T ++M+ G +KFKQ+ REEQAE DGT  A+K ++L  +N+ DL++A+  P+VKVGNEYVTKGQ+ +QV  ++GALAK++Y +MF W+V R+N+ LDTK  RQ+FIGVLDIAGFEIFDFN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D + K KLYD HLGKS NF +      G+ EAHF L HYAG V YNITGWLEKNKDPLNE+VVGL   S    +A LF+ A+           K G KKKG SF TVS + RE+LNKLM NL ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFP+R++Y++FKQRY +L  +AIP+G F++ K+ ++K+L +I +D   Y+ G+TKVFFKAG L  LE++RD+KL+ LI+  QA+ RG+L R +Y+++ ++R A+  IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM    EE +K+K+E  K+E  +KELEE+ VTLL+ KNDL LQ+Q E + LADAEE+  +L+  K  +E +IKE+ +   +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + D+E  K +L+E+LK+KE E++   SKIEDE  L   LQ+KIKELQARI+ELEE++EAER +RAKAEK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE++ +I+DL+S +E+++K KGNLEK  + LE  +S+L++K +E  R + +      R Q E+ E  + L++ E+ ++QL + KQ    Q+EE K+ LE+E +AK  L   L+++  D D LRE  EEEQE K+++QR L K   E+ Q +   +     RTEE+EE ++K+  R+Q  EE  E+  +KC+ LEK K RLQ E+EDL++DVER N   + L+KKQ+N DK++ EW++K  E+  ELE S +E+R++  E+FK+K+  E S DQ+E+L+RENKNL  EI DLTEQ+ EGG+ +HE+EK +K++E E+ ELQ ALEEAE++LE EE K  R QLE++Q + E +R++AEK+EE +  ++NH R +ESMQ++L+AE+R R +A+++KKK+E D+NE+E+ L+ ANR+ +E  +N +  Q  L + Q  +++    +E + EQLA+ ER+  ++  E+EE++   +  E++RK+AE E  +A +++     QN+S + TK+K+E D++ MQ ++E+    AR A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE R+RELEGE++ EQKR+ E  K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQAK+K+YKRQ EEAEE +  NLAK+RK+Q E+E++EERAD AE  + KLR K+
Sbjct:   32 FDAKTSVFVAEPKESFVKGTIQSREGGKVTVKTEGGATLTVKDDQVFPMNPPKYDKIEDMAMMTHLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYKPEVVTAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGEKKKEEITSGKIQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVVFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYPFVSQGEISVASIDDQEELMATDSAIDILGFTNEEKVSIYKLTGAVMHYGNLKFKQKQREEQAEPDGTEVADKAAYLQSLNSADLLKALCYPRVKVGNEYVTKGQTVEQVSNAVGALAKAVYEKMFLWMVARINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKSANF-QKPKVVKGKAEAHFALIHYAGVVDYNITGWLEKNKDPLNETVVGLYQKSAMKTLAQLFSGAQTAEGEGAGGGAKKGGKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYADFKQRYKVLNASAIPEGQFIDSKKASEKLLASIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDDKLAQLITRTQARCRGFLARVEYQRMVERREAIFCIQYNIRSFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKIKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQAEAEGLADAEERCDQLIKTKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDETIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKIKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDIENEKQQLDEKLKKKEFEISNLQSKIEDEQALGIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKMRRDLEEATLQHEATAATLRKKHADSVAELGEQIDNLQRVKQKLEKEKSEMKMEIDDLASNVETVSKAKGNLEKMCRTLEDQLSELKSKEEEQQRLINDLTAQRGRLQTESGEFSRQLDEKEALVSQLSRGKQAFTQQIEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMLDVERTNAACAALDKKQRNFDKILAEWKQKCEETHAELEASQKEARSLGTELFKIKNAYEESLDQLETLKRENKNLQQEISDLTEQIAEGGKRIHELEKIKKQVEQEKCELQAALEEAEASLEHEEGKILRIQLELNQVKSEVDRKIAEKDEEIDQLKRNHIRIVESMQSTLDAEIRSRNDAIRLKKKMEGDLNEMEIQLNHANRMAAEALRNYRNTQGILKDTQIHLDDALRSQEDLKEQLAMVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLETDISQMQGEMEDILQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQLRLDEAEQLALKGGKKQIQKLEARVRELEGEVESEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNILRLQDLVDKLQAKVKSYKRQAEEAEEQSNTNLAKFRKLQHELEEAEERADIAESQVNKLRVKS 1930          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-5 (MYOsin heavy chain structural genes [Source:UniProtKB/TrEMBL;Acc:Q21000])

HSP 1 Score: 1733 bits (4487), Expect = 0.000e+0
Identity = 1030/1930 (53.37%), Postives = 1392/1930 (72.12%), Query Frame = 1
Query:   52 SDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANV--XXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK-VKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASK-ECLVASL---FAPAED---------XXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            +DP + +L    + LL      FDSKKN+W+ D +EG+IA  ++ + GD V V T KG  K +K+D  +QMNPPK+   EDMANLTFLNDASV  NLRQRYY  +IYTYSGLFC+ +NPY+R PIY+  V   Y GKRR EMPPH+F++SD AY NM  DRENQS+LITGESGAGKTENTKKVI+YFA V  +  S K      K + SLEDQIVQ NPVLEA+GNAKT RNNNSSRFGKFIRIHF T GK+AGADIE YLLEKSRVI Q  GER+YHIFYQ+ S   K   +KL +T     ++F++Q E+TIDGVDD+EEM +TDEAF I+ F+  EK  LF  T  IM+MGE+KFKQRPREEQAE +   E E    L  V ++  + A+LKP+VKVG E+V KGQ+ DQV +++GALAK+L+ RMF+WL+ R NKTLD + + R FFIGVLDIAGFEIFD N FEQ+ IN+ NE+LQQFFNHHMFVLEQEEYK+E I WEFIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKASD TL +KL D HLGK PNF KP+PPK  Q EAH  + HYAG+V YN+ GWLEKNKDPLN++ V +L A+K   L+A L   +A  ED               K K  SFMTVS M+RESLNKLM  L  T PHFIRCI+PNE K+ G++DA+LV++QL CNGVLEGIRICRKGFPNRM + +FKQRY++LA +A   G  + K   +KI  A+  D +L    ++ G TKVFFKAG LA LE++RDE L  +++ FQ   R YL + +YK+  DQ+V L ++QRNIR +  LR+W+W+KLF +VKP++  +++ EE +   ++ + L+EE  + E+ +K++E +N  L   K  L +QL+ E+DS A+ EE+ +KL+ QKAD+E ++  + D L +EE   + L + KKK+  D + LKK V DLE++++K E EK AKD QI+SL D ++ ++E ++K+ KEKK  +E+ +K  E ++AEE+KV++LNK KAKLE  LDE+E+ L RE++ R D EK +RKVEGELK  QEL+ +L R K E E+ +K+K+IEL+   S++EDE +LVA LQR+IKEL ARIQELEE+L+AER +R+KAEKA+++++ ELEE+ +RL+E GGATQAQ +LNKKREAEL KL++DLE+A +  E ++  +RKK  D   E +DQLD +QK + K+EREK++ + ++++L    +   K + N E+  K LE  ++D+  K DE +R + E     N+  +EN ++++ LEDAE+Q+  L + KQQ  +QLEE K+ L+ E+R +  L+  + N   + +  RESLEEEQ+ K+DVQRQL K  +E+QQ +A  +G G  R EE+EE RRK+  ++QE++E+ E+   K   LEK K RL  ++ED  +D +RAN +AS LEKKQK  DK++ EW++K      E+E S RE+R  + E F+L++QLE S +Q E+++RENK L+ E+ D+ +QLGEGG++VH+++K R+R+EIE++ELQ AL+EAE ALE EEAK  RAQ+E+SQ R E E+RL EKEEEFE TRKNH RT+ESMQ SLE E RGR E +K KKKLE D+NELE+ LD +N+L  + +K+ KK Q  + E+Q QVEE+     +  +   L ER+  ++  E E++  + + +E+ R+ AE E  E  D +NE S  NS  +ATKRK+E DL  +Q+++EE+ + A+ ++E+ KKAI D ++L DE++ EQEHA    +++K LESQ+K+LQ +L+EAEA  +KGGK+ L+KL+ RI ELE EL+GE +RH ETQK  R  DR+ +E+ +Q+DEDKK+Q+RM  LIE LQ KIKTYKRQ+E+AE +A+ NLAKYR++Q  +ED++ERAD AE ALQKLR K
Sbjct:    5 ADPGWQFLRQSPEQLLAATTKKFDSKKNVWVADPEEGFIAAEIKSSKGDTVVVVTSKGVEKTIKKDDAQQMNPPKYEKTEDMANLTFLNDASVLHNLRQRYYSMMIYTYSGLFCVVINPYKRLPIYSESVCQMYLGKRRNEMPPHLFAVSDEAYRNMTNDRENQSMLITGESGAGKTENTKKVISYFAMVGASQQSNKKKSKKDKAQVSLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNTGGKVAGADIEHYLLEKSRVIKQAPGERSYHIFYQIYSDAVKGLREKLFLTRPIKEYTFVSQAEVTIDGVDDKEEMLITDEAFDIMKFTATEKSELFAITAGIMHMGELKFKQRPREEQAELEEGKEGELACKLYCVESEKFINALLKPRVKVGTEWVNKGQNLDQVNWAVGALAKALFARMFSWLIRRCNKTLDAQDLSRDFFIGVLDIAGFEIFDLNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYKREGIQWEFIDFGLDLQACIELIEKPLGIVSMLDEECIVPKASDLTLASKLNDQHLGKHPNFQKPRPPKGKQAEAHLAIVHYAGTVRYNVKGWLEKNKDPLNDTAVTVLKANKGNQLMADLWADYATQEDVAAAAKDGKKAVGKKKGKSASFMTVSMMYRESLNKLMHMLHQTHPHFIRCIIPNELKKAGMIDANLVLNQLTCNGVLEGIRICRKGFPNRMPFLDFKQRYAVLAADAAKAG-KDPKDAGEKISAALIKDGSLKQEEFQCGLTKVFFKAGVLAHLEELRDEALGKIMAKFQCACRHYLAQCEYKRKLDQKVGLIVLQRNIRAWCTLRSWSWFKLFGRVKPLIKGSKKNEEFEALEKKFKVLEEEKTQEERKRKDMEAENARLEAEKQALLIQLEQERDSSAEGEERSAKLLAQKADLEKQMANMNDQLCDEEEKNAALTKQKKKIEQDNEGLKKTVSDLETTIKKQESEKQAKDHQIRSLQDEIQSQDEVISKLNKEKKHQEEVNRKLLEDIQAEEDKVNHLNKTKAKLESTLDELEDTLEREKRGRQDCEKQRRKVEGELKIAQELIEELNRHKHEQEQVIKKKDIELSSIQSRLEDEQSLVAKLQRQIKELLARIQELEEELDAERNSRSKAEKARNEMQMELEELGDRLDEAGGATQAQIELNKKREAELAKLRQDLEDAAINSETSMAALRKKHNDAVAELSDQLDTIQKMRGKLEREKNDKQREVDELQQSADVEAKQRQNCERMAKQLEAQLTDMTLKSDEQARLIQELTMGKNKVHNENQDLNRQLEDAEAQLCALNRIKQQQHSQLEELKRTLDQETRERQSLHSQVSNYQLECEQFRESLEEEQDAKTDVQRQLSKANSEIQQWRAKFEGEGVSRAEELEETRRKLTHKVQEMQEQLENANQKIGTLEKNKQRLAHDLEDAQVDADRANSIASSLEKKQKGFDKVLDEWRRKCEALVAEVEQSQRETRAAATETFRLRNQLEESGEQTEAVKRENKALAQELKDIADQLGEGGKSVHDLQKMRRRLEIEKEELQQALDEAECALEAEEAKVMRAQIEVSQIRSEIEKRLQEKEEEFENTRKNHSRTIESMQVSLETESRGRAELLKTKKKLEGDVNELEIALDHSNKLNVDGQKSMKKLQDTIRELQYQVEEEQRSLSESRDHANLAERRSQVLQQEKEDLAIIYEQSERTRRQAELELAEVKDSVNELSNSNSLLLATKRKVEGDLQLLQSEIEEAMSDAKTSDEKAKKAIMDASKLADELRSEQEHASNLNQSKKTLESQVKDLQMRLDEAEAAGIKGGKRQLAKLDMRIHELETELEGENRRHAETQKVLRNKDRKCRELQFQVDEDKKSQERMYDLIEKLQQKIKTYKRQIEDAESLASGNLAKYRQLQHVVEDAQERADAAENALQKLRLK 1933          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1676.37 bits (4340), Expect = 0.000e+0
Identity = 1039/1956 (53.12%), Postives = 1413/1956 (72.24%), Query Frame = 1
Query:   55 DPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXX--XXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK-VKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASK--ECLV----------ASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRS 5865
            DP + YL   R+ +L+     +DSKKN+WIPD +EGY+A  +  T GD+VT+ T +G    +K++ +++MNPPKF   EDM+NL+FLNDASV  NLR RY   LIYTYSGLFC+ +NPY+R PIYT      + GKR+ EMPPH+F++SD AY NML D ENQS+LITGESGAGKTENTKKVI YFA V A+ ++   + DP+KKK +LEDQIVQ NPVLEA+GNAKT RNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRVI Q  GER YHIFYQ+ S        +LL+      + F+ Q EL IDG+DD EE +LTDEAF IL FS  EK   ++  ++ M+MG MKFKQRPREEQAE DGT EAEK S + G+  ++ ++A+ KP+VKVG E+V+KGQ+ +QV +++GA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIFDFN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D TL +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN++VV  +  SK  + LV           +     E  G    K K GSFMTVS ++RESLN LM  L  T PHFIRCI+PNE KQ G++DA LV++QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA     +   + K+  + I++ +  D +L    +R+G TKVFFKAG LA LEDIRDEKL+++++ FQ+QIR +L  +  K+  +QR  L ++QRN+R +  LRTW W+KL+ KVKPML   ++ EE++K  ++++ L++   K EK +KELEE +  L++ K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L++ E+  + ++ AKKK+ A+++ LKK ++DLE SL+KAE EK +KD QI+SL D +++++E +AK+ KEKK  +E+ +K  E L++EE+K ++ NK KAKLEQ LD++E++L RE++ RAD++K KRKVEGELK  QE +++  R + +LE  LK+KE EL+  +S++EDE  LV+ LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++AK  L+ ELEE+ E+L+EQGGAT AQ ++NKKREAEL KL+RDLEEANM HE  L  +RKK  D   E  DQLDQL K+K+K+E++K++   D EDL++QL+     K N EK  K  E  +++LQ+K DE SRQL +  ++  R   EN ++ + LEDAESQ+NQL + K QL +QLEEA++  ++E+R +  +    +N   + + L+ESLEEE EGK+++ RQL K   ++QQ KA  +G G ++ +E+E+ +R+   +I EL+E  ++  SK + LEK KSRL G+++D  +DVERANG+AS LEKKQK  DK+I EW+KK  +   EL+ + R+ R  S ++FK K+  E   + +E LRRENK+LS EI DLT+QLGEGGR+VHE++K  +R+EIE++ELQHAL+EAE+ALE EE+K  RAQ+E+SQ R E E+R+ EKEEEFE TRKNH R LESMQASLE E +G+ E +++KKKLE DINELE+ LD AN+  ++ +KN K+YQ+Q+ E+Q QVEE+        EQ    E++  ++  E EE+    + AE+ RK AE E  +A D+ NE + Q SS  + KRK+E ++ A+ ADL+E+ N  + A E+ KKAI D TRL +E++QEQEH+Q  ++ RK LE QLKE+Q +L+EAEA  LKGGKK ++KLEQR+RELE ELDGEQ+R  +  KN  ++DRR++E+ +Q+DEDKKN +R+Q LI+ LQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+         AS  PG + S +A  IRS
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGASQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKE-AKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKS------RASASVAPGLQSSASAAVIRS 1954          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1676.37 bits (4340), Expect = 0.000e+0
Identity = 1039/1956 (53.12%), Postives = 1413/1956 (72.24%), Query Frame = 1
Query:   55 DPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXX--XXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK-VKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASK--ECLV----------ASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRS 5865
            DP + YL   R+ +L+     +DSKKN+WIPD +EGY+A  +  T GD+VT+ T +G    +K++ +++MNPPKF   EDM+NL+FLNDASV  NLR RY   LIYTYSGLFC+ +NPY+R PIYT      + GKR+ EMPPH+F++SD AY NML D ENQS+LITGESGAGKTENTKKVI YFA V A+ ++   + DP+KKK +LEDQIVQ NPVLEA+GNAKT RNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRVI Q  GER YHIFYQ+ S        +LL+      + F+ Q EL IDG+DD EE +LTDEAF IL FS  EK   ++  ++ M+MG MKFKQRPREEQAE DGT EAEK S + G+  ++ ++A+ KP+VKVG E+V+KGQ+ +QV +++GA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIFDFN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D TL +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN++VV  +  SK  + LV           +     E  G    K K GSFMTVS ++RESLN LM  L  T PHFIRCI+PNE KQ G++DA LV++QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA     +   + K+  + I++ +  D +L    +R+G TKVFFKAG LA LEDIRDEKL+++++ FQ+QIR +L  +  K+  +QR  L ++QRN+R +  LRTW W+KL+ KVKPML   ++ EE++K  ++++ L++   K EK +KELEE +  L++ K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L++ E+  + ++ AKKK+ A+++ LKK ++DLE SL+KAE EK +KD QI+SL D +++++E +AK+ KEKK  +E+ +K  E L++EE+K ++ NK KAKLEQ LD++E++L RE++ RAD++K KRKVEGELK  QE +++  R + +LE  LK+KE EL+  +S++EDE  LV+ LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++AK  L+ ELEE+ E+L+EQGGAT AQ ++NKKREAEL KL+RDLEEANM HE  L  +RKK  D   E  DQLDQL K+K+K+E++K++   D EDL++QL+     K N EK  K  E  +++LQ+K DE SRQL +  ++  R   EN ++ + LEDAESQ+NQL + K QL +QLEEA++  ++E+R +  +    +N   + + L+ESLEEE EGK+++ RQL K   ++QQ KA  +G G ++ +E+E+ +R+   +I EL+E  ++  SK + LEK KSRL G+++D  +DVERANG+AS LEKKQK  DK+I EW+KK  +   EL+ + R+ R  S ++FK K+  E   + +E LRRENK+LS EI DLT+QLGEGGR+VHE++K  +R+EIE++ELQHAL+EAE+ALE EE+K  RAQ+E+SQ R E E+R+ EKEEEFE TRKNH R LESMQASLE E +G+ E +++KKKLE DINELE+ LD AN+  ++ +KN K+YQ+Q+ E+Q QVEE+        EQ    E++  ++  E EE+    + AE+ RK AE E  +A D+ NE + Q SS  + KRK+E ++ A+ ADL+E+ N  + A E+ KKAI D TRL +E++QEQEH+Q  ++ RK LE QLKE+Q +L+EAEA  LKGGKK ++KLEQR+RELE ELDGEQ+R  +  KN  ++DRR++E+ +Q+DEDKKN +R+Q LI+ LQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+         AS  PG + S +A  IRS
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGASQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKE-AKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKS------RASASVAPGLQSSASAAVIRS 1954          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: unc-54 (Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566])

HSP 1 Score: 1676.37 bits (4340), Expect = 0.000e+0
Identity = 1039/1956 (53.12%), Postives = 1413/1956 (72.24%), Query Frame = 1
Query:   55 DPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXX--XXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK-VKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASK--ECLV----------ASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRS 5865
            DP + YL   R+ +L+     +DSKKN+WIPD +EGY+A  +  T GD+VT+ T +G    +K++ +++MNPPKF   EDM+NL+FLNDASV  NLR RY   LIYTYSGLFC+ +NPY+R PIYT      + GKR+ EMPPH+F++SD AY NML D ENQS+LITGESGAGKTENTKKVI YFA V A+ ++   + DP+KKK +LEDQIVQ NPVLEA+GNAKT RNNNSSRFGKFIRIHF   G++A  DIE YLLEKSRVI Q  GER YHIFYQ+ S        +LL+      + F+ Q EL IDG+DD EE +LTDEAF IL FS  EK   ++  ++ M+MG MKFKQRPREEQAE DGT EAEK S + G+  ++ ++A+ KP+VKVG E+V+KGQ+ +QV +++GA+AK LY+R+F WLV + N TLD K + R +FIGVLDIAGFEIFDFN FEQ+ IN+ NE+LQQFFNHHMFVLEQEEY +E I W FIDFG+DLQACIELIEKP+GI+S+L+EEC+ PKA+D TL +KL D HLGK PNF KPKPPK  Q EAHF + HYAG+V YN   WLEKNKDPLN++VV  +  SK  + LV           +     E  G    K K GSFMTVS ++RESLN LM  L  T PHFIRCI+PNE KQ G++DA LV++QL CNGVLEGIRICRKGFPNR ++ +F QRY+ILA     +   + K+  + I++ +  D +L    +R+G TKVFFKAG LA LEDIRDEKL+++++ FQ+QIR +L  +  K+  +QR  L ++QRN+R +  LRTW W+KL+ KVKPML   ++ EE++K  ++++ L++   K EK +KELEE +  L++ K  LF  L++ +  L+DAEE+++KL  Q+ D   ++ EL D L++ E+  + ++ AKKK+ A+++ LKK ++DLE SL+KAE EK +KD QI+SL D +++++E +AK+ KEKK  +E+ +K  E L++EE+K ++ NK KAKLEQ LD++E++L RE++ RAD++K KRKVEGELK  QE +++  R + +LE  LK+KE EL+  +S++EDE  LV+ LQR+IK+ Q+RI ELEE+LE ERQ+R+KA++AK  L+ ELEE+ E+L+EQGGAT AQ ++NKKREAEL KL+RDLEEANM HE  L  +RKK  D   E  DQLDQL K+K+K+E++K++   D EDL++QL+     K N EK  K  E  +++LQ+K DE SRQL +  ++  R   EN ++ + LEDAESQ+NQL + K QL +QLEEA++  ++E+R +  +    +N   + + L+ESLEEE EGK+++ RQL K   ++QQ KA  +G G ++ +E+E+ +R+   +I EL+E  ++  SK + LEK KSRL G+++D  +DVERANG+AS LEKKQK  DK+I EW+KK  +   EL+ + R+ R  S ++FK K+  E   + +E LRRENK+LS EI DLT+QLGEGGR+VHE++K  +R+EIE++ELQHAL+EAE+ALE EE+K  RAQ+E+SQ R E E+R+ EKEEEFE TRKNH R LESMQASLE E +G+ E +++KKKLE DINELE+ LD AN+  ++ +KN K+YQ+Q+ E+Q QVEE+        EQ    E++  ++  E EE+    + AE+ RK AE E  +A D+ NE + Q SS  + KRK+E ++ A+ ADL+E+ N  + A E+ KKAI D TRL +E++QEQEH+Q  ++ RK LE QLKE+Q +L+EAEA  LKGGKK ++KLEQR+RELE ELDGEQ+R  +  KN  ++DRR++E+ +Q+DEDKKN +R+Q LI+ LQ K+KT K+QVEEAEE+A +NL KY+++  ++ED+EERADQAE +L K+R+K+         AS  PG + S +A  IRS
Sbjct:    6 DPGWQYLRRTREQVLEDQSKPYDSKKNVWIPDPEEGYLAGEITATKGDQVTIVTARGNEVTLKKELVQEMNPPKFEKTEDMSNLSFLNDASVLHNLRSRYAAMLIYTYSGLFCVVINPYKRLPIYTDSCARMFMGKRKTEMPPHLFAVSDEAYRNMLQDHENQSMLITGESGAGKTENTKKVICYFAAVGASQQEGGAEVDPNKKKVTLEDQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRIHFNKHGRLASCDIEHYLLEKSRVIRQAPGERCYHIFYQIYSDFRPELKKELLLDLPIKDYWFVAQAELIIDGIDDVEEFQLTDEAFDILNFSAVEKQDCYRLMSAHMHMGNMKFKQRPREEQAEPDGTDEAEKASNMYGIGCEEFLKALTKPRVKVGTEWVSKGQNCEQVNWAVGAMAKGLYSRVFNWLVKKCNLTLDQKGIDRDYFIGVLDIAGFEIFDFNSFEQLWINFVNEKLQQFFNHHMFVLEQEEYAREGIQWVFIDFGLDLQACIELIEKPLGIISMLDEECIVPKATDLTLASKLVDQHLGKHPNFEKPKPPKGKQGEAHFAMRHYAGTVRYNCLNWLEKNKDPLNDTVVSAMKQSKGNDLLVEIWQDYTTQEEAAAKAKEGGGGGKKKGKSGSFMTVSMLYRESLNNLMTMLNKTHPHFIRCIIPNEKKQSGMIDAALVLNQLTCNGVLEGIRICRKGFPNRTLHPDFVQRYAILAAKE-AKSDDDKKKCAEAIMSKLVNDGSLSEEMFRIGLTKVFFKAGVLAHLEDIRDEKLATILTGFQSQIRWHLGLKDRKRRMEQRAGLLIVQRNVRSWCTLRTWEWFKLYGKVKPMLKAGKEAEELEKINDKVKALEDSLAKEEKLRKELEESSAKLVEEKTSLFTNLESTKTQLSDAEERLAKLEAQQKDASKQLSELNDQLADNEDRTADVQRAKKKIEAEVEALKKQIQDLEMSLRKAESEKQSKDHQIRSLQDEMQQQDEAIAKLNKEKKHQEEINRKLMEDLQSEEDKGNHQNKVKAKLEQTLDDLEDSLEREKRARADLDKQKRKVEGELKIAQENIDESGRQRHDLENNLKKKESELHSVSSRLEDEQALVSKLQRQIKDGQSRISELEEELENERQSRSKADRAKSDLQRELEELGEKLDEQGGATAAQVEVNKKREAELAKLRRDLEEANMNHENQLGGLRKKHTDAVAELTDQLDQLNKAKAKVEKDKAQAVRDAEDLAAQLDQETSGKLNNEKLAKQFELQLTELQSKADEQSRQLQDFTSLKGRLHSENGDLVRQLEDAESQVNQLTRLKSQLTSQLEEARRTADEEARERQTVAAQAKNYQHEAEQLQESLEEEIEGKNEILRQLSKANADIQQWKARFEGEGLLKADELEDAKRRQAQKINELQEALDAANSKNASLEKTKSRLVGDLDDAQVDVERANGVASALEKKQKGFDKIIDEWRKKTDDLAAELDGAQRDLRNTSTDLFKAKNAQEELAEVVEGLRRENKSLSQEIKDLTDQLGEGGRSVHEMQKIIRRLEIEKEELQHALDEAEAALEAEESKVLRAQVEVSQIRSEIEKRIQEKEEEFENTRKNHARALESMQASLETEAKGKAELLRIKKKLEGDINELEIALDHANKANADAQKNLKRYQEQVRELQLQVEEEQRNGADTREQFFNAEKRATLLQSEKEELLVANEAAERARKQAEYEAADARDQANEANAQVSSLTSAKRKLEGEIQAIHADLDETLNEYKAAEERSKKAIADATRLAEELRQEQEHSQHVDRLRKGLEQQLKEIQVRLDEAEAAALKGGKKVIAKLEQRVRELESELDGEQRRFQDANKNLGRADRRVRELQFQVDEDKKNFERLQDLIDKLQQKLKTQKKQVEEAEELANLNLQKYKQLTHQLEDAEERADQAENSLSKMRSKS------RASASVAPGLQSSASAAVIRS 1954          
BLAST of Myosin heavy chain vs. Ensembl Celegans
Match: myo-3 (Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844])

HSP 1 Score: 1612.82 bits (4175), Expect = 0.000e+0
Identity = 966/1929 (50.08%), Postives = 1371/1929 (71.07%), Query Frame = 1
Query:   52 SDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX--XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTK-VKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKE-CLVASLFAPAEDXXXXXXXX-----------XXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            +DP F +LG+ R+A        FDSKKN WIPD ++G++A  ++ T G++VTV T KG    VK+D  ++MNPPKF   EDMANLTFLN+ASV  NL+ RY   +IYTYSGLFC+ +NPY+R PIY+  VI  + GKRR EMPPH+F++SD AY NM+ D+ENQS+LITGESGAGKTENTKKVI+YFA V A       +    K   +LE+QIVQ NPVLEA+GNAKT RNNNSSRFGKFIR HF  SGK+AG DIE YLLEKSRV+ Q  GER YHIFYQ++S    S   KL ++ D   + F +Q ELTI+G+DD+EEM+LT EAF I+GF D E M L++ T  IM+MGEMKFKQRPREEQAE DG  +A   + +LG+ A++ ++A+ KP+V+VG E+V KGQ+ +QV +++  LAK++Y RMF W++TR NKTLD K ++R+ FIGVLDIAGFEIFD N FEQ+ IN+ NERLQQFFNHHMFVLEQEEYK+E I W FIDFG+DLQACIELIEKP+GI+SIL+EEC+ PKA+D T   KL D HLGK PNF KPKPPK  Q +AHF + HYAG+V YN T +LEKNKDPLN++ V LL  S +  L+  ++   +   +                K  SF TVS ++RESLN LM  L  T PHFIRCI+PNE K  GV+D+ LV++QL CNGVLEGIRICRKGFPNRM+Y +FK RY+ILA +A  +   + K+ +  IL  I +D NL    +++G TK+FFKAG LA+LED+RDE LS ++++FQ++IR YL + + ++  +Q+  L ++QRN+R +  LRTW W+KLF KVKPML   +++E M + A +++KL+E  ++ E  + +LE Q   L++ KN LFL L+TE+ +LADAEE+  KL   KA +E ++ ++   L + +     L   KKK + ++ + KK V+DLE SL+KAEQEK ++D  I+SL D +  ++E +AK+ KEKK  +E  +K  E L++EE+KV++L K + KLEQ +DE+EEN+ RE++ R D+EKAKRKVEG+LK  QE ++++ + K ++E  LKRKE +L+  N+K+ + ++++A LQR IKEL AR  ELEE+LEAER +R K+++++ + E ELEE++ERLE+QGGAT AQ + NKKREAE+ KL+R+ EE ++ HE A+  +RK+  D+  E  +QL+ LQK K+K E EKS+L+ D+E+     +S  +++ +LEK+ K +E   S+LQ K DE SRQL +   + NR  +ENS+++++LE+ ++Q+N L + K  LQ+QL+E ++N ++ESR +  L    +N   +   LRE L+EE E K+D+ RQ+ K+  E+QQ KA     G  + EE+E  ++ +  ++QEL + +E   +K +  EK++ +L  +++D   DVE+A    +  EK ++  + +I EW+KK  +   EL+ + R++R +S ++FK K+  +   + ++S RRENK+L+ E+ DLT+QLGEGGR+V E++K  +++E+E++ELQ AL+EAE+ALE EEAK  RAQ+E+SQ R E E+R+ EKEEEFE TR+NHQR LESMQA+LEAE + + EA+++KKKLE DIN+LE+ LD ANR  ++ +K  KKY + + E+Q Q+EE+  Q++++ EQ   +E++  ++  E +E+    + AE+ R+ AE+E  E  ++ N+ +   S+    +RK+E +L A  A+LEE  N  + A EQ +KA  D  RL +E++QEQEH+   E+ RK LE Q+KE+Q +L++AE   LKGGKK +++LE RIR +E ELDGEQ+RH +T+KN RK++RR+KE+ +Q+ E+KKN++R+ +L++ LQ K+K +KRQVEEAEE+AA NL KY+ +  + E +EERAD AE AL K+R K
Sbjct:   10 NDPGFPFLGISREARAATAARPFDSKKNCWIPDPEDGFVAAEIQSTTGEQVTVVTVKGNQITVKKDQCQEMNPPKFDKTEDMANLTFLNEASVLGNLKDRYKDLMIYTYSGLFCVVINPYKRLPIYSESVIKHFMGKRRNEMPPHLFAVSDEAYRNMVQDKENQSMLITGESGAGKTENTKKVISYFAIVGATQAASGKEAKDGKKGGTLEEQIVQTNPVLEAFGNAKTVRNNNSSRFGKFIRTHFSGSGKLAGGDIEHYLLEKSRVVRQAPGERCYHIFYQIMSGNDPSLRGKLKLSNDITYYHFCSQAELTIEGMDDKEEMRLTQEAFDIMGFEDNETMDLYRSTAGIMHMGEMKFKQRPREEQAEPDGEEDALNAAAMLGIQAEEFLKALTKPRVRVGTEWVNKGQNLEQVNWAVSGLAKAIYARMFKWIITRCNKTLDAKEIERKHFIGVLDIAGFEIFDLNSFEQLWINFVNERLQQFFNHHMFVLEQEEYKREGIAWTFIDFGLDLQACIELIEKPLGIISILDEECIVPKATDMTYAQKLLDQHLGKHPNFQKPKPPKGKQGDAHFAIVHYAGTVRYNATNFLEKNKDPLNDTAVALLKHSTDNSLMLDIWQDYQTQEEAAEAAKAGQTAGGKRGKSSSFATVSMIYRESLNNLMNMLYQTHPHFIRCIIPNEKKASGVIDSALVLNQLTCNGVLEGIRICRKGFPNRMLYPDFKHRYAILAADAAKES--DPKKASVGILDKISVDGNLTDEEFKVGETKIFFKAGVLAKLEDLRDEILSRIVTMFQSRIRSYLAKAEVRRRYEQQTGLLVVQRNVRAWCTLRTWEWFKLFGKVKPMLKAGKEQEAMGELAVKIQKLEEAVQRGEIARSQLESQVADLVEEKNALFLSLETEKANLADAEERNEKLNQLKATLESKLSDITGQLEDMQERNEDLARQKKKTDQELSDTKKHVQDLELSLRKAEQEKQSRDHNIRSLQDEMANQDEAVAKLNKEKKHQEESNRKLNEDLQSEEDKVNHLEKIRNKLEQQMDELEENIDREKRSRGDIEKAKRKVEGDLKVAQENIDEITKQKHDVETTLKRKEEDLHHTNAKLAENNSIIAKLQRLIKELTARNAELEEELEAERNSRQKSDRSRSEAERELEELTERLEQQGGATAAQLEANKKREAEIAKLRREKEEDSLNHETAISSLRKRHGDSVAELTEQLETLQKLKAKSEAEKSKLQRDLEESQHATDSEVRSRQDLEKALKTIEVQYSELQTKADEQSRQLQDFAALKNRLNNENSDLNRSLEEMDNQLNSLHRLKSTLQSQLDETRRNYDEESRERQALAATAKNLEHENTILREHLDEEAESKADLTRQISKLNAEIQQWKARFDSEGLNKLEEIEAAKKALQLKVQELTDTNEGLFAKIASQEKVRFKLMQDLDDAQSDVEKAAAQVAFYEKHRRQFESIIAEWKKKTDDLSSELDAAQRDNRQLSTDLFKAKTANDELAEYLDSTRRENKSLAQEVKDLTDQLGEGGRSVAELQKIVRKLEVEKEELQKALDEAEAALEAEEAKVLRAQIEVSQIRSEIEKRIQEKEEEFENTRRNHQRALESMQATLEAETKQKEEALRIKKKLESDINDLEIALDHANRAYADAQKTIKKYMETVQELQFQIEEEQRQKDEIREQFLASEKRNAILQSEKDELAQQAEAAERARRNAEAECIELREQNNDLNAHVSALTGQRRKLEGELLAAHAELEEIANELKNAVEQGQKASADAARLAEELRQEQEHSMHIERIRKGLELQIKEMQIRLDDAENAALKGGKKIIAQLEARIRAIEQELDGEQRRHQDTEKNWRKAERRVKEVEFQVVEEKKNEERLTELVDKLQCKLKIFKRQVEEAEEVAASNLNKYKVLTAQFEQAEERADIAENALSKMRNK 1936          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0301827)

HSP 1 Score: 1844.32 bits (4776), Expect = 0.000e+0
Identity = 1096/1918 (57.14%), Postives = 1423/1918 (74.19%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GET+ +K+D L+Q+NPPK+   EDM+NLT+LNDASV  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY I+ P  + QG  + K+ T+ I+  I L  + YRLGNTKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E+EK+E    + DL + ++ +   K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYKIMCPKLL-QGVEKDKKATEIIIKFIDLPEDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAK 1922          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0307496)

HSP 1 Score: 1843.17 bits (4773), Expect = 0.000e+0
Identity = 1095/1918 (57.09%), Postives = 1424/1918 (74.24%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GET+ +K+D L+Q+NPPK+   EDM+NLT+LNDASV  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++ + +L+ + YRLGNTKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E+EK+E    + DL + ++ +   K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAK 1922          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080896)

HSP 1 Score: 1842.4 bits (4771), Expect = 0.000e+0
Identity = 1102/1947 (56.60%), Postives = 1433/1947 (73.60%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSE 5868
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GET+ +K+D L+Q+NPPK+   EDM+NLT+LNDASV  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY I+ P  + QG  + K+ T+ I+  I L  + YRLGNTKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E+EK+E    + DL + ++ +   K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK R+            G   +  ATS+R +
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYKIMCPKLL-QGVEKDKKATEIIIKFIDLPEDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGR-------GASPAPRATSVRPQ 1944          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080900)

HSP 1 Score: 1841.63 bits (4769), Expect = 0.000e+0
Identity = 1101/1947 (56.55%), Postives = 1434/1947 (73.65%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSE 5868
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GET+ +K+D L+Q+NPPK+   EDM+NLT+LNDASV  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E IDW FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++ + +L+ + YRLGNTKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E+EK+E    + DL + ++ +   K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK R+            G   +  ATS+R +
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIDWAFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGR-------GASPAPRATSVRPQ 1944          
BLAST of Myosin heavy chain vs. Ensembl Fly
Match: Mhc (gene:FBgn0264695 transcript:FBtr0080903)

HSP 1 Score: 1838.93 bits (4762), Expect = 0.000e+0
Identity = 1099/1947 (56.45%), Postives = 1434/1947 (73.65%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSE 5868
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GET+ +K+D L+Q+NPPK+   EDM+NLT+LNDASV  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNHHMFVLEQEEY++E I+W FIDFGMDLQ CI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +G  + K+ T  ++ + +L+ + YRLGNTKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E+EK+E    + DL + ++ +   K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK R+            G   +  ATS+R +
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGETRDLKKDLLQQVNPPKYEKAEDMSNLTYLNDASVLHNLRQRYYNKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHHMFVLEQEEYQREGIEWTFIDFGMDLQLCIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPKGI-KGIEDPKKCTKVLIESTELNDDQYRLGNTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEKEKNEYYGQLNDLRAGVDHITNEKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGR-------GASPAPRATSVRPQ 1944          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7ba (myosin, heavy chain 7B, cardiac muscle, beta a [Source:ZFIN;Acc:ZDB-GENE-100914-2])

HSP 1 Score: 1749.18 bits (4529), Expect = 0.000e+0
Identity = 1001/1899 (52.71%), Postives = 1400/1899 (73.72%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF--------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            +FD KK  WIPD+K+ YI + +++ +GD+V V+T  G+   VK+D ++QMNPPKF +IEDMA LT LN+ASV  NLR+RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++ML +RENQS+LITGESGAGKT NTK+VI YFA VAA  +            LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ++S       D LLV+++P  + F +QG  T++ +DD +E+  TD A  ILGF+ EEK   +K   +IM+ G MKFKQ+ REEQAEADGT  A+K S+L+GV++ DL++ +L P+VKVGNEYV KGQ+ +QV Y++GALAK+ Y+RMF WLV R+N+TL T + RQFFIGVLDIAGFEIF+ N FEQ+CIN+TNE+LQQFFNHHMF+LEQEEYK+E I+W FIDFG+DLQACI+LIEKP+GI+SILEEECMFPKA+D + KAKL+DNHLGKS NF KP+P K  ++EAHFEL HYAG VPYNI GWL+KNKDPLNE+VV     S   L+ASL+        A    TG    +KK  SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PG++D+ +V+HQL CNGVLEGIRICRKGFPNRM+Y+EFKQRY IL P+AIP   FV+ ++  +K+L ++ +D N YR G+TKVFFKAG L QLE++RDE+L+ +++L QA  RG +MR +  K+  ++ AL +IQ NIR + +++ W W KLF K+KP+L  A  E+E+    EE  KLKE  EK+E  +KELEE+ V+L+Q KNDL LQLQ EQD+LADAE++   L+  K  +E ++KE+ + L +EE   +T+   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E + K+ KEKKA  E  ++T + L+ EE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E++KRK+EG+LK + E + DLE  K +LEE+LK+K+ E+N  +SKIED+  L+  LQ+KIKELQARI+ELEE++EAER  RAK EK +     ELEE+SERLEE GGAT AQ ++NKKREA+ +KL+RDLEEA + HE     +RKK  D+  E ++Q+D LQ+ K K+E+E+SE + + +DL+S LE L K K   EK+ +  E  +++ + K++EL RQL++      R Q E++E+ + LE+ E+ ++QL ++K      +EE K+ LE+ES++K  L   L+++  D D LRE  +EEQEGKS++QR L K   E+ Q +   +     +TEE+EE ++K+  R+QE EE+ E++ +KCS LEK K RLQ EIEDLV+D+ER+N  A+ L+KKQ+  DK++ EW+ KY E Q ELE S +ESR +S E+FKLK+  E + D +ES++RE+KNL +EI DL +Q+ +GG+ +HE+EK +K +++E+ E+Q ALEEAE  LE EE+K+ R QLE++Q + +++R+LAEK+EE +  R+NHQR LESMQA+L+AE + R+EA+++KKK+E+D+NE+EV L+ AN L +E +K  +  Q Q+ ++Q +++E  HQ E++ EQ A+TER+  ++  E+EE++   +  ++ RK+AE E  E  +++N    QN+S +  K+K+E DLA + ++++++    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++R+LE EL+ EQK+  E QK  RK +RR+KE++YQ +ED+KN  R+Q+LI+ LQAK+KTYKRQ E+AEE A  NL KY+KIQ E++D+EERAD AE  + KLR ++
Sbjct:   31 AFDGKKRAWIPDDKDAYIEVEIKQIDGDRVEVETKDGKCLTVKEDDIQQMNPPKFDLIEDMAMLTHLNEASVLFNLRRRYSSWMIYTYSGLFCVTVNPYKWLPVYTAPVVAAYKGKRRSEAPPHIYSIADNAYNDMLRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEAAAKKGGT----LEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQIMSQKKPELLDMLLVSSNPYDYHFCSQGVTTVENMDDGQELMATDHAMDILGFTPEEKYGCYKIVGAIMHFGNMKFKQKQREEQAEADGTESADKASYLMGVSSADLIKGLLHPRVKVGNEYVVKGQNVEQVNYAVGALAKATYDRMFKWLVGRINRTLYTALPRQFFIGVLDIAGFEIFELNSFEQLCINFTNEKLQQFFNHHMFILEQEEYKREGIEWTFIDFGLDLQACIDLIEKPLGIMSILEEECMFPKATDNSFKAKLFDNHLGKSANFQKPRPDKKRKYEAHFELVHYAGVVPYNIIGWLDKNKDPLNETVVICFQKSSNKLLASLYEKYVSSDSASDPKTGGKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNETKTPGIMDSFMVLHQLRCNGVLEGIRICRKGFPNRMLYAEFKQRYRILNPHAIPDDKFVDSRKAAEKLLASLDIDHNQYRFGHTKVFFKAGLLGQLEEMRDERLAKILTLLQAASRGKIMRMELNKMTQRKEALMIIQWNIRAFNIVKNWPWMKLFFKIKPLLRSAATEKELAALKEEFLKLKEALEKSEAKRKELEEKQVSLIQEKNDLSLQLQAEQDNLADAEDRCDLLIKTKIQLEAKVKEMTERLEDEEEMNATVLAKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDETILKLTKEKKALQESHQQTLDDLQTEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERSKRKLEGDLKLSMESVMDLENDKQQLEEKLKKKDFEMNQISSKIEDDQVLIIQLQKKIKELQARIEELEEEMEAERSTRAKMEKHRSDSSKELEELSERLEEAGGATSAQIEMNKKREADFLKLRRDLEEAILHHEAMTAALRKKHADSVVELSEQIDSLQRVKQKLEKERSEAKMEADDLTSNLEQLAKGKATAEKTCRLYEDQMNESKAKVEELQRQLSDTNTQRARAQAESAELGRKLEEREALVSQLQRSKNTFSQNIEELKKQLEEESKSKNALTHALQSSRHDCDLLREQYDEEQEGKSELQRALSKANAEVAQWRTKYETDAIQKTEELEEAKKKLATRLQESEEQVEASNAKCSSLEKTKHRLQSEIEDLVLDLERSNAAATALDKKQRQFDKILAEWRHKYEECQSELESSQKESRNLSTELFKLKNSYEEALDHLESIKRESKNLQEEISDLNDQISQGGKTIHELEKIKKGLDLEKTEIQAALEEAEGTLEHEESKTLRIQLELNQIKADTDRKLAEKDEEIDNLRRNHQRALESMQATLDAEAKSRSEAIRVKKKMENDLNEMEVQLNHANWLATESQKMVRNLQTQIKDLQMELDETVHQNEELKEQSAVTERRNNLLTAEVEELRCQLEQNDRARKLAEFELLETTERVNLLHSQNTSMLNQKKKLENDLATLSSEVDDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQLRLDEAEQIALKGGKKQIQKLESKVRDLESELESEQKKSNELQKGIRKYERRIKELTYQTEEDRKNIARLQELIDKLQAKVKTYKRQAEDAEEQANSNLTKYKKIQHELDDAEERADIAESQVNKLRTRS 1925          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7ba (myosin, heavy chain 7B, cardiac muscle, beta a [Source:ZFIN;Acc:ZDB-GENE-100914-2])

HSP 1 Score: 1748.02 bits (4526), Expect = 0.000e+0
Identity = 1005/1902 (52.84%), Postives = 1406/1902 (73.92%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXX---XXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF--------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            +FD KK  WIPD+K+ YI + +++ +GD+V V+T  G+   VK+D ++QMNPPKF +IEDMA LT LN+ASV  NLR+RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++ML +RENQS+LITGESGAGKT NTK+VI YFA VAA   A+ K     +K  G+LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ++S       D LLV+++P  + F +QG  T++ +DD +E+  TD A  ILGF+ EEK   +K   +IM+ G MKFKQ+ REEQAEADGT  A+K S+L+GV++ DL++ +L P+VKVGNEYV KGQ+ +QV Y++GALAK+ Y+RMF WLV R+N+TL T + RQFFIGVLDIAGFEIF+ N FEQ+CIN+TNE+LQQFFNHHMF+LEQEEYK+E I+W FIDFG+DLQACI+LIEKP+GI+SILEEECMFPKA+D + KAKL+DNHLGKS NF KP+P K  ++EAHFEL HYAG VPYNI GWL+KNKDPLNE+VV     S   L+ASL+        A    TG    +KK  SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PG++D+ +V+HQL CNGVLEGIRICRKGFPNRM+Y+EFKQRY IL P+AIP   FV+ ++  +K+L ++ +D N YR G+TKVFFKAG L QLE++RDE+L+ +++L QA  RG +MR +  K+  ++ AL +IQ NIR + +++ W W KLF K+KP+L  A  E+E+    EE  KLKE  EK+E  +KELEE+ V+L+Q KNDL LQLQ EQD+LADAE++   L+  K  +E ++KE+ + L +EE   +T+   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E + K+ KEKKA  E  ++T + L+ EE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E++KRK+EG+LK + E + DLE  K +LEE+LK+K+ E+N  +SKIED+  L+  LQ+KIKELQARI+ELEE++EAER  RAK EK +     ELEE+SERLEE GGAT AQ ++NKKREA+ +KL+RDLEEA + HE     +RKK  D+  E ++Q+D LQ+ K K+E+E+SE + + +DL+S LE L K K   EK+ +  E  +++ + K++EL RQL++      R Q E++E+ + LE+ E+ ++QL ++K      +EE K+ LE+ES++K  L   L+++  D D LRE  +EEQEGKS++QR L K   E+ Q +   +     +TEE+EE ++K+  R+QE EE+ E++ +KCS LEK K RLQ EIEDLV+D+ER+N  A+ L+KKQ+  DK++ EW+ KY E Q ELE S +ESR +S E+FKLK+  E + D +ES++RE+KNL +EI DL +Q+ +GG+ +HE+EK +K +++E+ E+Q ALEEAE  LE EE+K+ R QLE++Q + +++R+LAEK+EE +  R+NHQR LESMQA+L+AE + R+EA+++KKK+E+D+NE+EV L+ AN L +E +K  +  Q Q+ ++Q +++E  HQ E++ EQ A+TER+  ++  E+EE++   +  ++ RK+AE E  E  +++N    QN+S +  K+K+E DLA + ++++++    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++R+LE EL+ EQK+  E QK  RK +RR+KE++YQ +ED+KN  R+Q+LI+ LQAK+KTYKRQ E+AEE A  NL KY+KIQ E++D+EERAD AE  + KLR ++
Sbjct:   31 AFDGKKRAWIPDDKDAYIEVEIKQIDGDRVEVETKDGKCLTVKEDDIQQMNPPKFDLIEDMAMLTHLNEASVLFNLRRRYSSWMIYTYSGLFCVTVNPYKWLPVYTAPVVAAYKGKRRSEAPPHIYSIADNAYNDMLRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEAAAKKGAPATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQIMSQKKPELLDMLLVSSNPYDYHFCSQGVTTVENMDDGQELMATDHAMDILGFTPEEKYGCYKIVGAIMHFGNMKFKQKQREEQAEADGTESADKASYLMGVSSADLIKGLLHPRVKVGNEYVVKGQNVEQVNYAVGALAKATYDRMFKWLVGRINRTLYTALPRQFFIGVLDIAGFEIFELNSFEQLCINFTNEKLQQFFNHHMFILEQEEYKREGIEWTFIDFGLDLQACIDLIEKPLGIMSILEEECMFPKATDNSFKAKLFDNHLGKSANFQKPRPDKKRKYEAHFELVHYAGVVPYNIIGWLDKNKDPLNETVVICFQKSSNKLLASLYEKYVSSDSASDPKTGGKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNETKTPGIMDSFMVLHQLRCNGVLEGIRICRKGFPNRMLYAEFKQRYRILNPHAIPDDKFVDSRKAAEKLLASLDIDHNQYRFGHTKVFFKAGLLGQLEEMRDERLAKILTLLQAASRGKIMRMELNKMTQRKEALMIIQWNIRAFNIVKNWPWMKLFFKIKPLLRSAATEKELAALKEEFLKLKEALEKSEAKRKELEEKQVSLIQEKNDLSLQLQAEQDNLADAEDRCDLLIKTKIQLEAKVKEMTERLEDEEEMNATVLAKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDETILKLTKEKKALQESHQQTLDDLQTEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERSKRKLEGDLKLSMESVMDLENDKQQLEEKLKKKDFEMNQISSKIEDDQVLIIQLQKKIKELQARIEELEEEMEAERSTRAKMEKHRSDSSKELEELSERLEEAGGATSAQIEMNKKREADFLKLRRDLEEAILHHEAMTAALRKKHADSVVELSEQIDSLQRVKQKLEKERSEAKMEADDLTSNLEQLAKGKATAEKTCRLYEDQMNESKAKVEELQRQLSDTNTQRARAQAESAELGRKLEEREALVSQLQRSKNTFSQNIEELKKQLEEESKSKNALTHALQSSRHDCDLLREQYDEEQEGKSELQRALSKANAEVAQWRTKYETDAIQKTEELEEAKKKLATRLQESEEQVEASNAKCSSLEKTKHRLQSEIEDLVLDLERSNAAATALDKKQRQFDKILAEWRHKYEECQSELESSQKESRNLSTELFKLKNSYEEALDHLESIKRESKNLQEEISDLNDQISQGGKTIHELEKIKKGLDLEKTEIQAALEEAEGTLEHEESKTLRIQLELNQIKADTDRKLAEKDEEIDNLRRNHQRALESMQATLDAEAKSRSEAIRVKKKMENDLNEMEVQLNHANWLATESQKMVRNLQTQIKDLQMELDETVHQNEELKEQSAVTERRNNLLTAEVEELRCQLEQNDRARKLAEFELLETTERVNLLHSQNTSMLNQKKKLENDLATLSSEVDDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQLRLDEAEQIALKGGKKQIQKLESKVRDLESELESEQKKSNELQKGIRKYERRIKELTYQTEEDRKNIARLQELIDKLQAKVKTYKRQAEDAEEQANSNLTKYKKIQHELDDAEERADIAESQVNKLRTRS 1932          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 1743.78 bits (4515), Expect = 0.000e+0
Identity = 1023/1913 (53.48%), Postives = 1390/1913 (72.66%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA-------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+    +FD KK  ++PD  E ++  TV    GDKVTV+T  G+T  VK+  + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHI+SISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA+  K D D +K    LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LLVT++P  ++FI+QGE T+  +DD +E+  TD AF ILGF+ EEK S++K T +IM+ G MKFKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNE+VTKGQ+  QV Y++GAL+K++Y +MF W+V R+N++L+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+++LFA          D GK   KKKG SF TVS +HRE+LNKLM NL ST PHF+RC++PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ K+  +K+L ++ +D   YR G+TKVFFKAG L QLE++RDE+LS +I+  QA+ RG L R +Y K+ ++R AL +IQ N+R ++ ++ W W KLF K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ VTLLQ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L++EE+KV+ L KAK KLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  NSKI+DE +++  LQ+K+KELQAR++ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSELR +++D++S +E + K+K N+EK N+ LE  +++ +NK +E  R L +      + Q EN E  + LE+ ES ++QL + K     QLE+ K+ L++E +AK  L   L++A  D D LRE  EEEQE K+++QR + K   E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ++ DK+I EW++KY ESQ ELE S +E+R++S E+FKLK+  E S D +E+++RENK L +EI DLTEQLGEGG+ +HE+EK RK++E E+ E+Q ALEEAE +LE EE K  R QLE +Q + + ER+L+EK+EE E  ++N QRT++++Q++LE+E R R EA+++KKK+E D+NE+E+ L  ANR  +E +K  K  Q  L + Q Q+++     + + E  A+ ER+  ++  ELEE++ + +  E+ RK+AE E  +  +++     QN+S +  K+K+E DL+  Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQKR  E+ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKR  EE+EE A V+L K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTKAFDLKKECFVPDAIEEFVKATVVSREGDKVTVETQGGKTVTVKEADVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRTEAPPHIYSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAASGGKKDQDKNKGT--LEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTSNPYDYAFISQGETTVPSIDDSDELMATDSAFDILGFTQEEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVNYAIGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRLVKGKPEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADSATGDGGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSKKGAEKLLGSLDIDHQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQAKSRGLLSRAEYIKMVERRDALLVIQWNVRAFMAVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEEKLKKKDFEISQLNSKIDDEQSIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: myh7l (myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GENE-061027-393])

HSP 1 Score: 1743.78 bits (4515), Expect = 0.000e+0
Identity = 1023/1913 (53.48%), Postives = 1390/1913 (72.66%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA-------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+    +FD KK  ++PD  E ++  TV    GDKVTV+T  G+T  VK+  + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHI+SISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA+  K D D +K    LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LLVT++P  ++FI+QGE T+  +DD +E+  TD AF ILGF+ EEK S++K T +IM+ G MKFKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNE+VTKGQ+  QV Y++GAL+K++Y +MF W+V R+N++L+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+++LFA          D GK   KKKG SF TVS +HRE+LNKLM NL ST PHF+RC++PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ K+  +K+L ++ +D   YR G+TKVFFKAG L QLE++RDE+LS +I+  QA+ RG L R +Y K+ ++R AL +IQ N+R ++ ++ W W KLF K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ VTLLQ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L++EE+KV+ L KAK KLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  NSKI+DE +++  LQ+K+KELQAR++ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSELR +++D++S +E + K+K N+EK N+ LE  +++ +NK +E  R L +      + Q EN E  + LE+ ES ++QL + K     QLE+ K+ L++E +AK  L   L++A  D D LRE  EEEQE K+++QR + K   E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ++ DK+I EW++KY ESQ ELE S +E+R++S E+FKLK+  E S D +E+++RENK L +EI DLTEQLGEGG+ +HE+EK RK++E E+ E+Q ALEEAE +LE EE K  R QLE +Q + + ER+L+EK+EE E  ++N QRT++++Q++LE+E R R EA+++KKK+E D+NE+E+ L  ANR  +E +K  K  Q  L + Q Q+++     + + E  A+ ER+  ++  ELEE++ + +  E+ RK+AE E  +  +++     QN+S +  K+K+E DL+  Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQKR  E+ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKR  EE+EE A V+L K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTKAFDLKKECFVPDAIEEFVKATVVSREGDKVTVETQGGKTVTVKEADVLQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRTEAPPHIYSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAASGGKKDQDKNKGT--LEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTSNPYDYAFISQGETTVPSIDDSDELMATDSAFDILGFTQEEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVNYAIGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRLVKGKPEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADSATGDGGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSKKGAEKLLGSLDIDHQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQAKSRGLLSRAEYIKMVERRDALLVIQWNVRAFMAVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKAKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEEKLKKKDFEISQLNSKIDDEQSIIIQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVAELGEQIDNLQRVKQKLEKEKSELRLELDDVASSMEHIVKSKTNMEKVNRTLEDQMNEYRNKCEEYQRSLNDFTTQKAKLQAENDEFSRQLEEKESLVSQLTRGKNSFSQQLEDLKRQLDEEIKAKNALAHALQSARHDTDLLREQYEEEQEAKAELQRSMSKANTEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNTAAASLDKKQRHFDKIISEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESMDHLETMKRENKILQEEISDLTEQLGEGGKTIHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRTQLEFNQIKADIERKLSEKDEEMEQVKRNQQRTIDTLQSALESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSVQAHLKDSQLQLDDSLRSNDDLKENTAIVERRNALLQAELEELRAVLEQTERGRKLAEQELLDVTERVQLLHSQNTSLINQKKKLETDLSQFQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELECEVEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEESEEQANVHLGKFRKLQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Match: smyhc2 (slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GENE-070822-12])

HSP 1 Score: 1735.7 bits (4494), Expect = 0.000e+0
Identity = 1023/1921 (53.25%), Postives = 1399/1921 (72.83%), Query Frame = 1
Query:   49 PSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF---APAEDX-----XXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            P+ P   +L    K  L+     FD KK  ++PD +  Y+  +V   +GDKVTV+T+ G+T  VK+      NPPKF  IEDMA  TFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHIFSISDNAY  ML DRENQSVLITGESGAGKT NTK+VI YFA++AAA     D   +KKG+LEDQI+Q NP LEA+GNAKT RN+NSSRFGKFIRIHFG SGK++ ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LL+T +P  +S+I+QGE  +  +DD +E+  TDEAF +LGF+ EEK S++K T +IM+ G MKFKQ+ REEQAEADGT +A+KV++L+G+N+ DL++ +  P+VKVGNE+VTKGQ+  QV YS+GALAKS+Y +MF W+V R+N++LDTK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACIELIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGK+PNF +      G+ EAHF L HYAG+V YNI+ WL KNKDPLNE+VVGL   S   L+ +LF   A AE       GK G KKKG SF TVS +HRE+LNKLM NL ST PHF+RC++PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ K+  +K+L ++ +D N Y+LG+TKVFFKAG L  LE++RD++L+ +I+  QA+ RG L R +++K+ ++R +L +IQ N+R ++ ++ W W KL+ K+KP+L  A  E+EM    EE  KLKE + K+E  KKELEE+ V+LLQ KNDL L +Q+EQD+LADAEE+   L+  K   E ++KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L++EE+KV+ L KAKAKLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE L DLE  K ++EE+LK+K+ E++  NSKIEDE  L A LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA +QHE     +RKK  D+ ++  +Q+D LQ+ K K+E+EKSELR +++D+ S +E + K K NLEK  + LE  +S+ + K +E  R + +      + Q EN E+ + LE+ +S ++QL + KQ    Q+E+ K+ LE+E +AK  L   +++A  D + LRE  EEEQE K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE + +ESR++S E+FKLK+  E S D +ES++RENKNL +EI DLTEQLGE G+N+HE+EK RK++E E+ E+Q ALEEAE +LE EE K  RAQLE +Q + + ER+L+EK+EE E  ++N QR ++++Q+SLE+E R R EA+++KKK+E D+NE+E+ L  ANR  SE +K  K     L + Q Q+++     + + E +A+ ER+  ++  EL+E++++ +  E+ RK+AE E  +  +++     QN+S +  K+K+E D   +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQ++  ++ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   11 PAAP---FLRKSDKERLEAQTRPFDMKKECFVPDPEVEYVKASVTSRDGDKVTVETEFGKTVTVKEVDCHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAPGGKKDPSQEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFGVSGKLSSADIETYLLEKSRVTYQLKAERDYHIFYQILSQRKPELLEMLLITNNPYDYSYISQGETQVASIDDRDELIATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKVAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYSIGALAKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKNPNF-QKPRIVKGRPEAHFALVHYAGTVDYNISNWLVKNKDPLNETVVGLFQKSTLKLLGTLFANYAGAESADSGGKGKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCLIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDNKKGAEKLLGSLDIDHNQYKLGHTKVFFKAGLLGTLEEMRDDRLALIITGIQARARGILSRIEFQKIVERRDSLLVIQWNVRAFMGVKNWPWMKLYFKIKPLLKTAETEKEMANMKEEFTKLKEAYAKSEARKKELEEKMVSLLQEKNDLQLAVQSEQDNLADAEERCEGLIKSKIQFEAKVKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLTQENLMDLENDKQQMEERLKKKDFEISQLNSKIEDEQALEAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATASTLRKKHADSVSDLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKAKANLEKMCRTLEDQMSEYRTKAEEGQRTINDFTMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDAELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQTELESAQKESRSLSTELFKLKNSYEESLDHLESMKRENKNLQEEISDLTEQLGESGKNIHELEKVRKQLEQEKQEIQTALEEAEGSLEHEEGKILRAQLEFNQVKADIERKLSEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRLKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHLKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELMDVSERVQLLHSQNTSLLNQKKKLEGDNTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLESRVRELESEVEMEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRTAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKS 1927          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1802.33 bits (4667), Expect = 0.000e+0
Identity = 1033/1917 (53.89%), Postives = 1404/1917 (73.24%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXX---XXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP--------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    + L+K    +FD KK  WIPD+KE YI + +++++G KV V+T   +T  VK+D ++QMNPPKF MIEDMA LT LN+ASV  NL++RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++M+ +RENQS+LITGESGAGKT NTK+VI YFA VAA  +   K     +K  G+LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ+LS       D LLV+ +P  + F +QG  T+D +DD EE+  TD A  ILGFS EEK   +K   ++M+ G MKFKQ+ REEQAE DGT  A+K ++L+G+++ DL++ +L P+VK+GNEYVTKGQ+ +QV+Y++GALAK+ Y+RMF WLV+R+N+TLDTK+ RQFFIGVLDIAGFEIF++N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASD T KAKLYDNHLGKSPNF KPK  K  ++E HFEL HYAG VPYNI GWL+KNKDPLNE+VV +   S   L+ASL+           +  G    +KK  SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PGV+D  +V+HQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T+K+L ++ +D   Y+ G+TKVFFKAG L QLE++RDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W+W KLF K+KP+L  A+ E+EM    EE  KLKE  EK+E  +KELEE+ VTL Q KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE   S L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +A++ KEKKA  E  ++  + L+AEE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DL+  K +LEE+LK+K+ E++  NS+IEDE  + A LQ+KIKELQARI+ELEE+LEAER  RAK EK + ++  ELEE+SERLEE GGAT  Q ++NKKREAE +KL+RDLEEA + HE     +RKK  DT  E  +Q+D LQ+ K K+E+EKSE++ +I+D +S +E L K KGN EK  +  E  +S+ ++K+DEL RQL +      R Q EN E+ + LE+ ES +NQL + K      +EE K+ LE+E++AK  L   L+ +  D D +RE  EEEQE K ++QR L K   E+ Q +   +     RTEE+EE ++K+ AR+Q+ EE  E   +KCS LEK K RLQ EIEDLVID+ERAN  A+ L+KKQ+N D+++GEW++KY E+Q ELE S +ESR++S E+FKLK+  E S D +E+++RENKNL +EI DLT+Q+   G+ +HE+EK +K +E E+ ++Q ALEEAE ALE EE+K+ R QLE+SQ + + +R++AEK+EE E  R+NHQR +ESMQASL+AE + R EA+++KKK+E D+NE+E+ L+ ANR  +E +K  +  Q  + ++Q ++++     + + EQ A  ER+  ++  E+EE++   + AE+ RK+AE E  EA +++N    QN+  +  K+K++AD++ +  ++EES    R A E+ KKAI D   + +E+K+EQ+     E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++RELEGEL+ EQK++ ETQK  RK +RR+KE++YQ +ED+KN  RMQ LI+ LQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLRA+ 
Sbjct:   16 YLRKSAQELMKVQTIAFDGKKKAWIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSAPATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSGKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLASLYEKYISSYSDEHQKPGVKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAKKKLAARLQDAEEAVEVANAKCSSLEKTKHRLQTEIEDLVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRART 1932          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1799.64 bits (4660), Expect = 0.000e+0
Identity = 1028/1899 (54.13%), Postives = 1396/1899 (73.51%), Query Frame = 1
Query:  124 SKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXX---XXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP--------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            SKK  WIPD+KE YI + +++++G KV V+T   +T  VK+D ++QMNPPKF MIEDMA LT LN+ASV  NL++RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++M+ +RENQS+LITGESGAGKT NTK+VI YFA VAA  +   K     +K  G+LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ+LS       D LLV+ +P  + F +QG  T+D +DD EE+  TD A  ILGFS EEK   +K   ++M+ G MKFKQ+ REEQAE DGT  A+K ++L+G+++ DL++ +L P+VK+GNEYVTKGQ+ +QV+Y++GALAK+ Y+RMF WLV+R+N+TLDTK+ RQFFIGVLDIAGFEIF++N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASD T KAKLYDNHLGKSPNF KPK  K  ++E HFEL HYAG VPYNI GWL+KNKDPLNE+VV +   S   L+ASL+           +  G    +KK  SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PGV+D  +V+HQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T+K+L ++ +D   Y+ G+TKVFFKAG L QLE++RDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W+W KLF K+KP+L  A+ E+EM    EE  KLKE  EK+E  +KELEE+ VTL Q KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE   S L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +A++ KEKKA  E  ++  + L+AEE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DL+  K +LEE+LK+K+ E++  NS+IEDE  + A LQ+KIKELQARI+ELEE+LEAER  RAK EK + ++  ELEE+SERLEE GGAT  Q ++NKKREAE +KL+RDLEEA + HE     +RKK  DT  E  +Q+D LQ+ K K+E+EKSE++ +I+D +S +E L K KGN EK  +  E  +S+ ++K+DEL RQL +      R Q EN E+ + LE+ ES +NQL + K      +EE K+ LE+E++AK  L   L+ +  D D +RE  EEEQE K ++QR L K   E+ Q +   +     RTEE+EE ++K+ AR+Q+ EE  E   +KCS LEK K RLQ EIEDLVID+ERAN  A+ L+KKQ+N D+++GEW++KY E+Q ELE S +ESR++S E+FKLK+  E S D +E+++RENKNL +EI DLT+Q+   G+ +HE+EK +K +E E+ ++Q ALEEAE ALE EE+K+ R QLE+SQ + + +R++AEK+EE E  R+NHQR +ESMQASL+AE + R EA+++KKK+E D+NE+E+ L+ ANR  +E +K  +  Q  + ++Q ++++     + + EQ A  ER+  ++  E+EE++   + AE+ RK+AE E  EA +++N    QN+  +  K+K++AD++ +  ++EES    R A E+ KKAI D   + +E+K+EQ+     E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++RELEGEL+ EQK++ ETQK  RK +RR+KE++YQ +ED+KN  RMQ LI+ LQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLRA+ 
Sbjct:   28 SKKKAWIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSAPATKTGGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSGKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLASLYEKYISSYSDEHQKPGVKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAKKKLAARLQDAEEAVEVANAKCSSLEKTKHRLQTEIEDLVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRART 1926          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1778.84 bits (4606), Expect = 0.000e+0
Identity = 1011/1883 (53.69%), Postives = 1377/1883 (73.13%), Query Frame = 1
Query:  139 WIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            WIPD+KE YI + +++++G KV V+T   +T  VK+D ++QMNPPKF MIEDMA LT LN+ASV  NL++RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++M+ +RENQS+LITGESGAGKT NTK+VI YFA VAA  +            LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ+LS       D LLV+ +P  + F +QG  T+D +DD EE+  TD A  ILGFS EEK   +K   ++M+ G MKFKQ+ REEQAE DGT  A+K ++L+G+++ DL++ +L P+VK+GNEYVTKGQ+ +QV+Y++GALAK+ Y+RMF WLV+R+N+TLDTK+ RQFFIGVLDIAGFEIF++N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASD T KAKLYDNHLGKSPNF KPK  K  ++E HFEL HYAG VPYNI GWL+KNKDPLNE+VV +   S   L+                     F+ + ++ +E+LNKLM NL ST PHF+RCI+PNE K PGV+D  +V+HQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T+K+L ++ +D   Y+ G+TKVFFKAG L QLE++RDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W+W KLF K+KP+L  A+ E+EM    EE  KLKE  EK+E  +KELEE+ VTL Q KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE   S L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +A++ KEKKA  E  ++  + L+AEE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DL+  K +LEE+LK+K+ E++  NS+IEDE  + A LQ+KIKELQARI+ELEE+LEAER  RAK EK + ++  ELEE+SERLEE GGAT  Q ++NKKREAE +KL+RDLEEA + HE     +RKK  DT  E  +Q+D LQ+ K K+E+EKSE++ +I+D +S +E L K KGN EK  +  E  +S+ ++K+DEL RQL +      R Q EN E+ + LE+ ES +NQL + K      +EE K+ LE+E++AK  L   L+ +  D D +RE  EEEQE K ++QR L K   E+ Q +   +     RTEE+EE ++K+ AR+Q+ EE  E   +KCS LEK K RLQ EIEDLVID+ERAN  A+ L+KKQ+N D+++GEW++KY E+Q ELE S +ESR++S E+FKLK+  E S D +E+++RENKNL +EI DLT+Q+   G+ +HE+EK +K +E E+ ++Q ALEEAE ALE EE+K+ R QLE+SQ + + +R++AEK+EE E  R+NHQR +ESMQASL+AE + R EA+++KKK+E D+NE+E+ L+ ANR  +E +K  +  Q  + ++Q ++++     + + EQ A  ER+  ++  E+EE++   + AE+ RK+AE E  EA +++N    QN+  +  K+K++AD++ +  ++EES    R A E+ KKAI D   + +E+K+EQ+     E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++RELEGEL+ EQK++ ETQK  RK +RR+KE++YQ +ED+KN  RMQ LI+ LQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLRA+ 
Sbjct:   16 WIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSGT----LEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSGKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLGCAM-----------------FLKLVFIVQENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAKKKLAARLQDAEEAVEVANAKCSSLEKTKHRLQTEIEDLVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRART 1877          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: pde1b (phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-987197])

HSP 1 Score: 1768.44 bits (4579), Expect = 0.000e+0
Identity = 1011/1914 (52.82%), Postives = 1380/1914 (72.10%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP--------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    + L+K    +FD KK  WIPD+KE YI + +++++G KV V+T   +T  VK+D ++QMNPPKF MIEDMA LT LN+ASV  NL++RY   +IYTYSGLFC+ VNPY+  P+YT+ V+  YKGKRR E PPHI+SI+DNAY++M+ +RENQS+LITGESGAGKT NTK+VI YFA VAA  +       +  G+LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ+LS       D LLV+ +P  + F +QG  T+D +DD EE+  TD A  ILGFS EEK   +K   ++M+ G MKFKQ+ REEQAE DGT  A+K ++L+G+++ DL++ +L P+VK+GNEYVTKGQ+ +QV+Y++GALAK+ Y+RMF WLV+R+N+TLDTK+ RQFFIGVLDIAGFEIF++N FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DLQ CI+LIEKP+GILSILEEECMFPKASD T KAKLYDNHLGKSPNF KPK  K  ++E HFEL HYAG VPYNI GWL+KNKDPLNE+VV +   S   L+ASL+           +  G    +KK  SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PGV+D  +V+HQL CNGVLEGIRICRKG+PNR++Y++FKQRY IL PNAIP   FV+ ++ T+K+L ++ +D   Y+ G+TKVFFKAG L QLE++RDE+L+ +I++ QA+ RG LMR +Y K+  ++ AL +IQ NIR +  ++ W+W KLF K+KP+L  A+ E+EM    EE  KLKE  EK+E  +KELEE+ VTL Q KNDL LQLQ EQD+LADAEE+   L+  K  +E ++KEL + L +EE   S L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +A++ KEKKA  E  ++  + L+AEE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DL+  K +LEE+LK+K+ E++  NS+IEDE  + A LQ+KIKELQARI+ELEE+LEAER  RAK EK + ++  ELEE+SERLEE GGAT  Q ++NKKREAE +KL+RDLEEA + HE     +RKK  DT  E  +Q+D LQ+ K K+E+EKSE++ +I+D +S +E L K KGN EK  +  E  +S+ ++K+DEL RQL +      R Q EN E+ + LE+ ES +NQL + K      +EE K+ LE+E++AK  L   L+ +  D D +RE  EEEQE K ++QR L K   E+ Q +   +     RTEE+EE +                       +  +  +L      LVID+ERAN  A+ L+KKQ+N D+++GEW++KY E+Q ELE S +ESR++S E+FKLK+  E S D +E+++RENKNL +EI DLT+Q+   G+ +HE+EK +K +E E+ ++Q ALEEAE ALE EE+K+ R QLE+SQ + + +R++AEK+EE E  R+NHQR +ESMQASL+AE + R EA+++KKK+E D+NE+E+ L+ ANR  +E +K  +  Q  + ++Q ++++     + + EQ A  ER+  ++  E+EE++   + AE+ RK+AE E  EA +++N    QN+  +  K+K++AD++ +  ++EES    R A E+ KKAI D   + +E+K+EQ+     E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE ++RELEGEL+ EQK++ ETQK  RK +RR+KE++YQ +ED+KN  RMQ LI+ LQ K+K+YKRQ EEAE  A  NL KYRKIQ E++D+EERAD AE  + KLRA+ 
Sbjct:   16 YLRKSAQELMKVQTIAFDGKKKAWIPDDKEAYIEVEIKDSSGGKVNVETKDKKTLTVKEDDIQQMNPPKFDMIEDMAMLTHLNEASVLSNLKRRYANWMIYTYSGLFCVTVNPYKWLPVYTATVVAAYKGKRRSEAPPHIYSIADNAYNDMVRNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEGLGKKSVRTNGTLEDQIIEANPAMEAFGNAKTLRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSGKKPELQDMLLVSTNPYDYHFCSQGVTTVDNLDDGEELMATDHAMDILGFSQEEKTGSYKIVGAVMHFGNMKFKQKQREEQAETDGTESADKAAYLMGISSADLIKGLLHPRVKIGNEYVTKGQNVEQVVYAVGALAKATYDRMFKWLVSRINRTLDTKLARQFFIGVLDIAGFEIFEYNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGLDLQPCIDLIEKPLGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFQKPKLDKKRRYEPHFELMHYAGVVPYNIVGWLDKNKDPLNETVVTVFQKSSNKLLASLYEKYISSYSDEHQKPGVKEKRKKAASFQTVSQLHKENLNKLMTNLRSTQPHFVRCIIPNESKTPGVMDPFMVLHQLRCNGVLEGIRICRKGYPNRLLYADFKQRYRILNPNAIPDDKFVDSRKATEKLLGSLDIDHTQYKFGHTKVFFKAGLLGQLEEMRDERLAKIITMLQARSRGRLMRIEYHKIIARKDALMVIQWNIRAFNAVKNWSWMKLFFKIKPLLKSAQTEKEMANMKEEFLKLKEALEKSEAKRKELEERQVTLTQEKNDLGLQLQAEQDNLADAEERCDLLIKTKIQLEAKVKELTERLEDEEEMNSDLTSKKRKLEDECAELKKDIDDLEITLAKVEKEKHATENKVKNLIEEMAALDEIIARLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQESVMDLDNDKQQLEEKLKKKDFEISQLNSRIEDEQVMCAQLQKKIKELQARIEELEEELEAERATRAKVEKQRAEVAKELEELSERLEEAGGATSVQIEMNKKREAEFLKLRRDLEEATLHHEATAAGLRKKHADTVAELGEQIDSLQRVKQKLEKEKSEMKMEIDDFTSNIEQLTKNKGNAEKLCRTYEDQLSEAKSKVDELQRQLADISLHRARLQTENGELSRLLEEKESLVNQLSRGKASFTQTIEELKRQLEEETKAKNALAHALQASRHDCDLMREQYEEEQEAKGELQRSLSKANAEVAQWRNKYETDAIQRTEELEEAK-----------------------MLPLDKKLAAH---LVIDLERANSAAAALDKKQRNFDRILGEWKQKYEETQAELEASQKESRSLSTELFKLKNAYEESLDNLETMKRENKNLQEEIADLTDQISASGKMIHELEKVKKALESEKSDIQAALEEAEGALEHEESKTLRIQLELSQIKADVDRKVAEKDEEIENLRRNHQRAMESMQASLDAEAKARNEAIRLKKKMEGDLNEMEIQLNHANRQAAESQKMVRNLQSHIKDLQIELDDTLRHNDDLKEQAAALERRNNLLLAEVEELRAALEQAERGRKLAEQELLEATERVNLLHSQNTGLINQKKKLDADISQLTTEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTTAHLERMKKNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLEAKVRELEGELEIEQKKNAETQKGVRKYERRIKELTYQTEEDRKNLARMQDLIDKLQMKVKSYKRQSEEAETQANSNLVKYRKIQHELDDAEERADVAEGQVNKLRART 1903          
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Match: ENSXETT00000000925.1 (myosin heavy chain 15 [Source:NCBI gene;Acc:100487082])

HSP 1 Score: 1767.67 bits (4577), Expect = 0.000e+0
Identity = 1037/1920 (54.01%), Postives = 1401/1920 (72.97%), Query Frame = 1
Query:   40 LMDPSD--PDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-----APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLR 5775
            +MD SD      +L    K L+ Q   +FD KK  WIPD+KE Y+   ++ET G KVTV+   G+T VVK+  ++QMNPPKF M+EDMA LT LN+ASV  NLR+RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  YKGKRR E PPHIFSI+DNAY +ML +RENQS+LITGESGAGKT NTK+VI YFA VAA               LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK++ ADIE YLLEKSRVI QQ GER+YHIFYQ+LS       D LLV+ +P  F F +QG +T+D +DD EE+  TD+AF ILGF  +EK   +K T +IM+ G MKFKQ+ REEQAEADGT   +K ++L+G+++ DL++ +L P+VKVGNEYVTKGQ+  QV+Y++GALAK +Y+RMF WLV R+NKTLDTK+ RQFFIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDWEFIDFG+DLQACI+LIEKP+GI+SILEEECMFPKA+D T K+KLYDNHLGKSPNF KP+  K  ++EAHFEL HYAG VPYNI GWLEKNKDPLNE+VVGL   S   L+  LF     + + D G    +KKG SF TVS +H+E+LNKLM NL STSPHF+RCI+PNE K PG +D  LV+HQL CNGVLEGIRICRKGFPNR++Y++FKQRY IL P+AIP+  FV+ ++ ++K+L  +++D   YR G+TKVFFKAG L  LE++RDE+LS +++L QA+ RG LMR +++K+ ++R AL +IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM    EE  KLKE  EK+E  +KELEE+ VTL+Q KNDL LQLQ EQD  ADAEE+   L+  K  ME +IK+L + + +EE   S L   K+KL  +  ELKKD++DLE +L KAE+EK A + ++K+L + +   ++ + K+ KEKKA  E  ++T + L+AEE+KV++L K K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE L D E  K ++EE+LK+KE E++  +SKIEDE  +V  LQ+KIKELQARI+ELEE+LEAER ARAK EK +  L  ELEE+SERLEE GGA+ AQ ++NKKRE E +K++RDLEEA + HE     +RKK  DT  E  +Q+D LQ+ K K+E+EKSEL+ + +DLSS +E L K KG  EK  +  E  +++ + KLDE++RQ+ E      R Q EN E  + LE+ ES I+QL + K     Q+E+ ++ LE+E++AK  L   L++A  D D LRE  +EEQE K+++QR L K   E+   +   +     RTEE+EE ++K+ AR+QE EE  E+  +KC+ LEK K RLQ E+ED++ID+ER+N  A+ ++KKQ+N DKLI +W++KY E+Q ELE S +++R +S E+FKLK+  E   D +E+++RENKNL +EI DLT+Q+ EG +++HEIEK +K++E E+ E+Q ALEEAE ALE EE+K+ R QLE+SQ + E ER+L+EK+EE E  R+N QR +ES+Q++LE+E + R EA+++KKK+E D+NE+E+ L  + R  +E  K  +  Q Q  ++Q Q ++  H  E + EQ A+ ER+  ++  EL+E++   D  E+ RK++E E  E+ +++N    QN+S +  K+K+E D++ MQ ++EES    R A ++ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE EL+ EQ+R+ E+ K  RK +RR+KE++YQ +EDKKN  RMQ LI+ LQ K+K+YK Q EEA E +   L+KY+K+Q E++D++ERAD AE  + KLR
Sbjct:    7 MMDMSDFGEAASFLRKSEKELMIQQTVAFDGKKKCWIPDDKEAYLEAEIKETGGGKVTVEVGDGKTVVVKEGDVQQMNPPKFDMMEDMAMLTHLNEASVLFNLRKRYANWMIYTYSGLFCVTVNPYKWLPVYKTEVVAAYKGKRRSEAPPHIFSIADNAYHDMLRNRENQSMLITGESGAGKTVNTKRVIQYFATVAAIGDPMSKKNGT----LEDQIIQANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLSSADIEIYLLEKSRVIFQQPGERSYHIFYQILSGKMSELQDMLLVSTNPYDFHFSSQGVVTVDNLDDSEELIATDQAFDILGFIPDEKYGSYKLTGAIMHFGNMKFKQKQREEQAEADGTENTDKAAYLMGISSSDLVKGLLHPRVKVGNEYVTKGQTVAQVVYAVGALAKGIYDRMFKWLVVRINKTLDTKLPRQFFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWEFIDFGLDLQACIDLIEKPLGIMSILEEECMFPKATDMTFKSKLYDNHLGKSPNFQKPRLDKKRKYEAHFELMHYAGVVPYNIMGWLEKNKDPLNETVVGLFQKSSNKLLGCLFENYVSSDSADQGGEKKRKKGASFQTVSSLHKENLNKLMTNLRSTSPHFVRCIIPNETKTPGAMDPFLVLHQLRCNGVLEGIRICRKGFPNRVLYADFKQRYRILNPSAIPEDKFVDSRKASEKLLGTLEIDHTQYRFGHTKVFFKAGLLGNLEEMRDERLSKILTLIQARARGKLMRIEFQKILERRDALLVIQWNIRAFMTVKNWPWMKLFFKIKPLLKSAETEKEMANMKEEFLKLKEALEKSEARRKELEEKQVTLVQEKNDLTLQLQAEQDMFADAEERCDLLIKSKIQMESKIKDLTERIEDEEEMNSELTSKKRKLEDECSELKKDIDDLEITLAKAEKEKHATENKVKNLTEEMASLDDTINKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKIKTKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESLMDAENDKQQMEEKLKKKEFEISQMSSKIEDEQAIVMQLQKKIKELQARIEELEEELEAERAARAKVEKQRSDLARELEELSERLEEAGGASAAQIEMNKKRETEYLKMRRDLEEATLHHEATAASLRKKHADTVAELGEQIDNLQRVKQKLEKEKSELKLEADDLSSSMEQLVKAKGISEKLCRTYEDQLNETKAKLDEMTRQVNELTTQKGRLQTENGEFGRLLEEKESLISQLSRGKSSFTQQIEDLRKQLEEETKAKNALAHALQSARHDCDLLREQFDEEQEAKAELQRSLSKGNAEVATWRNKYETDAIQRTEELEEAKKKLAARLQEAEEAVEAANAKCASLEKTKHRLQNELEDMMIDLERSNAAAAAMDKKQRNFDKLIADWKQKYEETQAELETSQKDARGLSTELFKLKNAYEEVLDNLETVKRENKNLQEEISDLTDQISEGNKSLHEIEKVKKQVEQEKSEVQVALEEAEGALEHEESKTLRFQLELSQIKAEFERKLSEKDEETENIRRNLQRIIESLQSNLESEAKSRNEAVRLKKKMEGDLNEMEIQLSHSIRQATEATKAMRNLQAQYKDLQVQYDDYIHLSEDLKEQAAVIERRNTLLQSELDELRAALDQTERARKLSEQELLESTERVNLLHSQNTSLINQKKKLETDISHMQNEVEESIQECRNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQKRLDEAEQIAMKGGKKQIQKLESRVRELENELESEQRRNSESLKGFRKFERRIKELTYQGEEDKKNLIRMQDLIDKLQLKVKSYKHQAEEASEQSNQYLSKYKKLQHELDDAQERADIAESQVNKLR 1922          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh6 (myosin, heavy polypeptide 6, cardiac muscle, alpha [Source:MGI Symbol;Acc:MGI:97255])

HSP 1 Score: 1758.42 bits (4553), Expect = 0.000e+0
Identity = 1030/1913 (53.84%), Postives = 1394/1913 (72.87%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+     FD +   ++PD+KE Y+   V    G KVT +T+ G+T  +K+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA   +   +       +LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ERNYHIFYQ+LS       D LLVT +P  ++F++QGE+++  +DD EE+  TD AF +L F+ EEK  ++K T +IM+ G MKFKQ+ REEQAE DGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQS  QV YS+GALAKS+Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWLEKNKDPLNE+VVGL   S   L+A+LF+        +     G KKKG SF TVS +HRE+LNKLM NL +T PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++K+  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+AEE+KV+ L K+K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+KE +++  NSKIEDE  L   LQ+K+KE QARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK ++ LE   ++ + KL+E  R L +      + Q EN E+ + LE+ E+ I+QL + K     Q+E+ K+ LE+E +AK  L   L+++  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLGEGG+NVHE+EK RK++E+E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ SE +K+ K  Q  L + Q Q+++  H  + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KME+DL  +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1926          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh6 (myosin, heavy polypeptide 6, cardiac muscle, alpha [Source:MGI Symbol;Acc:MGI:97255])

HSP 1 Score: 1758.42 bits (4553), Expect = 0.000e+0
Identity = 1030/1913 (53.84%), Postives = 1394/1913 (72.87%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+     FD +   ++PD+KE Y+   V    G KVT +T+ G+T  +K+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA   +   +       +LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ERNYHIFYQ+LS       D LLVT +P  ++F++QGE+++  +DD EE+  TD AF +L F+ EEK  ++K T +IM+ G MKFKQ+ REEQAE DGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQS  QV YS+GALAKS+Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWLEKNKDPLNE+VVGL   S   L+A+LF+        +     G KKKG SF TVS +HRE+LNKLM NL +T PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++K+  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+AEE+KV+ L K+K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+KE +++  NSKIEDE  L   LQ+K+KE QARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK ++ LE   ++ + KL+E  R L +      + Q EN E+ + LE+ E+ I+QL + K     Q+E+ K+ LE+E +AK  L   L+++  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLGEGG+NVHE+EK RK++E+E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ SE +K+ K  Q  L + Q Q+++  H  + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KME+DL  +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   15 YLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKVVSREGGKVTAETENGKTVTIKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKENPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLSFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNIMGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLNDAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALISQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNSQAHLKDTQLQLDDAVHANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMESDLTQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLMRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1926          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1752.64 bits (4538), Expect = 0.000e+0
Identity = 1021/1897 (53.82%), Postives = 1393/1897 (73.43%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KK++++PD+KE ++   +    G KVT +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA   +   D +  KG+LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ER+YHIFYQ+LS       D LL+T +P  ++FI+QGE T+  +DD EE+  TD AF +LGF+ EEK S++K T +IM+ G MKFKQ+ REEQAE DGT EA+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV Y++GALAKS+Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWL+KNKDPLNE+VVGL   S   L+++LF       APA+     G  KKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG L R ++KKL ++R +L +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++K+  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELK+D++DLE +L K E+EK A + ++K+L + +   +E + K+ KEKKA  E  ++  + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +L+E+LK+K+ ELN  N++IEDE  L + LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK  + LE  +++ ++K +E  R + +  +   + Q EN E+ + L++ E+ I+QL + K     QLE+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLG  G+++HE+EK RK++E E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ +E +K  K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KM+ADL+ +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPAD--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh7 (myosin, heavy polypeptide 7, cardiac muscle, beta [Source:MGI Symbol;Acc:MGI:2155600])

HSP 1 Score: 1752.64 bits (4538), Expect = 0.000e+0
Identity = 1021/1897 (53.82%), Postives = 1393/1897 (73.43%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KK++++PD+KE ++   +    G KVT +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA   +   D +  KG+LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ER+YHIFYQ+LS       D LL+T +P  ++FI+QGE T+  +DD EE+  TD AF +LGF+ EEK S++K T +IM+ G MKFKQ+ REEQAE DGT EA+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV Y++GALAKS+Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWL+KNKDPLNE+VVGL   S   L+++LF       APA+     G  KKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG L R ++KKL ++R +L +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++K+  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELK+D++DLE +L K E+EK A + ++K+L + +   +E + K+ KEKKA  E  ++  + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +L+E+LK+K+ ELN  N++IEDE  L + LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK  + LE  +++ ++K +E  R + +  +   + Q EN E+ + L++ E+ I+QL + K     QLE+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLG  G+++HE+EK RK++E E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ +E +K  K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KM+ADL+ +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDSAFDVLGFTPEEKNSIYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVSYAIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLQKNKDPLNETVVGLYQKSSLKLLSNLFANYAGADAPAD--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEFKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIVKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSTGKSIHELEKIRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRMVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKSLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Mouse
Match: Myh8 (myosin, heavy polypeptide 8, skeletal muscle, perinatal [Source:MGI Symbol;Acc:MGI:1339712])

HSP 1 Score: 1735.7 bits (4494), Expect = 0.000e+0
Identity = 1009/1911 (52.80%), Postives = 1393/1911 (72.89%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-----APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  ++     FD+K ++++ + KE Y+   ++  +G KVTVKT+ G T  VK+D +  MNPPK+  IEDMA +T L++  V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +A    K  ++  K +G+LEDQI+ ANP+LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+ S       + LL+T +P  ++F++QGE+T+  +DD+EE+  TD A  ILGFS EEK+S++K T ++M+ G MKFKQ+ REEQAE DGT  A+K ++L  +N+ DL++A+  P+VKVGNEYVTKGQ+  QV  ++GALAK++Y +MF W+VTR+N+ LDTK  RQ+FIGVLDIAGFEIFDFN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDL ACIELIEKP+GI SILEEECMFPKA+D + K KLYD HLGKS NF +   P  G+ EAHF L HYAG+V YNITGWL+KNKDPLN++VVGL   S    +ASLF     A A+   K G KKKG SF TVS + RE+LNKLM NL ST PHF+RCI+PNE K PG ++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  +AIP+G F++ K+ ++K+L +I +D   Y+ G+TKVFFKAG L  LE++RDEKL+ +I+  QA  RGYLMR +Y+K+  +R ++  IQ N+R ++ ++ W W KLF K+KP+L  A  E+EM    EE +K K+E  K+E  +KELEE+ VTLL+ KNDL LQ+Q+E DSLADAEE+  +L+  K  +E +IKE+ +   +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE   D+E  K +L+E+LK+KE E++   SKIEDE  +   LQ+KIKELQARI+ELEE++EAER +RAKAEK +  L  ELEEISERLEE GGAT AQ ++NKKRE E  KL+RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSEL+ +I+DLSS  E++ K KGNLEK  + LE  VS+L++K +E  R + E      R Q E  E  + L++ ++ ++QL ++KQ    Q+EE K+ LE+E++AK  L   L+++  D D LRE  EEEQEGK+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q  EE  E+  +KC+ LEK K RLQ E+EDL+IDVER N   + L+KKQ+N DK++ EW++KY E+Q ELE   +ESRT+S E+FK+K+  E S D +E+LRRENKNL  EI DLTEQ+ EGG+++HE+EK +K++E E+ E+Q ALEEAE++LE EE K  R QLE++Q + E +R++AEK+EE +  ++NH R +E+MQ++L+AE+R R +A+++KKK+E D+NE+E+ L+ ANRL +E  +N +  Q  L + Q  +++    +E + EQLA+ ER+  ++  E+EE++   +  E++RK+AE E  +A +++     QN+S + TK+K+E D++ +Q+++EE    +R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK + KLE R+RELEGE++ EQKR+ E  K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQAK+K+YKRQ EEAEE +  NLAK+RK+Q E+E++EERAD AE  + KLR K+
Sbjct:   18 YLRKSEKERIEAQNKPFDAKTSVFVAEPKESYVKSVIQSKDGGKVTVKTESGATLTVKEDQVFPMNPPKYDKIEDMAMMTHLHEPGVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNPEVVAAYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVTGDKKKEESGKMQGTLEDQIISANPLLEAFGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVTFQLKAERSYHIFYQITSNKKPELIEMLLITTNPYDYAFVSQGEITVPSIDDQEELMATDSAIDILGFSPEEKVSIYKLTGAVMHYGNMKFKQKQREEQAEPDGTEVADKAAYLQCLNSADLLKALCYPRVKVGNEYVTKGQTVQQVYNAVGALAKAVYEKMFLWMVTRINQQLDTKQPRQYFIGVLDIAGFEIFDFNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLAACIELIEKPLGIFSILEEECMFPKATDTSFKNKLYDQHLGKSNNF-QKPKPTKGKAEAHFSLVHYAGTVDYNITGWLDKNKDPLNDTVVGLYQKSAMKTLASLFSTYASAEADGGAKKGAKKKGSSFQTVSALFRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMEHELVLHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASAIPEGQFIDSKKASEKLLGSIDIDHTQYKFGHTKVFFKAGLLGLLEEMRDEKLAQIITRTQAVCRGYLMRVEYQKMLLRRESIFCIQYNVRAFMNVKHWPWMKLFFKIKPLLKSAETEKEMATMKEEFQKTKDELAKSEAKRKELEEKMVTLLKEKNDLQLQVQSEADSLADAEERCEQLIKNKIQLEAKIKEVTERAEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDENIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESTMDIENDKQQLDEKLKKKEFEISNLISKIEDEQAVEIQLQKKIKELQARIEELEEEIEAERASRAKAEKQRSDLSRELEEISERLEEAGGATSAQVEMNKKRETEFQKLRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSELKMEIDDLSSNAEAIAKAKGNLEKMCRTLEDQVSELKSKEEEQQRLINELTAQRARLQTEAGEYSRQLDEKDALVSQLSRSKQASTQQIEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQAAEEHVEAVNAKCASLEKTKQRLQNEVEDLMIDVERTNAACAALDKKQRNFDKVLSEWRQKYEETQAELESCQKESRTLSTELFKVKNAYEESLDHLETLRRENKNLQQEISDLTEQIAEGGKHIHELEKIKKQVEQEKCEIQAALEEAEASLEHEEGKILRIQLELNQVKSEIDRKIAEKDEEIDQLKRNHVRVVETMQSTLDAEIRSRNDALRVKKKMEGDLNEMEIQLNHANRLAAESLRNYRNTQGILKDTQLHLDDALRGQEDLKEQLAIVERRANLLQAEIEELRATLEQTERSRKIAEQELLDASERVQLLHTQNTSLINTKKKLENDVSQLQSEVEEVIQESRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQLALKGGKKQIQKLEARVRELEGEVENEQKRNAEAVKGLRKHERRVKELTYQTEEDRKNVLRLQDLVDKLQAKVKSYKRQAEEAEEQSNANLAKFRKLQHELEEAEERADIAESQVNKLRVKS 1927          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P24733|MYS_ARGIR (Myosin heavy chain, striated muscle OS=Argopecten irradians OX=31199 PE=1 SV=1)

HSP 1 Score: 2179.83 bits (5647), Expect = 0.000e+0
Identity = 1226/1918 (63.92%), Postives = 1531/1918 (79.82%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVK-TDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXX-XXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-APAEDXXXXXXXXXXXS-FMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            +D SDPDF YL VDRK L+K+   +FD KKN W+PDEKEG+ +  ++ + GD++TVK      T+ VK+D ++ MNPPKF  +EDMAN+T+LN+ASV  NLR RY   LIYTYSGLFCIAVNPYRR PIYT  VI KY+GKR+ E+PPH+FS++DNAY NM+ DRENQS LITGESGAGKTENTKKVI Y A VA A KK D++ S KK  SLEDQI+QANPVLEAYGNAKTTRNNNSSRFGKFIRIHFG +GKIAGADIE YLLEKSRV  QQ  ERNYHIFYQ+ S      +D +LVT D  L+SFINQG LT+D +DD EE KL DEAF ILGF+ EEK S+FKCT SI++MGEMKFKQRPREEQAE+DGT EAEKV+FL G+NA DL++A+LKPKVKVG E VTKGQ+ +QV+ S+GALAKSLY+RMF WLV RVNKTLDTK KR ++IGVLDIAGFEIFDFN FEQ+CINYTNERLQQFFNHHMF+LEQEEYKKE I WEFIDFGMDLQ CI+LIEKPMGILSILEEECMFPKA D++ + KLY NH+GK+  F KP KP +P Q  AHFELHHYAG+VPY+ITGWLEKNKDP+NE+VV LLGASKE LVA LF AP E  G    KK   S F T+S +HRESLNKLMKNL ST PHF+RCI+PNE KQPG+VDA LV+HQL CNGVLEGIRICRKGFP+R+IYSEFKQRYSILAPNAIPQGFV+GK V++KIL  +Q+D   YRLG TKVFFKAG L  LE++RDE+LS +IS+FQA IRGYL+R+ YKKLQDQR+ LS+IQRNIRK+LVLR W WWKL++KVKP+L+IARQEEEMK+  ++++K+KE+  KTE+ KKELEEQNVTLL+ KNDLFLQLQT +DS+ D EE+V KL++QKAD E +IKELE+ L +EE++A+ LE  KKK+ AD   LKKD+ DLE++LQKAEQ+K  KD QI +L   + +++E + K+ KEKKA +E  KKT +SL+AEE+K ++LNK KAKLEQALDE+E+NL RE+K+R DVEKAKRKVE +LK  QE + DLER+K ELEE ++RKE E++  NSK+EDE NLV+ LQRKIKELQARI+ELEE+LEAER ARAK EK + +L  ELEE+ ERL+E GGAT AQ +LNKKREAEL+K++RDLEEA++QHE  +  +RKK QD +NE ADQ+DQLQK KSK+E++K +L+ +++DL SQ+    K KG  EK  K  E+ +SDL  +L++  R + E  +  +R Q ENS++ + LEDAE +++ L K K QL +QLE+A+++LE+E+RA++KL  ++RN  +D+DA+RE LEEEQE KSDVQRQL K  NE+QQ ++  +  G  RTEE+E+ +RK+  ++ E E+ +E+  +KCS LEK KSRLQ E+ED+ I+V+RAN   +Q+EKKQ+  DK   EWQ K +  Q ELE S +ESR  SAE++++K+ +E  QD I +LRRENKNL+DEIHDLT+QL EGGR+ HE++K R+R+E+E++ELQ ALEEAE ALEQEEAK  RAQLEI+  R E ++R+ EKEEEF+ TR+NHQR LESMQASLEAE +G+ +AM++KKKLE DINELEV LD +NR K+E EK  K+YQQQ+ EMQ  +EE+  QR++  E   + ER+  +M GE+EE++   + AE+ RK +++E  +A D++NE + Q SS    KRK+E D+ AMQ DL+E     + A+E+ KKA+ D  RL DE++ EQ+H+ Q EK RKNLESQ+KE Q +L+EAEA+ LKGGKK + KLE R+ ELE ELD EQ+RH ETQKN RK+DRRLKE+++Q DED+KNQ+R+Q+LI+ L AKIKT+KRQVEEAEEIAA+NLAKYRK Q E+E++EERAD A+  LQK RAK
Sbjct:    3 IDFSDPDFQYLAVDRKKLMKEQTAAFDGKKNCWVPDEKEGFASAEIQSSKGDEITVKIVADSSTRTVKKDDIQSMNPPKFEKLEDMANMTYLNEASVLYNLRSRYTSGLIYTYSGLFCIAVNPYRRLPIYTDSVIAKYRGKRKTEIPPHLFSVADNAYQNMVTDRENQSCLITGESGAGKTENTKKVIMYLAKVACAVKKKDEEASDKKEGSLEDQIIQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGPTGKIAGADIETYLLEKSRVTYQQSAERNYHIFYQICSNAIPELNDVMLVTPDSGLYSFINQGCLTVDNIDDVEEFKLCDEAFDILGFTKEEKQSMFKCTASILHMGEMKFKQRPREEQAESDGTAEAEKVAFLCGINAGDLLKALLKPKVKVGTEMVTKGQNMNQVVNSVGALAKSLYDRMFNWLVRRVNKTLDTKAKRNYYIGVLDIAGFEIFDFNSFEQLCINYTNERLQQFFNHHMFILEQEEYKKEGIAWEFIDFGMDLQMCIDLIEKPMGILSILEEECMFPKADDKSFQDKLYQNHMGKNRMFTKPGKPTRPNQGPAHFELHHYAGNVPYSITGWLEKNKDPINENVVALLGASKEPLVAELFKAPEEPAGGGKKKKGKSSAFQTISAVHRESLNKLMKNLYSTHPHFVRCIIPNELKQPGLVDAELVLHQLQCNGVLEGIRICRKGFPSRLIYSEFKQRYSILAPNAIPQGFVDGKTVSEKILAGLQMDPAEYRLGTTKVFFKAGVLGNLEEMRDERLSKIISMFQAHIRGYLIRKAYKKLQDQRIGLSVIQRNIRKWLVLRNWQWWKLYSKVKPLLSIARQEEEMKEQLKQMDKMKEDLAKTERIKKELEEQNVTLLEQKNDLFLQLQTLEDSMGDQEERVEKLIMQKADFESQIKELEERLLDEEDAAADLEGIKKKMEADNANLKKDIGDLENTLQKAEQDKAHKDNQISTLQGEISQQDEHIGKLNKEKKALEEANKKTSDSLQAEEDKCNHLNKLKAKLEQALDELEDNLEREKKVRGDVEKAKRKVEQDLKSTQENVEDLERVKRELEENVRRKEAEISSLNSKLEDEQNLVSQLQRKIKELQARIEELEEELEAERNARAKVEKQRAELNRELEELGERLDEAGGATSAQIELNKKREAELLKIRRDLEEASLQHEAQISALRKKHQDAANEMADQVDQLQKVKSKLEKDKKDLKREMDDLESQMTHNMKNKGCSEKVMKQFESQMSDLNARLEDSQRSINELQSQKSRLQAENSDLTRQLEDAEHRVSVLSKEKSQLSSQLEDARRSLEEETRARSKLQNEVRNMHADMDAIREQLEEEQESKSDVQRQLSKANNEIQQWRSKFESEGANRTEELEDQKRKLLGKLSEAEQTTEAANAKCSALEKAKSRLQQELEDMSIEVDRANASVNQMEKKQRAFDKTTAEWQAKVNSLQSELENSQKESRGYSAELYRIKASIEEYQDSIGALRRENKNLADEIHDLTDQLSEGGRSTHELDKARRRLEMEKEELQAALEEAEGALEQEEAKVMRAQLEIATVRNEIDKRIQEKEEEFDNTRRNHQRALESMQASLEAEAKGKADAMRIKKKLEQDINELEVALDASNRGKAEMEKTVKRYQQQIREMQTSIEEEQRQRDEARESYNMAERRCTLMSGEVEELRAALEQAERARKASDNELADANDRVNELTSQVSSVQGQKRKLEGDINAMQTDLDEMHGELKGADERCKKAMADAARLADELRAEQDHSNQVEKVRKNLESQVKEFQIRLDEAEASSLKGGKKMIQKLESRVHELEAELDNEQRRHAETQKNMRKADRRLKELAFQADEDRKNQERLQELIDKLNAKIKTFKRQVEEAEEIAAINLAKYRKAQHELEEAEERADTADSTLQKFRAK 1920          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|F1PT61|MYH16_CANLF (Myosin-16 OS=Canis lupus familiaris OX=9615 GN=MYH16 PE=3 SV=2)

HSP 1 Score: 1825.06 bits (4726), Expect = 0.000e+0
Identity = 1041/1913 (54.42%), Postives = 1425/1913 (74.49%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            D  DP   +L    K  ++     +D KK+ W+ DEKEG+IA  ++   GD+VTVKT   +T  VK+D ++QMNPPKF    DMA++TFLN+ASV +NLRQRY    IYTYSGLFC+ VNPY+  PIY ++V   YKGK+R EMPPH+FSISDNAY +ML++RENQS+LITGESGAGKTENTKKVI YFANV    K+  D   +    LEDQI+QANPVLEA+GNAKT RNNNSSRFGKFIRIHFGT+GK+AGADIE YLLEKSRVISQQ  ER YHIFYQ+LS       + LL+  +P  + +++QG   ++ +DD EE+++TD AF +LGFS EEK+ ++K T  IM+ G MKFKQ+PREEQAE D T  A+KVS L+G+N+ +L + I +P+VKVGNE+V KGQ+ +Q   S+GAL K++Y++MF WLV R+NKTLDTK++RQFFIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYK+E I+W FIDFG+DLQACI+L+EKPMGI SILEE+C+FPKA+D T KA LYDNHLGKS NF KPK  K    EAHFEL HYAG+V YNITGWLEKNKDPLNE+VVGL   S   L+A LF   E       +K+G SFMTVS  +RE LNKLM  L ST+PHF+RCIVPNEFKQ GVVDAHL+MHQL CNGVLEGIRICRKGFPNRM Y EFKQRY +L PN IPQGFV+ K+ ++ +L +I LD N Y++G+TKVFF+AG LA+LED+RDE+L+ ++++ Q ++RG+LMR ++KK+ ++R+ L +IQRN RK+L LR W WWKL+ KVKP+LN+ARQEEEMK   EEL     + ++     KELEE+  TL Q KNDL +QLQ EQ+++ DAEE++++++  K D+E +I ++ + L EEE +A++L   K+KL  ++ +LK+D+E LE++L K E+EK A D ++++L  ++  +E+ +AK+QKEK+A +EL +KT + L+AEE+KV++L K  +KL   + E+E+N  +E+KIRA+VEKA+RK E +LK   + LND+ER K +LEE +K++++E+N  NSK EDE +L +TLQRK+KE QARI+ELEE+LEAER  RAK EK +  L  +LE++S+RLEE GGAT AQ + N+KREAEL+KL+R+LEEA +Q E A   +RKK  D+  E  + ++ LQ+ KSK+E++K  ++A+I+DL++ +E++ K+K N E   + LE ++S+   K+ EL R   E   V  R Q EN E+ +  E+++S++NQ+ + K  L +Q+++ K+ L++ES++++     L N   DLD ++E LEEEQ GKS++QR + K+  E+   +   +     RTEE+EE +RK+ AR+QE EE +E+ +++ + LEK K RLQ E+EDL ID+E+AN  A+ L+KKQ+  DK++ EWQ+K  E Q E++ S +E R    E FK+K+  E S + +ES+++ENK L +EI +L +QLGEGGR+VHE++K +K++EIE++ELQ ALEEAES+LE EE+K  R QLE++Q + + +RR+ EKEEEFE TRKNHQR +ES+QASLEAE +GR EA+++KKK+E D+NE+E+ LD AN+  SE  K  K+ QQQ+ ++Q Q++E   Q E++ EQ  L ER+L ++  ELEE+++  + +E++RK+ E E  E  ++ NE +IQN S +  KRK+E+D+  + ++ EE  +  R A+E+ KKA+ D  R+ +E++QEQ+H    EK +KN E  +K+LQ+K+EEAE   LKGGK+ + KLE RI+ELE ELDGEQK+HVET K  RK++RRLKE+ +Q +ED K   RMQ+L+E LQ K+K YKRQ+EEAEE A   LA+YRK   E++D+EERA  AE AL KLR ++
Sbjct:   11 DDVDP-MPFLAPPEKERIEAMNKPYDIKKSCWVKDEKEGFIAGEIQSEQGDQVTVKTVNNQTVTVKKDDVQQMNPPKFYQASDMADMTFLNEASVLNNLRQRYTNMRIYTYSGLFCVTVNPYKWLPIYGARVANMYKGKKRTEMPPHLFSISDNAYHDMLMNRENQSMLITGESGAGKTENTKKVIQYFANVGGTGKQSSDGKGQGS--LEDQIIQANPVLEAFGNAKTIRNNNSSRFGKFIRIHFGTTGKLAGADIESYLLEKSRVISQQAAERGYHIFYQILSNKKPELIESLLLVPNPKEYHWVSQGVTVVENMDDGEELQITDVAFDVLGFSAEEKIGIYKLTGGIMHFGNMKFKQKPREEQAEVDTTEVADKVSHLMGLNSGELQKGITRPRVKVGNEFVQKGQNVEQCNNSIGALGKAIYDKMFKWLVVRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKREGIEWVFIDFGLDLQACIDLLEKPMGIFSILEEQCVFPKATDATFKAALYDNHLGKSNNFLKPKGGKGKGPEAHFELVHYAGTVAYNITGWLEKNKDPLNETVVGLFQKSSLGLLALLFKEEEAPAGSKKQKRGSSFMTVSNFYREQLNKLMATLHSTAPHFVRCIVPNEFKQSGVVDAHLIMHQLACNGVLEGIRICRKGFPNRMQYPEFKQRYQVLNPNVIPQGFVDNKKASELLLGSIDLDVNEYKIGHTKVFFRAGILAKLEDMRDERLAKIMTMLQCRLRGFLMRIEFKKMLERRIGLKVIQRNTRKFLELRFWGWWKLYNKVKPLLNVARQEEEMKAKEEELRNAMSKTQELLSRVKELEEKMATLSQEKNDLTIQLQAEQENVIDAEERLTQMMKTKMDLESQISDMRERLEEEEGTAASLSATKRKLEGEMSDLKRDLEGLETTLAKTEKEKQALDHRVRTLTGDLSLREDSIAKLQKEKRALEELHQKTLDDLQAEEDKVNHLTKTNSKLSTQIHELEDNWEQEKKIRAEVEKARRKAESDLKMTIDNLNDMERSKLDLEEVVKKRDMEINSVNSKYEDEQSLNSTLQRKLKEHQARIEELEEELEAERSMRAKVEKQRSDLSRDLEDLSDRLEEAGGATSAQIEQNRKREAELLKLRRELEEAALQSEAAASTLRKKHTDSMAELTEHVENLQRVKSKLEKDKQVMKAEIDDLNASMETVQKSKMNAEAHIRKLEDSLSEANAKVAELERNQAEINAVRTRLQAENGELSREYEESQSRLNQILRIKTSLTSQVDDYKRQLDEESKSRSAAMVSLANTKHDLDLVKEQLEEEQGGKSELQRLVSKLNTEVTTWRTKYETDAIQRTEELEETKRKLAARLQEAEETAEAAQARAASLEKNKQRLQAEVEDLTIDLEKANAAAAALDKKQRVFDKMLAEWQQKCEELQVEVDSSQKECRMYMTESFKIKTAYEESLEHLESVKKENKTLQEEIKELIDQLGEGGRSVHELQKLKKKLEIEKEELQVALEEAESSLEVEESKVIRIQLELAQVKADIDRRIHEKEEEFEATRKNHQRAIESLQASLEAEAKGRAEALRLKKKMETDLNEMEIQLDHANKNNSELVKTLKRLQQQIKDLQVQMDEDARQHEELREQYNLQERRLSLLQTELEEVRSGLEGSERSRKLLEQEVVEITERHNEVNIQNQSLLVVKRKLESDVQRISSEHEELISEFRSADERAKKAMTDAARMAEELRQEQDHCMHLEKIKKNYEITIKDLQAKMEEAEQLALKGGKRTIMKLEARIKELETELDGEQKQHVETVKTLRKNERRLKELVFQTEEDHKTNQRMQELVEKLQNKLKVYKRQIEEAEEQANQTLARYRKTVHELDDAEERAGMAETALNKLRTRH 1920          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P05661|MYSA_DROME (Myosin heavy chain, muscle OS=Drosophila melanogaster OX=7227 GN=Mhc PE=1 SV=4)

HSP 1 Score: 1818.9 bits (4710), Expect = 0.000e+0
Identity = 1088/1947 (55.88%), Postives = 1424/1947 (73.14%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP------AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSE 5868
            DP+   F+ L   R    K Y    DSKK+ WIPDEKEGY+   ++ T GD V+V    GE + +K + +E++NPPKF  IEDMA++T LN   V  NLRQRYY  LIYTYSGLFC+A+NPY+R+P+YT++    Y+GKRR E+PPHIF+ISD AY +ML +  NQS+LITGESGAGKTENTKKVI YFA V A+ K D+   SK    LEDQ+VQ NPVLEA+GNAKT RN+NSSRFGKFIRIHFG +GK+AGADIE YLLEK+RVISQQ  ER+YHIFYQ++S       D  L+T +   +  ++QG++T+  +DD EE  LTD+AF ILGF+ +EK  +++ T ++M+MG MKFKQR REEQAE DG  E  +VS L G +  +L + +LKP++KVGNE+VT+G++  QV  S+GAL K +++R+F WLV + N+TLDT+ KRQ FIGVLDIAGFEIF++NGFEQ+CIN+TNE+LQQFFNH MFV+EQEEYKKE I+W+FIDFGMDL ACI+LIEKPMGILSILEEE MFPKA+DQT   KL + HLGKS  F KPKPPKPGQ  AHF + HYAG V YNITGWLEKNKDPLN++VV     S+  L+  +FA         +  K G  KKGG F TVS  ++E LN LM  L ST PHF+RCI+PNE KQPGVVDAHLVMHQL CNGVLEGIRICRKGFPNRM+Y +FK RY IL P  I +     K+ +  ++ + +L+ +LYRLG+TKVFF+AG L Q+E+ RDE+L  ++S  QA  RGYL R+ +KKLQ+QRVAL ++QRN+RKYL LRTW W+KL+ KVKP+LN++R E+E+ +  E+ +K +E      K +KELE  N  LL  K  L   L  E+ +L D +E+ +KL  QK D+E +++++++ L++EE++ + L + KKK + +I  LKKD+EDLE ++QKAEQ+K  KD QI++LND +  ++E + K+ KEKK   E  +KT E L+A E+K+++LNK KAKLEQ LDE+E++L RE+K+R DVEK+KRKVEG+LK  QE + DLER K ELE+ ++RK+ EL+   +K+EDE  +V   QR+IKELQARI+ELEE++EAERQARAKAEK +  L  ELEE+ ERLEE GGAT AQ +LNKKREAEL KL+RDLEEAN+QHE  L  +RKK  D   E A+Q+DQL K K+K E ++     ++    +  + L + K   EK  K L+ T++++Q+KLDE +R L +      +   ENS++ + LE+AESQ++QL K K  L  QLE+ K+  ++ESR +A L G  RN   DLD LRE +EEE EGK+D+QRQL K   E Q  ++  +  G  R+EE+EE +RK+ AR+ E EE  ES   KC  LEK K RL  E+EDL ++V+RAN +A+  EKKQK  DK+IGEW+ K  +   EL+ S +E R  S E+F+LK   E  Q+Q+E++RRENKNL+DE+ DL +Q+GEGGRN+HEIEK RKR+E E+DELQ ALEEAE+ALEQEE K  RAQLE+SQ RQE +RR+ EKEEEFE TRKNHQR L+SMQASLEAE +G+ EA++MKKKLE DINELE+ LD AN+  +E +KN K+YQQQL ++Q  +EE+   R+   EQL ++ER+   +  ELEE + + + A++ R+ AE E  +A ++LNE S QN+S  A KRK+E++L  + +DL+E  N A+ + E+ KKA+ D  RL DE++ EQ+HAQ  EK RK LE Q+KELQ +L+EAEAN LKGGKKA+ KLEQR+RELE ELDGEQ+RH + QKN RKS+RR+KE+S+Q +ED+KN +RMQ L++ LQ KIKTYKRQ+EEAEEIAA+NLAK+RK QQE+E++EERAD AEQA+ K RAK R+            G   +  ATS+R +
Sbjct:   12 DPTPYLFVSLEQRRIDQSKPY----DSKKSCWIPDEKEGYLLGEIKATKGDIVSVGLQGGEVRDIKSEKVEKVNPPKFEKIEDMADMTVLNTPCVLHNLRQRYYAKLIYTYSGLFCVAINPYKRYPVYTNRCAKMYRGKRRNEVPPHIFAISDGAYVDMLTNHVNQSMLITGESGAGKTENTKKVIAYFATVGASKKTDEAAKSKGS--LEDQVVQTNPVLEAFGNAKTVRNDNSSRFGKFIRIHFGPTGKLAGADIETYLLEKARVISQQSLERSYHIFYQIMSGSVPGVKDICLLTDNIYDYHIVSQGKVTVASIDDAEEFSLTDQAFDILGFTKQEKEDVYRITAAVMHMGGMKFKQRGREEQAEQDGEEEGGRVSKLFGCDTAELYKNLLKPRIKVGNEFVTQGRNVQQVTNSIGALCKGVFDRLFKWLVKKCNETLDTQQKRQHFIGVLDIAGFEIFEYNGFEQLCINFTNEKLQQFFNHIMFVMEQEEYKKEGINWDFIDFGMDLLACIDLIEKPMGILSILEEESMFPKATDQTFSEKLTNTHLGKSAPFQKPKPPKPGQQAAHFAIAHYAGCVSYNITGWLEKNKDPLNDTVVDQFKKSQNKLLIEIFADHAGQSGGGEQAKGGRGKKGGGFATVSSAYKEQLNSLMTTLRSTQPHFVRCIIPNEMKQPGVVDAHLVMHQLTCNGVLEGIRICRKGFPNRMMYPDFKMRYQILNPRGI-KDLDCPKKASKVLIESTELNEDLYRLGHTKVFFRAGVLGQMEEFRDERLGKIMSWMQAWARGYLSRKGFKKLQEQRVALKVVQRNLRKYLQLRTWPWYKLWQKVKPLLNVSRIEDEIARLEEKAKKAEELHAAEVKVRKELEALNAKLLAEKTALLDSLSGEKGALQDYQERNAKLTAQKNDLENQLRDIQERLTQEEDARNQLFQQKKKADQEISGLKKDIEDLELNVQKAEQDKATKDHQIRNLNDEIAHQDELINKLNKEKKMQGETNQKTGEELQAAEDKINHLNKVKAKLEQTLDELEDSLEREKKVRGDVEKSKRKVEGDLKLTQEAVADLERNKKELEQTIQRKDKELSSITAKLEDEQVVVLKHQRQIKELQARIEELEEEVEAERQARAKAEKQRADLARELEELGERLEEAGGATSAQIELNKKREAELSKLRRDLEEANIQHESTLANLRKKHNDAVAEMAEQVDQLNKLKAKAEHDRQTCHNELNQTRTACDQLGRDKAAQEKIAKQLQHTLNEVQSKLDETNRTLNDFDASKKKLSIENSDLLRQLEEAESQVSQLSKIKISLTTQLEDTKRLADEESRERATLLGKFRNLEHDLDNLREQVEEEAEGKADLQRQLSKANAEAQVWRSKYESDGVARSEELEEAKRKLQARLAEAEETIESLNQKCIGLEKTKQRLSTEVEDLQLEVDRANAIANAAEKKQKAFDKIIGEWKLKVDDLAAELDASQKECRNYSTELFRLKGAYEEGQEQLEAVRRENKNLADEVKDLLDQIGEGGRNIHEIEKARKRLEAEKDELQAALEEAEAALEQEENKVLRAQLELSQVRQEIDRRIQEKEEEFENTRKNHQRALDSMQASLEAEAKGKAEALRMKKKLEADINELEIALDHANKANAEAQKNIKRYQQQLKDIQTALEEEQRARDDAREQLGISERRANALQNELEESRTLLEQADRGRRQAEQELADAHEQLNEVSAQNASISAAKRKLESELQTLHSDLDELLNEAKNSEEKAKKAMVDAARLADELRAEQDHAQTQEKLRKALEQQIKELQVRLDEAEANALKGGKKAIQKLEQRVRELENELDGEQRRHADAQKNLRKSERRVKELSFQSEEDRKNHERMQDLVDKLQQKIKTYKRQIEEAEEIAALNLAKFRKAQQELEEAEERADLAEQAISKFRAKGRAGSVGR-------GASPAPRATSVRPQ 1944          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P02563|MYH6_RAT (Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=1 SV=2)

HSP 1 Score: 1761.12 bits (4560), Expect = 0.000e+0
Identity = 1032/1913 (53.95%), Postives = 1394/1913 (72.87%), Query Frame = 1
Query:   70 YLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            YL    K  L+     FD +   ++PD+KE Y+   +    G KVT +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA   +   D       +LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ERNYHIFYQ+LS       D LLVT +P  ++F++QGE+++  +DD EE+  TD AF +LGF+ EEK  ++K T +IM+ G MKFKQ+ REEQAE DGT +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQS  QV YS+GALAKS+Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWLEKNKDPLNE+VVGL   S   L+A+LF+        +     G KKKG SF TVS +HRE+LNKLM NL +T PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++  +  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG LMR ++KK+ ++R AL +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++K+  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+AEE+KV+ L K+K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+KE +++  NSKIEDE  L   LQ+K+KE QARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK ++ LE   ++ + KL+E  R L +      + Q EN E+ + LE+ E+ I QL + K     Q+E+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLGEGG+NVHE+EK RK++E+E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ SE +K+ K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KM+ADL+ +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   14 YLRKSEKERLEAQTRPFDIRTECFVPDDKEEYVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAIGDRSKKDNPNANKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERNYHIFYQILSNKKPELLDMLLVTNNPYDYAFVSQGEVSVASIDDSEELLATDSAFDVLGFTAEEKAGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEDADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQSVQQVYYSIGALAKSVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNVKGKQEAHFSLVHYAGTVDYNILGWLEKNKDPLNETVVGLYQKSSLKLMATLFSTYASADTGDSGKGKGGKKKGSSFQTVSALHRENLNKLMTNLRTTHPHFVRCIIPNERKAPGVMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSGKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQARGQLMRIEFKKMVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFGRVKDALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKSKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKLQLEEKLKKKEFDISQQNSKIEDEQALALQLQKKLKENQARIEELEEELEAERTARAKVEKLRSDLTRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSHMEQIIKAKANLEKVSRTLEDQANEYRVKLEEAQRSLNDFTTQRAKLQTENGELARQLEEKEALIWQLTRGKLSYTQQMEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGEGGKNVHELEKIRKQLEVEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSQANRIASEAQKHLKNAQAHLKDTQLQLDDAVRANDDLKENIAIVERRNTLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDKKNLVRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1925          
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Match: sp|P49824|MYH7_CANLF (Myosin-7 OS=Canis lupus familiaris OX=9615 GN=MYH7 PE=1 SV=3)

HSP 1 Score: 1758.42 bits (4553), Expect = 0.000e+0
Identity = 1023/1897 (53.93%), Postives = 1392/1897 (73.38%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-------APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KK++++PD+KE ++   +    G KVT +T+ G+T  VK+D + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y ++V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA   +   D +  KG+LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADIE YLLEKSRVI Q K ER+YHIFYQ+LS       D LL+T +P  ++FI+QGE T+  +DD EE+  TD AF +LGF+ EEK S++K T +IM+ G MKFKQ+ REEQAE DGT EA+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV Y+ GALAK++Y +MF W+VTR+N TL+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI GWL+KNKDPLNE+VV L   S   L+++LF       AP E     G  KKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +F+QRY IL P AIP+G F++ ++  +K+L+++ +D N Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QAQ RG L R +YKKL ++R +L +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  ++KE  EK+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+LADAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELK+D++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +L+E+LK+K+ ELN  N++IEDE  L + LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT  Q ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  E  +Q+D LQ+ K K+E+EKSE + +++D++S +E + K K NLEK  + LE  +++ ++K +E  R + +  +   + Q EN E+ + L++ E+ I+QL + K     QLE+ K+ LE+E +AK  L   L++A  D D LRE  EEE E K+++QR L K  +E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S + +E+ +RENKNL +EI DLTEQLG  G+ +HE+EK RK++E E+ ELQ ALEEAE++LE EE K  RAQLE +Q + E ER+LAEK+EE E  ++NH R ++S+Q SL+AE R R EA+++KKK+E D+NE+E+ L  ANR+ +E +K  K  Q  L + Q Q+++     + + E +A+ ER+  ++  ELEE++ + +  E++RK+AE E  E  +++     QN+S +  K+KM+ADL+ +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQKR+ E+ K  RKS+RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKRQ EEAEE A  NL+K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   31 FDLKKDVFVPDDKEEFVKAKIVSREGGKVTAETENGKTVTVKEDQVMQQNPPKFDKIEDMAMLTFLHEPAVLYNLKERYASWMIYTYSGLFCVTVNPYKWLPVYNAEVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFAVIAAIGDRSKKDQTPGKGTLEDQIIQANPALEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLASADIETYLLEKSRVIFQLKAERDYHIFYQILSNKKPELLDMLLITNNPYDYAFISQGETTVASIDDSEELMATDNAFDVLGFTSEEKNSMYKLTGAIMHFGNMKFKQKQREEQAEPDGTEEADKSAYLMGLNSADLLKGLCHPRVKVGNEYVTKGQNVQQVAYATGALAKAVYEKMFNWMVTRINATLETKQPRQYFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDMTFKAKLYDNHLGKSNNF-QKPRNIKGKQEAHFSLIHYAGTVDYNILGWLQKNKDPLNETVVALYQKSSLKLLSNLFANYAGADAPVE--KGKGKAKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKSPGVIDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFRQRYRILNPAAIPEGQFIDSRKGAEKLLSSLDIDHNQYKFGHTKVFFKAGLLGLLEEMRDERLSRIITRIQAQSRGVLSRMEYKKLLERRDSLLIIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMATMKEEFARIKEALEKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLADAEERCDQLIKNKIQLEAKVKEMTERLEDEEEMNAELTAKKRKLEDECSELKRDIDDLELTLAKVEKEKHATENKVKNLTEEMAGLDEIIAKLTKEKKALQEAHQQALDDLQAEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLDERLKKKDFELNALNARIEDEQALGSQLQKKLKELQARIEELEEELEAERTARAKVEKLRSDLSRELEEISERLEEAGGATSVQIEMNKKREAEFQKMRRDLEEATLQHEATAAALRKKHADSVAELGEQIDNLQRVKQKLEKEKSEFKLELDDVTSNMEQIIKAKANLEKMCRTLEDQMNEHRSKAEETQRSVNDLTSQRAKLQTENGELSRQLDEKEALISQLTRGKLTYTQQLEDLKRQLEEEVKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQSELESSQKEARSLSTELFKLKNAYEESLEHLETFKRENKNLQEEISDLTEQLGSSGKTIHELEKVRKQLEAEKLELQSALEEAEASLEHEEGKILRAQLEFNQIKAEIERKLAEKDEEMEQAKRNHLRVVDSLQTSLDAETRSRNEALRVKKKMEGDLNEMEIQLSHANRMAAEAQKQVKGLQSLLKDTQIQLDDAVRANDDLKENIAIVERRNNLLQAELEELRAVVEQTERSRKLAEQELIETSERVQLLHSQNTSLINQKKKMDADLSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQKRNAESVKGMRKSERRIKELTYQTEEDRKNLLRLQDLVDKLQLKVKAYKRQAEEAEEQANTNLSKFRKVQHELDEAEERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. TrEMBL
Match: O96063 (Myosin heavy chain (Fragment) OS=Dugesia japonica OX=6161 GN=DjMHC-B PE=2 SV=1)

HSP 1 Score: 2807.71 bits (7277), Expect = 0.000e+0
Identity = 1608/1733 (92.79%), Postives = 1681/1733 (97.00%), Query Frame = 1
Query:  673 LEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            LEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYH+KLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAF +LGFSDEE+MSLFKCTTSIMNMGEMKFKQRPREEQAEADGT EAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLV RVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPG  EAHFELHHYAGSVPYNITGWLEKNKDPLNE+VVGLLGASKE LV+SLFAPAED  + G +KKGG+  T+S  HRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGK VTDKIL+AIQLD NLYRLGNTKVFFKAGTLAQLED+RDEKLSSLIS+FQAQIRGYLMRRQYK+LQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEEL KLKEEFEK+EKYKK+LEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELED LSEEENSA+TLEEAKKKLN +I+ELKKDVE LESSLQKAEQEK AKDQQIK+LNDNVREKEEQ+ KMQKEKKAADELQKKTEESL+AEEEKVSNLNKAKAKLEQA+DEMEENL REQK+RADVEKAKRKVEGELKQNQE+LNDLER+KSELEEQLKRKE+ELNGANSKIEDE+NLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAE+EE++ERLEEQGGATQAQTDLNKKREAEL+KLKRDLEEANMQHEQA++Q RKKQQDT+NEFADQLDQLQKSKSKIEREK+ELR DIEDLS QLESLNK K NLEKSNK LE T+S+LQNKLDEL++QL++AGN NNRNQHENSE+HK+LEDAESQINQL KAKQQLQAQLEEAKQNLEDESRAK+KLNGDLRNA+SDLDA+RESLEEEQEGKSDVQRQLVKVQNELQQLK+NSQGTGGVR+EEMEEF+RKMNARIQELEEESESNKSKCSQLEK+KSRLQGEIEDL+IDVERANGLASQLEKKQK VDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKS LENSQDQIESL+RENKNLSDEIHDLTEQLGEGGRNVHEIEK RKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQE+ERR+AEKEEEFE TRKNHQR+LESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKN+KKYQQQL EMQAQV+EQHHQRE VSEQL L ERKL MM+GELEE++NMCDHAEKNRK AESEKNEA+DKLNE SIQNSSFMA KRK+E DL+AMQADLEE+TN  RQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKN ESQLK+LQ+KL+EAEAN LKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARK+DRRLKEI+YQIDEDKKNQDRMQQLIE+LQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSV+RGAS GPGTKISIT++S R ED
Sbjct:   12 LEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHEKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFGVLGFSDEERMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTAEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVNRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGHAEAHFELHHYAGSVPYNITGWLEKNKDPLNETVVGLLGASKETLVSSLFAPAEDPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKMVTDKILSAIQLDKNLYRLGNTKVFFKAGTLAQLEDLRDEKLSSLISMFQAQIRGYLMRRQYKRLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELAKLKEEFEKSEKYKKDLEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDQLSEEENSATTLEEAKKKLNGEIEELKKDVESLESSLQKAEQEKAAKDQQIKTLNDNVREKEEQITKMQKEKKAADELQKKTEESLRAEEEKVSNLNKAKAKLEQAVDEMEENLSREQKVRADVEKAKRKVEGELKQNQEMLNDLERVKSELEEQLKRKEMELNGANSKIEDENNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAEIEEVTERLEEQGGATQAQTDLNKKREAELMKLKRDLEEANMQHEQAIMQTRKKQQDTANEFADQLDQLQKSKSKIEREKNELRGDIEDLSGQLESLNKAKINLEKSNKGLEATISELQNKLDELTKQLSDAGNSNNRNQHENSELHKSLEDAESQINQLSKAKQQLQAQLEEAKQNLEDESRAKSKLNGDLRNALSDLDAMRESLEEEQEGKSDVQRQLVKVQNELQQLKSNSQGTGGVRSEEMEEFKRKMNARIQELEEESESNKSKCSQLEKVKSRLQGEIEDLLIDVERANGLASQLEKKQKGVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSVLENSQDQIESLKRENKNLSDEIHDLTEQLGEGGRNVHEIEKARKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQEAERRIAEKEEEFEVTRKNHQRSLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNSKKYQQQLLEMQAQVDEQHHQRELVSEQLVLAERKLTMMNGELEEVRNMCDHAEKNRKAAESEKNEAVDKLNELSIQNSSFMAAKRKLETDLSAMQADLEEATNEGRQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNFESQLKDLQTKLDEAEANALKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKNDRRLKEITYQIDEDKKNQDRMQQLIENLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVNRGASMGPGTKISITSSS-RIED 1743          
BLAST of Myosin heavy chain vs. TrEMBL
Match: O96062 (Myosin heavy chain OS=Dugesia japonica OX=6161 GN=DjMHC-A PE=2 SV=1)

HSP 1 Score: 2737.21 bits (7094), Expect = 0.000e+0
Identity = 1531/1933 (79.20%), Postives = 1738/1933 (89.91%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXX---XXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGT 5832
            M+P+DPDF YLGVDRKALLKQYGDSFDSKKN WIPDEKEG+I+ T+E+++GD  T+KT+K ETK VK+D ++QMNPPKFMMIEDMANLTFLNDASV DNLRQR+YKNLIYTYSGLFC+ +NPY+RFPIYT+QVI KYKGKRR EMPPHIFSISDNAYSNML DR+NQSVLITGESGAGKTENTKKVITYFA+VAAA+KK+DD+      +KG+LEDQIVQANPVLEAYGNAKT RNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRV SQQKGERNYHIFYQ+LSAGGK +H+KLL++ DPAL+SFINQGELTIDGVDDEEEMK+TDEAF ILGFS +EKMSLFKCT SI+NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDLMQ+ILKPKVKVGNEYVTKGQSKDQVLYS+GALAKSLYNRMFAWLV RVNKTLDTKVKRQFFIGVLDIAGFEIF+FNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASD T KAKLYDNHLGKSPNFGKPKPPKPGQ EAHFELHHYAGSVPYN+TGWLEKNKDPLNE+V+ LL ASKE LV+SLF PAED    G +KKGG+  T+S  HRESLNKLMKNL STSPHFIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVT KIL A+QLD NLYRLGNTK+FFKAGTLA LED+RDEKLSSLISLFQAQIRGYLMR+QYKKLQDQRVALS+IQRNIRKYL+LRTW WWKL+TKVKP+LNIARQEEEMKKAAEEL KLKEEFEK +K+KKELEEQNV LL+AKNDLFLQLQTEQDSLADAEEKVSKLV+QKADME RIKELED L EEE++++ LEE KKK+  +I+ELKKDV DLESSLQKAEQEK AKDQQIK+L D +  +EE++ KM+KEKKAADELQKKTEESL+AEEEKV NLNKAKAKLEQ +DEMEENL REQK+RADVEK KRK+E ELKQ QE ++DLER+K ELEEQLKRKE+EL+ A+SKIEDES LVA LQ+KIKELQARIQELEEDLEAERQARAKAEK++HQLE ELEE+S+RLEEQGGAT AQ +LNKKREAEL+KLKRDLEEANMQH+Q + Q RKKQQD +NEF+DQLDQLQK+K+KIE+EK+E++ D+ DL SQLE+LNK K N +K  K LE+  ++LQ KL+EL+R + +A N + +NQ  N+E+   LE+AESQINQL K KQQ+Q QLEEA+QNL+DESR KAKL+ D+RN  +DLD LRE+LEEE E KSD+QRQLVK Q+E+QQ+K+  +GTG VR+EE++E +RK  ARI ELEEESES KSK  QLEK+K+RLQGEIED+++DV+RAN LASQLEKKQK  DK++ EWQ+KY+ESQ E+E S RESR VSAEVF+LK+Q+E SQ+Q+ES++RENKNL+DEIHDLTEQ+GEGGR+VHE EK RKR+E+E++ELQHALEEAE ALEQEEAK+QR+QLE+SQ RQE +RR+AEKEEEFE TR NHQR +ESM+ASLEAE RGRTE+ KMKKKLEHDI ELEV +DTANR +SE EKNAKK+QQQ+ E+QA VE++ HQ++Q+ EQ  + ERK+ M+ GELEE+++  +++E+NRK  ESEK E  D+LNE S+Q+SSFMATKRK+EADLAAMQ+DLEE++N ARQANEQ KKA+ D++RLFDEI+QEQEHAQQ +K +K LE+Q KELQ KL+E+E N +KGGKK L KLEQR+RELE ELD EQKRHVETQKN RK +RRLKEI  Q DEDKKNQ+R+Q L+E LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLR KNRSSVS +RG S  PGT
Sbjct:    1 MNPTDPDFQYLGVDRKALLKQYGDSFDSKKNCWIPDEKEGFISATIEDSSGDVFTIKTEKLETKTVKKDEIQQMNPPKFMMIEDMANLTFLNDASVLDNLRQRFYKNLIYTYSGLFCVTINPYKRFPIYTAQVIAKYKGKRRTEMPPHIFSISDNAYSNMLTDRDNQSVLITGESGAGKTENTKKVITYFAHVAAATKKEDDESGSGGKRKGTLEDQIVQANPVLEAYGNAKTVRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVNSQQKGERNYHIFYQILSAGGKQFHEKLLISPDPALYSFINQGELTIDGVDDEEEMKITDEAFDILGFSSDEKMSLFKCTCSILNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLMQSILKPKVKVGNEYVTKGQSKDQVLYSVGALAKSLYNRMFAWLVLRVNKTLDTKVKRQFFIGVLDIAGFEIFNFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDMTFKAKLYDNHLGKSPNFGKPKPPKPGQAEAHFELHHYAGSVPYNVTGWLEKNKDPLNETVINLLAASKEALVSSLFVPAEDASSSGKRKKGGAMQTISSTHRESLNKLMKNLQSTSPHFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTGKILEAVQLDKNLYRLGNTKIFFKAGTLADLEDMRDEKLSSLISLFQAQIRGYLMRKQYKKLQDQRVALSIIQRNIRKYLMLRTWAWWKLYTKVKPLLNIARQEEEMKKAAEELAKLKEEFEKVDKFKKELEEQNVKLLEAKNDLFLQLQTEQDSLADAEEKVSKLVMQKADMESRIKELEDHLLEEEDASAGLEEMKKKMQGEIEELKKDVVDLESSLQKAEQEKTAKDQQIKALQDQIARQEEEMNKMKKEKKAADELQKKTEESLQAEEEKVKNLNKAKAKLEQTIDEMEENLSREQKVRADVEKVKRKIETELKQTQETVDDLERVKRELEEQLKRKEMELSNASSKIEDESGLVAQLQKKIKELQARIQELEEDLEAERQARAKAEKSRHQLEGELEELSDRLEEQGGATSAQLELNKKREAELLKLKRDLEEANMQHDQMIAQSRKKQQDVANEFSDQLDQLQKAKAKIEKEKNEMKEDLNDLQSQLEALNKAKANSDKKIKELESQNAELQGKLEELNRHINDANNTSGKNQQLNAELQARLEEAESQINQLTKVKQQMQTQLEEARQNLDDESRTKAKLSSDVRNLNADLDNLREALEEENENKSDLQRQLVKAQSEMQQMKSKFEGTGSVRSEELDEAKRKFMARIHELEEESESAKSKVGQLEKIKARLQGEIEDMLVDVDRANALASQLEKKQKTFDKVVSEWQQKYAESQAEVEASQRESRAVSAEVFRLKAQIEESQEQLESVKRENKNLADEIHDLTEQIGEGGRSVHETEKARKRLEMEKEELQHALEEAEQALEQEEAKAQRSQLEMSQVRQEIDRRIAEKEEEFEATRVNHQRAMESMEASLEAESRGRTESTKMKKKLEHDIGELEVAVDTANRFRSEAEKNAKKFQQQVQELQAMVEDEKHQKDQIREQTMMNERKMAMILGELEEVRSSLENSERNRKNTESEKVELTDRLNELSVQSSSFMATKRKLEADLAAMQSDLEEASNEARQANEQAKKAVADSSRLFDEIRQEQEHAQQLDKIKKQLEAQNKELQVKLDESENNAMKGGKKVLGKLEQRVRELEAELDAEQKRHVETQKNTRKIERRLKEIGLQTDEDKKNQERLQDLVEKLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRTKNRSSVSTARGGSMAPGT 1933          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A5K3EWP6 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 2491.46 bits (6456), Expect = 0.000e+0
Identity = 1407/1940 (72.53%), Postives = 1655/1940 (85.31%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQY-GDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTK-ISITATS 5856
            MDPSDPDF YLGVDRKALLK+    SFDSK   W+ DEKEGY+   + ET+GD VTV+   G TK +K+D ++Q+NPPKF M EDMA+LT+LNDASV +NLR RYY  LIYTYSGLFC+AVNPY+R+PIY+ +V MKYKGKRR EMPPH+FSI+DNAY +ML DRENQS+LITGESGAGKTENTKKVI+YFA V A   K  ++  KK   LEDQIVQANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV SQ KGERN+HIFYQLLS  GK YHDKLLVTADPAL+SFINQGELTIDGVDD EEMKLTDEA  ILGF+++E+MSLFKCTTS++NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDL+ + LKPKVKVGNE+VTKGQ+ DQV +++ ALAKSLY+R+F WLV RVNKTLDTKVKRQ+FIGVLDIAGFEIFD NGFEQICINYTNERLQQFFNHHMFV EQEEY+KE I W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D+T K KLYDNHLGKSPNF KPKPPK GQ EAHFELHHYAGSVPYNITGWL KNKDPLN++VV LL  SKE LVA +FAP ED      KKK  SFMTV+Y HRESLNKLMKNLMSTSP FIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPN IP GF++GKQVT+KIL A QL    Y+ GNTKVFFKAGTLA+LED+RDEKL+ +IS FQAQIRGYLMR++YKKLQDQR AL+LIQRNIRKYL+LRTW WW+L+TKVKPMLNIARQEEEMKKAAEEL KLKEEFEK EK KKELEEQNVTLLQ KND+FLQLQTEQD+LAD+EEKVSKL+LQKADME +IKELE+ L++EE+S+  LEEAKKKL A+IDELKKDVEDLES+LQKAEQEK AKD QI+ L   ++++E+QLA++ KEKKA +E  K+T E+L+AEE+KV++L K KAKLE  LDEMEENL REQKIR+DVEKAKRK+EG+LK  QE ++D+ER+K +LEEQL+RK+ ELN   SK E++  L+  LQRKIKELQARI ELEEDLEAER AR+KAEKA+ QLEAEL+E+S+RLEEQGGAT AQ DLNKKREAELIKLKRDLEEA +Q+EQ +  MRKKQ D  NE  DQLDQ QK K+K+E+EK++L+A+ +DL  Q+ +L K K N EK+ K  E  VS+LQ +LDE +RQ T+AG+   R   + +E+ + LE+AESQI QL KAKQQL +QLEEA++NL++E+RAK+KL+ ++RN  SDLDALRESLEEEQ  KSD+QRQ+ K+Q E+       +G G ++ EE EE +R++NA+IQE E E+E+ K KCSQLEK+K+RLQG+IEDL++DVERANGLASQLEKKQKN DK +GEWQ KY+ESQ ELE + RE+R  S +VF+LK+QLE +QDQIE++RRENKNLSDEIHDLTEQLGEGGR+VHE +K RKR+E+E++ELQ ALEEAESALEQEEAK QRA LE+SQ R E +RRLAEKEEEFE TRKNHQR +ESMQASLEAEV+G+ +AM+MKKKLE DINELEV LD+ANR ++E EKN KK+QQQ+ E+++Q+EE+   RE++ E  +  ER+  MM  E+E+++N  + +E+ RK AE E+ EA D+ +E S+Q++SF A KRKMEADLAAMQADLEE+ N A+QA+E+ KKA+ D+ R+F+E++QEQEH Q  EKARK LE Q+KELQ +LEEAE+N +KGGKKAL+KLEQR+RELE ELD EQ+RH ETQKN RK DRRLKE++ Q DEDKKN DRMQ+L++ LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLRAKNRSSVS+SRG S+ PG + I++T  S
Sbjct:    1 MDPSDPDFEYLGVDRKALLKEAEAGSFDSKSVAWVEDEKEGYVMADIVETSGDTVTVRLKDGTTKQIKKDDIQQVNPPKFTMTEDMADLTYLNDASVLENLRARYYHKLIYTYSGLFCVAVNPYKRYPIYSYEVAMKYKGKRRAEMPPHLFSIADNAYHSMLADRENQSILITGESGAGKTENTKKVISYFAFVTANPSKKGEEVEKKGS-LEDQIVQANPLLEAYGNAKTNRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTSQMKGERNFHIFYQLLSDYGKKYHDKLLVTADPALYSFINQGELTIDGVDDSEEMKLTDEAIDILGFTNDERMSLFKCTTSVINMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEFVTKGQNLDQVNFAVNALAKSLYSRLFTWLVARVNKTLDTKVKRQYFIGVLDIAGFEIFDENGFEQICINYTNERLQQFFNHHMFVQEQEEYRKENIQWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDETFKNKLYDNHLGKSPNFAKPKPPKAGQKEAHFELHHYAGSVPYNITGWLVKNKDPLNDTVVNLLMESKESLVAHMFAPPED---GTKKKKSSSFMTVTYTHRESLNKLMKNLMSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNVIPAGFIDGKQVTEKILDACQLSKESYQCGNTKVFFKAGTLAELEDMRDEKLNKIISNFQAQIRGYLMRKEYKKLQDQRTALALIQRNIRKYLMLRTWPWWRLYTKVKPMLNIARQEEEMKKAAEELAKLKEEFEKLEKLKKELEEQNVTLLQQKNDIFLQLQTEQDNLADSEEKVSKLILQKADMEQQIKELEERLNDEEDSSRNLEEAKKKLAAEIDELKKDVEDLESTLQKAEQEKQAKDNQIRQLQSEMQQQEDQLARLNKEKKALEEQNKRTSEALQAEEDKVNHLTKLKAKLESTLDEMEENLAREQKIRSDVEKAKRKLEGDLKATQETVDDMERVKRDLEEQLRRKDAELNNMGSKSEEDQGLINQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDEVSDRLEEQGGATAAQMDLNKKREAELIKLKRDLEEARIQNEQQIAAMRKKQTDAINEVTDQLDQAQKLKAKLEKEKTDLKAECDDLQGQVANLAKQKMNAEKNWKTFEAQVSELQARLDEATRQNTDAGSQKARLTQDVTELQRQLEEAESQIGQLTKAKQQLASQLEEARRNLDEETRAKSKLSSEVRNLNSDLDALRESLEEEQASKSDMQRQIQKLQAEI--AAGVGKGQGDIKNEEFEEMKRRLNAKIQEYESEAEAAKQKCSQLEKVKARLQGDIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQAKYAESQSELENAQREARGYSTDVFRLKAQLEEAQDQIEAVRRENKNLSDEIHDLTEQLGEGGRSVHEADKARKRLEMEKEELQAALEEAESALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAIESMQASLEAEVKGKADAMRMKKKLEQDINELEVALDSANRSRAEMEKNVKKFQQQVRELESQIEEEQRSREELRETASTAERRAQMMAAEMEDLRNHLEASERARKTAEMERAEAADRASELSVQSASFTAMKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQHVEKARKQLEQQVKELQVRLEEAESNAMKGGKKALAKLEQRVRELETELDAEQRRHGETQKNYRKIDRRLKEVTLQADEDKKNYDRMQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKNRSSVSMSRGPSAAPGGRSINMTTNS 1934          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A068YE18 (Myosin heavy chain OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000920900 PE=3 SV=1)

HSP 1 Score: 2486.45 bits (6443), Expect = 0.000e+0
Identity = 1390/1915 (72.58%), Postives = 1639/1915 (85.59%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQY-GDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            MDPSDPDF YLGVDRKALLK+    SFDSK   W+ DEKEGY+   +EET+GD VTV+   G TK +K+D ++Q+NPPKF+M EDMA+LT+LNDASV +NLR RYY  LIYTYSGLFC+AVNPY+R+PIY+ +V MKYKGKRR EMPPH+FSISDNAY +ML DRENQS+LITGESGAGKTENTKKVI+YFA V A   K  ++  KK   LEDQIVQANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV SQ KGERN+HIFYQLLS  GK YHDKLLV+ADPAL+SFINQGELTIDGVDD EEMKLTDEA  ILGFS++E+MSLFKCTTS++NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDL+ + LKPKVKVGNE+VTKGQ+ DQV +++ ALAKSLY+R+F WLV RVNKTLDTKVKRQ+FIGVLDIAGFEIF+ NGFEQICINYTNERLQQFFNHHMFV EQEEY+KE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DQT K KLYDNHLGKSPNF KPKPPK GQ EAHFELHHYAGSVPYNITGWL+KNKDPLN++VV LL  SKE LVA +FAP ED      KKK GSFMTV+Y HRESLNKLMKNLMSTSP FIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRM+YSEFKQRYSILAPN IP GFV+GKQVT+KIL A QL  + Y+ GNTKVFFKAGTLA+LED+RDEKL+ +IS FQAQIRGYLMR++YKKLQDQR AL+LIQRNIRKYL+LRTW WW+L+TKVKPMLNIARQEEEM+KAAEEL K+KEEFEK EK KKELEEQNVTLLQ KND+FLQLQTEQD+LAD+EEKVSKL+LQKADME +IKELE+ L++EE+++  LEEAKKKL A+IDELKKDVEDLES+LQKAEQEK AKD QIK L   ++++E+Q+A++ KEKKA +E  K+T E+L+AEE+KV++LNK KAKLE  LDEMEENL REQKIR DVEKAKRK+EG+LK  QE ++DLER+K +LEEQL+RK+ E+    SK E++  L+  LQRKIKELQARI ELEEDLEAER AR+KAEKA+ QLEAEL+E+S+RLEEQGGAT AQ DLNKKREAELIKLKRDLEEA +Q+EQ +  +RKKQ D  NE  DQLDQ  K K+K+E+EK +L+A+ +DL SQ+ ++ K K N EK+ K  E+ +++LQ KLDE SRQ T+AG+   R   + +E+ + LE+AESQ+ QL KAKQQL +QLEEA++NL++ESRAK+KL  ++RN  SDLDALRESLEEEQ  KSD+QRQ+ K+Q+EL       +G G ++TEE EE +R++ A++QE E ++ES K KCSQLEK+K+RLQGEIEDL++DVERANGLASQLEKKQKN DK +GEWQ KY+ESQ ELE + RE R  S +VF+LK+QLE + DQIE++RRENKNLSDEIHDLTEQLGEGGR+VHE +K RKR+E+E++ELQ ALEEAESALEQEEAK QRA LE+SQ R E +RRLAEKEEEFE TRKNHQR +ESMQASLEAEV+G+ +AM+MKKKLE DINELEV LD+ANR ++E EKNAKK+QQQ+ EM++Q+EE  H R+++ E ++  ER+  M+ GEL++++   + +E+ RK AE E+ EA D+ +E + Q++SF A KRKMEADLAAMQADLEE+ N A+QA+E+ KKA+ D+ R+F+E++QEQEH Q  EKARK  E Q+KELQ +LEEAEAN +KGGKKAL+KLEQR+RELE ELD EQ+RH ETQKN RK DRRLKE++ Q DEDKKN DR+Q+L++ LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLRAKN
Sbjct:    1 MDPSDPDFEYLGVDRKALLKEAEAGSFDSKSVAWVEDEKEGYVMADIEETSGDTVTVRLKDGNTKKIKKDDIQQVNPPKFIMAEDMADLTYLNDASVLENLRARYYHKLIYTYSGLFCVAVNPYKRYPIYSYEVAMKYKGKRRAEMPPHLFSISDNAYHSMLADRENQSILITGESGAGKTENTKKVISYFAFVTANPAKKGEEVEKKGS-LEDQIVQANPLLEAYGNAKTNRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTSQMKGERNFHIFYQLLSDYGKKYHDKLLVSADPALYSFINQGELTIDGVDDAEEMKLTDEAIDILGFSNDERMSLFKCTTSVVNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEFVTKGQNLDQVNFAVNALAKSLYSRLFTWLVARVNKTLDTKVKRQYFIGVLDIAGFEIFEENGFEQICINYTNERLQQFFNHHMFVQEQEEYRKENIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDQTFKQKLYDNHLGKSPNFAKPKPPKAGQKEAHFELHHYAGSVPYNITGWLDKNKDPLNDTVVNLLQESKETLVAYMFAPPED---GTKKKKSGSFMTVTYTHRESLNKLMKNLMSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMVYSEFKQRYSILAPNVIPAGFVDGKQVTEKILDACQLSKDSYQCGNTKVFFKAGTLAELEDMRDEKLNKIISNFQAQIRGYLMRKEYKKLQDQRTALALIQRNIRKYLMLRTWPWWRLYTKVKPMLNIARQEEEMRKAAEELAKMKEEFEKLEKLKKELEEQNVTLLQQKNDIFLQLQTEQDNLADSEEKVSKLILQKADMEQQIKELEERLNDEEDASKNLEEAKKKLAAEIDELKKDVEDLESTLQKAEQEKQAKDNQIKQLQSEMQQQEDQIARLNKEKKALEEQNKRTTEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKAKRKLEGDLKSTQESVDDLERVKRDLEEQLRRKDAEMANMGSKSEEDQGLINQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDEVSDRLEEQGGATAAQMDLNKKREAELIKLKRDLEEARIQNEQQVQALRKKQADAVNEITDQLDQATKLKAKVEKEKGDLKAECDDLQSQIANITKQKMNAEKNWKTCESQLAELQAKLDETSRQATDAGSQKARLSQDITELQRQLEEAESQLGQLSKAKQQLASQLEEARRNLDEESRAKSKLTSEVRNLTSDLDALRESLEEEQSAKSDMQRQIQKLQSEL--AAGVGKGQGDIKTEEFEEMKRRLTAKLQEAESDAESAKQKCSQLEKIKARLQGEIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQAKYAESQAELENAQREGRGYSTDVFRLKAQLEEANDQIEAVRRENKNLSDEIHDLTEQLGEGGRSVHEADKARKRLEMEKEELQAALEEAESALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAIESMQASLEAEVKGKADAMRMKKKLEQDINELEVALDSANRGRAEMEKNAKKFQQQVREMESQMEEDQHVRDELRENVSTAERRAQMLAGELDDLRTHLETSERARKAAELERAEASDRASELTAQSASFAAMKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQHVEKARKQAEQQVKELQVRLEEAEANAMKGGKKALAKLEQRVRELETELDAEQRRHGETQKNYRKIDRRLKEVTMQADEDKKNYDRLQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKN 1909          
BLAST of Myosin heavy chain vs. TrEMBL
Match: A0A068WWT7 (Myosin heavy chain OS=Echinococcus granulosus OX=6210 GN=EgrG_000920900 PE=3 SV=1)

HSP 1 Score: 2485.29 bits (6440), Expect = 0.000e+0
Identity = 1390/1915 (72.58%), Postives = 1636/1915 (85.43%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQY-GDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            MDPSDPDF YLGVDRKALLK+    SFDSK   W+ DEKEGY+   + ET+GD VTV+   G TK +K+D ++Q+NPPKF+M EDMA+LT+LNDASV +NLR RYY  LIYTYSGLFC+AVNPY+R+PIY+ +V MKYKGKRR EMPPH+FSISDNAY NML DRENQS+LITGESGAGKTENTKKVI+YFA V A   K  ++  KK   LEDQIVQANP+LEAYGNAKT RNNNSSRFGKFIRIHFGT+GKIAGADIEFYLLEKSRV SQ KGERN+HIFYQLLS  GK YHDKLLV+ADPAL+SFINQGELTIDGVDD EEMKLTDEA  ILGFS++E+MSLFKCTTS++NMGEMKFKQRPREEQAEADGT EAEKV+FLLGVNAKDL+ + LKPKVKVGNE+VTKGQ+ DQV +++ ALAKSLY+R+F WLV RVNKTLDTKVKRQ+FIGVLDIAGFEIF+ NGFEQICINYTNERLQQFFNHHMFV EQEEY+KE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+DQT K KLYDNHLGKSPNF KPKPPK GQ EAHFELHHYAGSVPYNITGWL+KNKDPLN++VV LL  SKE LVA +FAP ED      KKK GSFMTV+Y HRESLNKLMKNLMSTSP FIRCIVPNEFKQPGV+DAHLV+HQLHCNGVLEGIRICRKGFPNRM+YSEFKQRYSILAPN IP GFV+GKQVT+KIL A QL  + Y+ GNTKVFFKAGTLA+LED+RDEKL+ +IS FQAQIRGYLMR++YKKLQDQR AL+LIQRNIRKYL+LRTW WW+L+TKVKPMLNIARQEEEM+KAAEEL K+KEEFEK EK KKELEEQNVTLLQ KND+FLQLQTEQD+LAD+EEKVSKL+LQKADME +IKELE+ L++EE+++  LEEAKKKL A+IDELKKDVEDLES+LQKAEQEK AKD QIK L   ++++E+Q+A++ KEKKA +E  K+T E+L+AEE+KV++LNK KAKLE  LDEMEENL REQKIR DVEKAKRK+EG+LK  QE ++DLER+K +LEEQL+RK+ E+    SK E++  L+  LQRKIKELQARI ELEEDLEAER AR+KAEKA+ QLEAEL+E+S+RLEEQGGAT AQ DLNKKREAELIKLKRDLEEA +Q+EQ +  +RKKQ D  NE  DQLDQ  K K+K+E+EK +L+A+ +DL SQ+ ++ K K N EK+ K  E+ +++LQ KLDE SRQ T+AG+   R   + +E+ + LE+AESQ+ QL KAKQQL +QLEEA++NL++ESRAK+KL  ++RN  SDLDALRESLEEEQ  KSD+QRQ+ K+Q+EL       +G G ++TEE EE +R++ A++QE E ++ES K KCSQLEK+K+RLQGEIEDL++DVERANGLASQLEKKQKN DK +GEWQ KY+ESQ ELE + RE R  S +VF+LK+QLE + DQIE++RRENKNLSDEIHDLTEQLGEGGR+VHE +K RKR+E+E++ELQ ALEEAESALEQEEAK QRA LE+SQ R E +RRLAEKEEEFE TRKNHQR +ESMQASLEAEV+G+ +AM+MKKKLE DINELEV LD+ANR ++E EKNAKK+QQQ+ EM+ Q+EE  H R+++ E ++  ER+  M+ GEL++++   + +E+ RK AE E+ EA D+  E + Q++SF A KRKMEADLAAMQADLEE+ N A+QA+E+ KKA+ D+ R+F+E++QEQEH Q  EKARK  E Q+KELQ +LEEAEAN +KGGKKAL+KLEQR+RELE ELD EQ+RH ETQKN RK DRRLKE++ Q DEDKKN DR+Q+L++ LQ KIKTYKRQVEEAEEIAAVNLAKYRKIQ E+ED+EERADQAEQALQKLRAKN
Sbjct:    1 MDPSDPDFEYLGVDRKALLKEAEAGSFDSKSVAWVEDEKEGYVMADIVETSGDTVTVRLKDGNTKKIKKDDIQQVNPPKFIMAEDMADLTYLNDASVLENLRARYYHKLIYTYSGLFCVAVNPYKRYPIYSYEVAMKYKGKRRAEMPPHLFSISDNAYHNMLADRENQSILITGESGAGKTENTKKVISYFAFVTANPAKKGEEVEKKGS-LEDQIVQANPLLEAYGNAKTNRNNNSSRFGKFIRIHFGTTGKIAGADIEFYLLEKSRVTSQMKGERNFHIFYQLLSDYGKKYHDKLLVSADPALYSFINQGELTIDGVDDAEEMKLTDEAIDILGFSNDERMSLFKCTTSVVNMGEMKFKQRPREEQAEADGTAEAEKVAFLLGVNAKDLLNSFLKPKVKVGNEFVTKGQNLDQVNFAVNALAKSLYSRLFTWLVARVNKTLDTKVKRQYFIGVLDIAGFEIFEENGFEQICINYTNERLQQFFNHHMFVQEQEEYRKENIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDQTFKQKLYDNHLGKSPNFAKPKPPKAGQKEAHFELHHYAGSVPYNITGWLDKNKDPLNDTVVNLLQESKETLVAHMFAPPED---GTKKKKSGSFMTVTYTHRESLNKLMKNLMSTSPSFIRCIVPNEFKQPGVIDAHLVLHQLHCNGVLEGIRICRKGFPNRMVYSEFKQRYSILAPNVIPAGFVDGKQVTEKILDACQLSKDSYQCGNTKVFFKAGTLAELEDMRDEKLNKIISNFQAQIRGYLMRKEYKKLQDQRTALALIQRNIRKYLILRTWPWWRLYTKVKPMLNIARQEEEMRKAAEELAKMKEEFEKLEKLKKELEEQNVTLLQQKNDIFLQLQTEQDNLADSEEKVSKLILQKADMEQQIKELEERLNDEEDASKNLEEAKKKLAAEIDELKKDVEDLESTLQKAEQEKQAKDNQIKQLQSEMQQQEDQIARLNKEKKALEEQNKRTTEALQAEEDKVNHLNKLKAKLESTLDEMEENLAREQKIRGDVEKAKRKLEGDLKSTQENVDDLERVKRDLEEQLRRKDAEMANMGSKSEEDQGLINQLQRKIKELQARIAELEEDLEAERAARSKAEKARQQLEAELDEVSDRLEEQGGATAAQMDLNKKREAELIKLKRDLEEARIQNEQQVQALRKKQADAVNEITDQLDQATKLKAKVEKEKGDLKAECDDLQSQIANITKQKMNAEKNWKTCESQLAELQAKLDETSRQATDAGSQKARLSQDITELQRQLEEAESQLGQLSKAKQQLASQLEEARRNLDEESRAKSKLTSEVRNLTSDLDALRESLEEEQSAKSDMQRQIQKLQSEL--AAGVGKGQGDIKTEEFEEMKRRLTAKLQEAESDAESAKQKCSQLEKIKARLQGEIEDLMVDVERANGLASQLEKKQKNFDKTLGEWQAKYAESQAELENAQREGRGYSTDVFRLKAQLEEANDQIEAVRRENKNLSDEIHDLTEQLGEGGRSVHEADKARKRLEMEKEELQAALEEAESALEQEEAKVQRAALELSQVRSEIDRRLAEKEEEFEATRKNHQRAIESMQASLEAEVKGKADAMRMKKKLEQDINELEVALDSANRGRAEMEKNAKKFQQQVREMETQMEEDQHVRDELRENVSTAERRAQMLAGELDDLRTHLETSERARKAAELERAEASDRALELTAQSASFAAMKRKMEADLAAMQADLEEAANEAKQADERAKKAMADSARVFEEVRQEQEHTQHVEKARKQAEQQVKELQVRLEEAEANAMKGGKKALAKLEQRVRELETELDAEQRRHGETQKNYRKIDRRLKEVTMQADEDKKNYDRLQELVDQLQGKIKTYKRQVEEAEEIAAVNLAKYRKIQHEVEDAEERADQAEQALQKLRAKN 1909          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000010358.2 (pep primary_assembly:Astyanax_mexicanus-2.0:23:34206862:34242580:1 gene:ENSAMXG00000010027.2 transcript:ENSAMXT00000010358.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1769.98 bits (4583), Expect = 0.000e+0
Identity = 1029/1913 (53.79%), Postives = 1398/1913 (73.08%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            D  DP   +L    K  L+     +D KK+ W+  EKEG+IA  ++  +GDKVTVKT K  T  +K+D ++QMNPPKF    DMANLTFLN+ASV +NLR RY    IYTYSGLF                             PPH+FSISDNAY +M+++ ENQS+LITGESGAGKTENTKKVI YFANV A   K   D       LEDQI+QANPVLEA+GNAKTTRNNNSSRFGKFIRIHFG + K+AGADIE YLLEKSRVISQQ  ER+YHIFYQLLS       + LL+ ADP  + +I QG   +D +DD+EE+ LTD AF +LGF+ EEKMS++K T  IM+ G MKFKQ+ REEQA+ D T  A+KV+ L+G+N+ DL + I +P+VKVGNE+VTKGQ++DQ +YS+GALAK++Y+RMF W+V R+NKTLDTK++RQFFIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDW FIDFG+DLQACIEL+EKPMGI SILEE+C+FPKA+D T K  LYDNHLGKS NF KPK  K G  E HFEL HYAG+V YNI GWLEKNKDPLNE+VVGL   S   L+A LF   E       +KKG SF TVS  +RE LNKLM  L ST+PHF+RCIVPNEFKQ GV DA+L++HQL CNGVLEGIRICRKGFPNR+ Y EFKQRY IL PN IP+GFV+ K+ ++ IL +I LD   YR+G+TKVFF+AG LA+LED+RDE+L+ ++++ Q ++RG LMR ++KK+ ++R+AL  +QRN+RK+L LR W WWKL+TKVKP+L++ARQE+E+K   EEL    E+  +  +  KEL+E+ VTL + K+DL L L  EQDS+ADAEE+ S+L+ QK +ME +I+++++ L EEE SA  L   K+KL  ++ +LK+D+E LES+L K+E+EK   D +++SL   + ++++ + + QKE+KA +ELQ+KT + L+AEE+KV++L K  +KL   + E+E+N  +E+KIR +VEKA+RK E +LK   + LN++ER K +LEE +K++++E+N  N+K+EDE +L +TL RK+KE QARI+ELEE+LEAER  RAK EK +  L  +LE++ +RLEE GGAT AQ + NKKREAEL+KL+R+LEEA +Q E     +RKK  D   E  +Q++ LQ+ + K+E++K  ++A+I+DL++ +E++ K+K N E   + LE ++++  ++L E+ R  TE   +      ENS++ + L +A+S++NQ+ + K  L  Q +E K+ +++ES+A++     L NA  DLD ++E L+EEQEGKS++QR + K+  E+   +   +     +TEE+EE +RK+  R+QE EE +E+ +++ + LEK+K RLQGE+EDL ID+E++N  A+ L+KKQ++ DK+  EW +K  E Q ELE S +E RT   EV+KLK+  E S D +E+++++NK LSDEI DL EQLGEGG++VHE++K ++++E+ERDELQ ALEEAE++LE EE K  R QLE++Q + + +RR+ EKEEEFE TRKNHQR +ES+QASLEAE +GR EA++MKKK+E D+NE+E+ L+ AN+  SE  K+ K+ QQQ+ +MQ Q++E     E++ E  +L ER++ ++  E+EE+++  + +E++RK+ E E  +  ++ NE   QN S +  KRKMEADL  +  + EE  +  R A+E+ KKAI D TR+ +E++QEQ+H    EK +KN E  +K+LQ K+EEAE   LK GK+ + KLE R+RELE ELD EQKRHVET K  RK++RRLKE+ +Q +ED K   RMQ+L+E LQ K+K+YKRQ+EEAEE A  +L+KYRK   E++D+EERA  AE AL KLR +N
Sbjct:   11 DDVDP-MPFLAPPEKERLEAMNRPYDIKKSCWVKHEKEGFIAGEIQSDDGDKVTVKTVKNATVTIKKDDIQQMNPPKFYQASDMANLTFLNEASVLENLRSRYVYMRIYTYSGLF----------------------------FPPHLFSISDNAYHDMMMEHENQSMLITGESGAGKTENTKKVIQYFANVGATGGKPSSDSKGS---LEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFGPTAKLAGADIESYLLEKSRVISQQAAERSYHIFYQLLSGKKPELLEALLLVADPKQYVWICQGVTVVDNMDDKEELMLTDMAFDVLGFTAEEKMSIYKLTGGIMHFGNMKFKQKAREEQADVDTTEVADKVAHLMGINSGDLQKGITRPRVKVGNEFVTKGQNQDQCIYSIGALAKAIYDRMFKWMVNRINKTLDTKMQRQFFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWVFIDFGLDLQACIELLEKPMGIFSILEEQCVFPKATDVTFKTALYDNHLGKSANFQKPKGGKKGP-EVHFELIHYAGTVGYNIAGWLEKNKDPLNETVVGLYQKSSMSLLAHLFKEEEAAAGVKKQKKGSSFQTVSAFYREQLNKLMSTLRSTAPHFVRCIVPNEFKQSGVCDANLILHQLACNGVLEGIRICRKGFPNRLQYPEFKQRYYILNPNVIPKGFVDNKKASELILGSIGLDDMEYRIGHTKVFFRAGVLAKLEDMRDERLAKIMTMLQGRLRGTLMRVEFKKMLERRIALIALQRNVRKFLQLRYWGWWKLYTKVKPLLHVARQEDELKAKEEELRVALEKTAEMTEKIKELDEKLVTLSKEKSDLALALAAEQDSIADAEERCSQLMKQKMNMEEQIQDMKERLEEEEGSAMALSAQKRKLEGELMDLKRDLEGLESTLAKSEKEKQGLDSKVRSLTAELGQRDDTITRSQKERKALEELQQKTLDDLQAEEDKVNHLTKTNSKLTSQVHELEDNWEQEKKIRGEVEKARRKAEADLKMTIDNLNEMERAKIDLEEVVKKRDMEINHLNAKLEDEQSLSSTLHRKLKEHQARIEELEEELEAERAVRAKVEKQRADLSRDLEDLGDRLEEAGGATFAQIEQNKKREAELMKLRRELEEAALQSEATASALRKKHSDAMAELGEQVENLQRVRIKLEKDKQVMKAEIDDLNATVEAVQKSKLNAEAHVRKLEDSLAEANSRLAEMERSQTELNTIKIHLTAENSDLSRELGEAQSKLNQITRIKTSLTTQNDELKRQVDEESKARSAAVIGLANAQHDLDLMKEQLDEEQEGKSEMQRLISKLNAEVTTWRTKYETDAIHKTEELEETKRKLTVRLQEAEEATEAAQARAASLEKVKQRLQGEVEDLTIDLEKSNAAAAALDKKQRSFDKMTAEWSQKCEEMQLELENSQKECRTYMTEVYKLKTSYEESLDHLETVKKDNKTLSDEIRDLMEQLGEGGKSVHELQKAKRKLEVERDELQIALEEAETSLEVEEGKVVRVQLELAQVKADIDRRIHEKEEEFEITRKNHQRAIESLQASLEAEAKGRAEALRMKKKMECDLNEMEIQLEHANKNNSELVKSLKRLQQQIKDMQMQMDEDARVHEELREHYSLQERRVCLLQTEIEELRSGLEASERSRKLMEQELVDVTERHNELYSQNQSLIIIKRKMEADLTRVSNENEELISEFRSADERAKKAITDATRMAEELRQEQDHCIHLEKIKKNNELMIKDLQLKVEEAEELALKSGKRTIQKLEVRVRELESELDVEQKRHVETVKVLRKNERRLKELIFQTEEDHKTNQRMQELVEKLQNKLKSYKRQIEEAEEQANTSLSKYRKTVHELDDAEERAGNAEMALNKLRTRN 1890          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: myh7bb (myosin, heavy chain 7B, cardiac muscle, beta b [Source:ZFIN;Acc:ZDB-GENE-090311-5])

HSP 1 Score: 1743.4 bits (4514), Expect = 0.000e+0
Identity = 993/1897 (52.35%), Postives = 1380/1897 (72.75%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQ-GFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            +FD KK +WIPDEKE YI + V+E +G+KV V+T  G+   VK+D L+ MNPPKF MIEDMA LT LN+ASV  NLR+RY   +IYTYSGLFC+ VNPY+  P+Y  +V+  YKGKRR + PPHI+SI+DNAY++ML +RENQS+LITGESGAGKT NTK+VI YFA VAA  +            LEDQI++ANP +EA+GNAKT RN+NSSRFGKFIRIHFG +GK+A ADI+ YLLEKSRVI QQ GER+YHI+YQ+LS       D LLV+++P  + F +QG  T+D +DD EE+  TD A   LGF+ EEK   +K    IM+ G M+FK + REEQAEADGT  A+K S+L+G+N+ +L++ +L P+VKVGNEY+ KGQ+ +QV YS+GALAK+ Y+RMF W+V R+NKTL T + RQFFIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMF+LEQEEYK E I+W FIDFG+DLQACI+LIEKP+GI+SI+EEECMFPKA+D + KAKLYDNHLGKSPNF KPKP K  ++E HFEL HYAG VPYNI+GWLEKNKDPLNESVVG+   S   L++SLF            G    +KKG SF TVS +H+E+LNKLM NL ST PHF+RCI+PNE K PG+++  LV+HQL CNGVLEGIRICRKGFPNR++Y+EFKQRY IL P+AIP+  +V+ K+  +K+L ++ +D N Y+ G+TKVFFKAG L QLED+RDE+L+ +I++ QA  RG LMR           A+ +IQ NIR +  ++ W W  LF K+KP+L  A  E+E+    EE +KLKE  E++E  +K+LEE+ V+L+Q KNDL LQLQ EQD+LADAE++ + L+  K  ME ++KEL + L +EE  +S+L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E + ++ KEKKA  +  ++  E L+AEE+KV+ L K+K KLEQ +D++E  L +E+K+R D+E+ KRK+EG+LK + E   DLE  K +LE++LK+K+++++ AN++IEDE  LV  LQ+K KELQ R++ELEE+LEAER ARAKAEK + ++  ELEE+SE+LEE GGAT AQ +LNKKREA+ +KL+RDLEEA++ HE  +  +RKK  D+  E A+QLD LQ+ K K+E+EK E R +++D++S LE L++ K   EK  +  E   ++ + K+DEL RQL +  +   R   E++E+ + LE+ E  + QL + K  L    E+ K+ LE+ESRAK  L   L+ +  D D LRE  EEEQE KS++QR L K   E+ Q +   +     RTEE+EE ++K+  R+Q  EE  E++ +KC+ LEK K RLQ EIEDL++D+ER+N +A+ L+KKQ+  DK++ EW++K+ E+Q ELE S RESR++S E+FKLK+  E + + +E++ RENKNL +EI DLTEQ+  GG+ +HE+E+ +K ++ E+  +Q ALEEAE  LE EE+K+ R Q+E+ Q + E +++LAE++EE +  R+NHQR +ESMQ SL+AE R R EA+++KKK+E D+NE+E+ L  AN+   E +K  +  Q Q+ ++Q +++E  H+ + + EQ+A+T+R+  ++  E++E++ + +  ++ RKVAE E  EA +++N    QN++ +  K+K+E+DL+ +  +++E+    R A E+ KKAI D   + +E+K+EQ+ +   E+ + N+E  +K+LQ +L+EAE   LKGGKK + KLE R+RELE ELD EQK+  E QK  RK +RR+KE++YQ +ED+KN  RMQ LI+ LQAK+K+YKRQ E+AEE  + N+ ++RKIQ E++D+EERAD AE  + KLR + 
Sbjct:   31 AFDGKKRVWIPDEKEAYIDVEVKELDGEKVIVETRDGQILTVKEDDLQPMNPPKFDMIEDMAMLTHLNEASVLFNLRRRYSFWMIYTYSGLFCVTVNPYKWLPVYAPEVVAAYKGKRRSDAPPHIYSIADNAYNDMLKNRENQSMLITGESGAGKTVNTKRVIQYFAIVAALGEAGGKKGGT----LEDQIIEANPAMEAFGNAKTIRNDNSSRFGKFIRIHFGPTGKLASADIDIYLLEKSRVIFQQPGERSYHIYYQILSHRKPELQDMLLVSSNPFDYHFCSQGVTTVDNMDDGEELLATDHAMDTLGFTPEEKYGCYKIVGGIMHFGNMRFKVKQREEQAEADGTESADKASYLMGINSAELVKGLLHPRVKVGNEYIVKGQTVEQVTYSVGALAKATYDRMFKWIVGRINKTLYTAIPRQFFIGVLDIAGFEIFEFNNFEQMCINFTNEKLQQFFNHHMFILEQEEYKTEGIEWTFIDFGLDLQACIDLIEKPLGIMSIMEEECMFPKATDSSFKAKLYDNHLGKSPNFQKPKPDKKRKYETHFELVHYAGVVPYNISGWLEKNKDPLNESVVGIFQKSSNKLMSSLFENFVSLDSEPKPGGKEKRKKGASFQTVSQLHKENLNKLMANLRSTQPHFVRCIIPNETKNPGMMEPFLVLHQLRCNGVLEGIRICRKGFPNRILYAEFKQRYRILNPSAIPEDTYVDSKKAAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGQLEDMRDERLAEIITMLQAFCRGKLMR--------MVEAIMVIQWNIRSFYAVKNWPWMCLFFKIKPLLRSAATEKELATLKEEFQKLKEALERSEAKRKDLEERQVSLVQEKNDLSLQLQAEQDNLADAEDRCNLLIKAKIQMEAKVKELMERLEDEEEMSSSLLTKKRKLEDECAELKKDLDDLEMTLAKVEKEKHATENKVKNLVEEMAALDETILRLTKEKKALQDAHQQALEDLQAEEDKVNMLTKSKIKLEQQVDDLEGTLEQEKKVRMDLERVKRKLEGDLKLSIESAMDLENDKQQLEDRLKKKDMDMSQANARIEDEQALVLQLQKKTKELQTRVEELEEELEAERSARAKAEKQRSEVTKELEELSEKLEESGGATAAQIELNKKREADFLKLRRDLEEASLHHEATVAMLRKKHADSMTELAEQLDNLQRVKQKLEKEKVEARMEVDDIASNLEHLSRAKVTTEKMCRMFEDQFNESKAKVDELQRQLMDVTSQKARALTESAEISRRLEEREVLVMQLQRTKTSLMQNGEDMKKQLEEESRAKNALAHALQTSRHDCDLLREQYEEEQEAKSELQRALSKANAEIAQWRTKYETDAIQRTEELEEAKKKLVTRLQSSEEVIEASHAKCASLEKTKHRLQTEIEDLMMDLERSNAVAAALDKKQRTFDKVLSEWKQKFDETQSELESSQRESRSLSTELFKLKNSYEEALEHLETVNRENKNLQEEITDLTEQISNGGKTIHELEQMKKSLDQEKSNIQAALEEAEGTLEHEESKTLRIQMELVQVKTEVDKKLAERDEELDNLRRNHQRIVESMQTSLDAEARARNEAIRVKKKMEGDLNEMEIHLSHANKQAVESQKMVRHLQVQIKDLQLELDESVHRCDDLKEQVAVTDRRNSLLAAEVQELRTVLEQTDRMRKVAEHELIEATERVNLLHTQNTAVLNQKKKLESDLSMLAGEVDEALQECRNAEEKAKKAITDAAMMAEELKKEQDTSTHLERMKNNMEQTIKDLQMRLDEAEQIALKGGKKQIQKLETRVRELESELDCEQKKSGEFQKGIRKYERRIKELTYQTEEDRKNLLRMQDLIDKLQAKVKSYKRQAEDAEEQVSTNMTRFRKIQHELDDAEERADMAESQINKLRVRT 1915          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: MYH6 (myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:7576])

HSP 1 Score: 1716.82 bits (4445), Expect = 0.000e+0
Identity = 1005/1925 (52.21%), Postives = 1390/1925 (72.21%), Query Frame = 1
Query:   40 LMDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA--PAEDXXX-------XXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            LM+   P   YL    K  L+     FD KK  ++PD +E Y+  T+   +GDK T +T KG T  VK+  +   NPPKF  IEDMA  TFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA   K D    K    LEDQI+Q NP LEA+GNAKT RN+NSSRFGKFIRIHF  SGK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LL+TA+P  +++I+QGE  +  +DD +E+  TDEAF +LGF+ EEK S++K T +IM+ G MKFKQ+ REEQAEADGT + +K ++L+G+N+ DL++A+  P+VKVGNE+VTKGQ+  QV Y++GAL+KS+Y +MF W+V R+N++LDTK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+++LFA   + D+            KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ ++  +K+L ++ +D N Y+ G+TKVFFKAG L  LE++RD++L+ +I+  Q++ RG L R +++K+ ++R AL +IQ N+R ++ ++ W W KL+ K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ VTLLQ KNDL LQ+Q EQD+L DAEE+   L+  K  +E + KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++T + L++EE+KV+ L KAKAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE++K+K+ E++  NSKIEDE  L A LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  K++RDLEEA +QHE     +RKK  D+  +  +Q+D LQ+ K K+E+EKSELR +++D+ S +E + K+K NLEK  + LE  +S+ + K +E  R + +      + Q EN E+ + LE+ +S ++QL + KQ    Q+E+ K+ LE+E +AK  L   +++A  D + LRE  EEEQE K+++QR L K  +E+ Q +   +     RTEE+E+ ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE + +E+R++S E+FKLK+  E S D +E+++RENKNL +EI DLTEQ+GE G+++HE+EK RK++E E+ E+Q ALEEAE++LE EE K  RAQLE +Q + + ER+LAEK+EE E  ++N QR ++++Q+SLE+E R R EA+++KKK+E D+NE+E+ L  ANR  SE +K  K     + + Q Q+++     + + E +A+ ER+  ++  EL+E++++ +  E+ RK+AE E  +  +++     QN+S +  K+K+E D + +Q ++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQ++  ++ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K+YKR  EEAEE A  NL K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:    5 LMEEFGPAAPYLRKSDKERLEAQTRPFDMKKECFVPDAEEEYLKATITSRDGDKCTCETSKGTTVTVKECDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRTEAPPHIFSISDNAYQYMLADRENQSILITGESGAGKTVNTKRVIQYFASIAAGGPKKDTSDKKGT--LEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFAASGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSQRKPELLEMLLITANPYDYAYISQGETQVASIDDRDELMATDEAFDVLGFTQEEKNSIYKLTGAIMHYGNMKFKQKQREEQAEADGTEDTDKSAYLMGLNSADLVKALCHPRVKVGNEWVTKGQNVQQVYYAIGALSKSVYEKMFLWMVVRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDSTFKAKLYDNHLGKSNNF-QKPRIVKGKPEAHFSLVHYAGTVDYNIMNWLVKNKDPLNETVVGLYQKSTMKLLSNLFANYASADSAAEGGGGKGKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGTFIDSRKGAEKLLGSLDIDHNQYKFGHTKVFFKAGLLGTLEEMRDDRLALIITGIQSRSRGLLSRLEFQKIVERRDALLVIQWNVRAFMGVKNWPWMKLYFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVTLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQLEAKTKELTERLEDEEEMNAELVAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLTQENVMDLENDKQQLEERIKKKDFEISQLNSKIEDEQALAAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKVRRDLEEATLQHEATAATLRKKHADSVADLGEQIDNLQRVKQKLEKEKSELRLELDDVVSNMEQIVKSKTNLEKMCRTLEDQMSEYRTKYEEGQRSINDFSMQKAKLQTENGELSRQLEEKDSLVSQLTRGKQSYTQQIEDLKRQLEEEVKAKNALAHAVQSARHDSELLREQYEEEQEAKAELQRSLSKANSEVAQWRTKYETDAIQRTEELEDAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKILAEWKQKYEESQTELESAQKEARSLSTELFKLKNSYEESLDHLETMKRENKNLQEEISDLTEQIGESGKSIHELEKIRKQLEQEKSEIQSALEEAEASLEHEEGKILRAQLEFNQVKADIERKLAEKDEEMEQAKRNQQRVVDTLQSSLESETRSRNEALRIKKKMEGDLNEMEIQLSQANRQASEAQKQLKGLHGHMKDAQLQLDDALRGNDDLKENIAIVERRNNLLQAELDELRSLVEQTERGRKLAEQELLDVSERVQLLHSQNTSLLNQKKKLEGDTSQLQTEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELETEVEIEQRKASDSVKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKRSAEEAEEQANSNLGKFRKLQHELDEAEERADIAESQVNKLRAKS 1926          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000001735.2 (pep primary_assembly:Astyanax_mexicanus-2.0:9:30825677:30852786:-1 gene:ENSAMXG00000001635.2 transcript:ENSAMXT00000001735.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1711.81 bits (4432), Expect = 0.000e+0
Identity = 1008/1918 (52.55%), Postives = 1381/1918 (72.00%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXX--XXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISI 5844
            FD KK  ++PD ++ ++  +V    GDKVTV+T+ G+T   K   + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHIFSISDNAY  ML  + +  +   GESGAGKT NTK+VI YFA++AA+  K +        +G+LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LLVT +P  +SFI+QGE T+  +DD EE+  TD AF +LGF+ +EK S++K T +IM+ G MKFKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNE+VTKGQ+  QV Y++GAL+K++Y +MF W+V R+N++L+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGI+SILEEECMFPKA+D T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+++LFA       A   GK   KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PG +D  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P+AIP+G F++ ++  +K+L ++ +D   YR G+TKVFFKAG L QLE++RDE+LS +I+  QA+ RG L R +Y+K+ ++R AL +IQ N+R ++ ++ W W KLF K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+   L+  K  ME + KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E +AK+ KEKKA  E  ++  + L++EE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  NSKIEDE  ++A LQ+K+KELQAR++ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA + HE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSEL+ +++D+ S +E + K+K NLEK ++ LE  +++ +NK +E  R L +      + Q EN E+ + LE+ ES I QL + KQ    QLE+ K+ LE+E +AK  L   +++   D D LRE  EEEQE K+++QR L K   E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ EIEDL++D+ER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E S D +E+L+RENK L +EI DLTEQLGE G+ VHE+EK RK++E E+ E+Q ALEEAE +LE EE K  RAQLE +Q + + ER+L EK+EE E +++N  RT++++Q+SLE+E R R EA+++KKK+E D+NE+E+ L  ANR  +E +K  K     L + Q Q+++     + + E  A+ ER+  ++  ELEE++N+ +  E+ RK+AE E  +  +++     QN+S +  K+K+EAD   +Q ++E++    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQKR  E+ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K YKR  E+AEE A+V+L K+RK+Q E++++ ERAD AE  + K+RAK+             PGTK++I
Sbjct:   31 FDMKKECFVPDPEKEFVKASVTSREGDKVTVQTETGKTLTFKDSQILQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVIAYRGKKRSEAPPHIFSISDNAYQYMLAGKSDNEITALGESGAGKTVNTKRVIQYFASIAASGSKKEAINQNKVMQGTLEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKLASADIETYLLEKSRVTFQLKAERDYHIFYQILSNKKPEILEMLLVTQNPYDYSFISQGETTVPSIDDAEELMATDSAFDVLGFTQDEKNSVYKLTGAIMHYGNMKFKQKQREEQAEADGTEDADKSAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVQQVYYAVGALSKAVYEKMFLWMVVRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKATDATFKAKLYDNHLGKSSNF-QKPRIVKGKAEAHFALVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSSLKLLSNLFANYASADSAMGDGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMDNPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSAIPEGQFIDSRKGAEKLLGSLDIDIQQYRFGHTKVFFKAGLLGQLEEMRDERLSKIITGIQARSRGLLSRIEYQKMVERRDALLVIQWNVRAFMSVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQMEAKTKELTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDEIIAKLTKEKKALQEAHQQALDDLQSEEDKVNTLTKAKVKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQESIMDLENDKQQLEERLKKKDFEISQLNSKIEDEQAMIAQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLHHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSELKLELDDVVSSMEHIVKSKTNLEKMSRTLEDQMNEYRNKCEENQRSLNDFSTQKAKLQAENDELSRQLEEKESLIFQLTRGKQSYSQQLEDLKRQLEEEVKAKNALAHAVQSVRHDSDLLREQYEEEQEAKAELQRSLSKANAEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQDAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDMERSNAAAAALDKKQRNFDKVLSEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEESLDHLETLKRENKILQEEITDLTEQLGESGKTVHELEKVRKQLEQEKAEIQAALEEAEGSLEHEEGKILRAQLEFNQIKADIERKLTEKDEEMEQSKRNLLRTIDTLQSSLESETRSRNEALRVKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSLHANLKDCQLQLDDSQRANDDLKENTAIVERRNVLLQAELEELRNVLEQTERGRKLAEQELLDVSERVQLLHSQNTSLLNQKKKLEADTCQLQTEVEDAIQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELESEIEAEQKRSSESVKGIRKYERRIKELTYQTEEDRKNIARLQDLVDKLQLKVKAYKRAAEDAEEQASVHLGKFRKLQHELDEASERADIAESQVNKMRAKS-----------REPGTKVNI 1936          
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Match: ENSAMXT00000042907.1 (myosin heavy chain, fast skeletal muscle-like [Source:NCBI gene;Acc:103033118])

HSP 1 Score: 1709.5 bits (4426), Expect = 0.000e+0
Identity = 1009/1910 (52.83%), Postives = 1387/1910 (72.62%), Query Frame = 1
Query:   67 IYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKT-DKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPA--EDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            IYL    K  ++     FD+K   ++ D KE Y+  T++  +G KV V+  D  E + VK+D +  MNPPKF  IEDMA +T LN+ASV  NL++RY   +IYTYSGLFC  VNPY+  P+Y ++V+  Y+GK+R E PPHIFS+SDNAY  ML DRENQSVLITGESGAGKT NTK+VI YFA VA    K  +  SK +GSLEDQI+ ANP+LEAYGNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE YLLEKSRV  Q   ER YHIFYQ+++       +  L+T +P  F   +QG++T+  +DD+EE+  TD A  ILGFS++EKMS++K T ++++ G MKFKQ+ REEQAE DGT +A+KV++LLG+N+ D+++A+  P+VKVGNE+VTKGQ+  QV  ++ ALAKS+Y RMF W+V R+N+ LDTK +R FFIGVLDIAGFEIFDFN  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I WEFIDFGMDL +CIELIEKPMGI SILEEECMFPKA+D + K KLYD HLGK   F +   P  G+ EAHF L HYAG+V YNI+GWL+KNKDPLNESV+ L   S   L+A+L+ P   E  G  G KKKGGS  TVS   RE+L KLM NL ST PHF+RC++PNE K PG+++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ ++K+L +I +D + YR G+TKVFFKAG L  LE++RDEKL+SL+++ QA  RGYLMRR+Y K+ ++R ++  IQ NIR ++ ++ W W K++ K+KP+L  A  E+E+    E+  K KE+  K E  KKELEE+ V+LLQ KNDL LQ+ +E ++L+DAEE+   L+  K  +E ++KE  + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +  ++E ++K+ KEKKA  E  ++T + L+AEE+KV+ L K+K KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K + EE++K+K+ E++   SKIEDE +L A LQ+KIKELQARI+ELEE++EAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEE+ +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSE + +I+DLSS +E++ K K NLEK  + LE  +S+++ K DE  RQ+ + G    R Q EN E  + LE+ ES ++QL + KQ    Q+EE K+ +E+E +AK  L   L++A  D D LRE  EEEQE K+++QR + K  +E+ Q ++  +     RTEE+EE ++K+  R+QE EE+ E+  SKC+ LEK K RLQGE+EDL+IDVERAN LA+ L+KKQ+N DK++ EW++K+ E Q ELE + +E+R +S E+FK+K+  E + DQ+E+L+RENKNL  EI DLTEQ+GE G+++HE+EK +K +E E+ E+Q ALEEAE  LE EE+K  R QLE++Q + E +R+LAEK+EE E  ++N QR +ESMQ++L++EVR R +A+++KKK+E D+NE+E+ L  ANR  SE +K  +  Q QL + Q  +++    +E + EQ+A+ ER+  +M  E+EE++   +  E+ RKVAE E  +A +++     QN+S + TK+K+EADL  +Q +++++   AR A ++ KKAI D   + +E+K+EQ+ +   E+ +KNLE  +K+LQ +L+EAE   +KGGKK L KLE R+RELE E++ EQ+R V+  K  RK +RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  +L+K RK Q ++E++EERAD AE  + KLRAK+
Sbjct:   15 IYLRKPEKERIEAQSKPFDAKSACYVADAKELYLKGTIKSRDGGKVVVEVLDTKEERTVKEDDVSPMNPPKFDKIEDMAMMTHLNEASVLYNLKERYAAWMIYTYSGLFCATVNPYKWLPVYDAEVVAAYRGKKRMEAPPHIFSVSDNAYQFMLTDRENQSVLITGESGAGKTVNTKRVIQYFATVAVQGDKKKESSSKMQGSLEDQIIAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGTTGKLASADIETYLLEKSRVSFQLSDERGYHIFYQMMTNHKPELIEMTLITTNPYDFPMCSQGQITVASIDDKEELIATDTAIDILGFSNDEKMSIYKFTGAVLHHGNMKFKQKQREEQAEPDGTEDADKVAYLLGLNSADMLKALCYPRVKVGNEFVTKGQTVPQVYNAVNALAKSIYERMFLWMVIRINQMLDTKQQRNFFIGVLDIAGFEIFDFNSMEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIVWEFIDFGMDLASCIELIEKPMGIFSILEEECMFPKATDTSFKNKLYDQHLGKCNAF-QKPKPAKGKAEAHFSLVHYAGTVDYNISGWLDKNKDPLNESVLQLYQKSAVKLLATLYPPVVEEPKGGKGGKKKGGSMQTVSSQFRENLGKLMTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDIDHDQYRFGHTKVFFKAGLLGTLEEMRDEKLASLVTMTQALCRGYLMRREYVKMTERRDSIYTIQYNIRSFMNVKHWPWMKVYYKIKPLLKSAETEKELATMKEDFAKCKEDLAKAEAKKKELEEKMVSLLQEKNDLQLQVASESENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAAQDESISKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKSKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSEEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKAKANLEKMCRTLEDQLSEIKTKNDENVRQINDIGAQKARLQTENGEFGRQLEEKESLVSQLTRGKQAFTQQIEELKRQIEEEVKAKNALAHGLQSARHDCDLLREQFEEEQEAKAELQRSMSKANSEVAQWRSKYETDAIQRTEELEEAKKKLAQRLQEAEEQIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKFEEGQAELEGAQKEARGLSTELFKMKNSYEEALDQLETLKRENKNLQQEISDLTEQIGETGKSIHELEKAKKTVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEVDRKLAEKDEEMEQIKRNSQRVIESMQSTLDSEVRSRNDALRIKKKMEGDLNEMEIQLSHANRQASEAQKQLRNVQGQLKDAQLHLDDAVRGQEDMKEQVAMVERRNTLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADLVQVQGEVDDTVQEARNAEDKAKKAITDAAMMAEELKKEQDTSAHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVEAEQRRGVDAVKGVRKYERRVKELTYQTEEDKKNLTRLQDLVDKLQLKVKAYKRQAEEAEEQANGHLSKLRKAQHDLEEAEERADIAESQVNKLRAKS 1923          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002731.1 (pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 gene:ENSPMAG00000002428.1 transcript:ENSPMAT00000002731.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1654.03 bits (4282), Expect = 0.000e+0
Identity = 1007/1912 (52.67%), Postives = 1359/1912 (71.08%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA-----PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQR-YSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTK-------GNLEKSNKALETTVSDLQNKLDELSRQL-TEAGNVNNRNQHENS-----EMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNL---SDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KKN+++   K  +I   V+  +G K TV+T +GET VVK   + QMNPPKF  IEDMA LTFLN+ SV  NL++RY   +IYTYSGLFC+ VNPY+  P+Y+SQ +  Y+GK+R E PPHIFSISDNAY  ML DRENQSVLITGESGAGKT NTK+VI YFA++AAA  K D         LEDQIV ANP LEA+GNAKT RN+NSSRF  ++   F  S       +  +LLEKSRV  Q K ERNYHIFYQ+LS       + LLVT +P  +SFI+QG++T+ G+DD +E+  TD AF ILGF+ EEK S++K T +IM+ G M FKQ+ REEQAEADGT +A+K S+L+G+N+ DL++ +  P+VKVGNEYVTKGQ   QV YS+GALAKS+Y +MF W+V R+N++L+TK  RQ FIGVLDIAGFEIFDFN FEQICIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASDQ+ KAKLYDNHLGKS NF +      G+ EAHF L HYAG V YNI+GWL KNKDPLNE+VVGL   S   L++ LFA      A+   K G KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K+PG +D  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQR Y IL PNA+P+G F++ ++  +K+L+ + +D   Y+ G+TKVFFKAG L  LE++RD++LS +I+L Q+Q RG+L R+++ K+ ++R AL +IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM+   E+  KLKE + K+E  +KELEE++V+LLQ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE   + +   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L+AEE+KV++L K+KAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+ K ++   N  NS+IEDE  L A LQ+KIKELQARI+ELEE+LEAER ARAK EK +  +  ELEEISERLEE GGAT AQ + NKKREAE  KL+RDLEE+ +QHE     +RKK  D+  E  +QLD LQ+ K K+E+EKSEL+ +++D+ S +ES+ KTK        +  ++++ L  +   L +       +L TE G  ++ +  + +      MH T    E +++Q               +    +E +AK+ L   ++ A  D D LRE  EEEQE K+++QR L +   E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ E+ED+++DVERAN  A+ L+KKQ+  DK++ EW++K+ ESQ ELE + +E+R++S E+FKLK+  E S D +E+++RENKNL   ++EI DLTEQ+ EG + VHE+EK RK++E E+ +LQ ALEEAE++LE EE+K  RAQLE++Q + + ER+L+EK+EE E  ++N+QR +E++Q +LEAE R R EA+++KKK+E D+NE+E+ L  ANR  SE +K  K  Q Q  E Q Q+++     ++  EQ A+ ER+  +M  E+EE+++  +  E+ RK+AE E  EA +++     QN+S +  K+K+E D+  +Q ++EES    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQ+R+ ET K ARK +RR KE+SYQ +EDKKN  R+Q L++ LQ K+K YKR  EEAEE A  NL++YRK+Q E+E++EERAD AE    KLRAK 
Sbjct:   29 FDMKKNVYVNHPKCEFIKALVQSVDGGKYTVETAEGETIVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLSDRENQSVLITGESGAGKTVNTKRVIQYFASIAAAGTKRDASKGT----LEDQIVSANPALEAFGNAKTLRNDNSSRFTTYV---FVLSNVCLSVHLSLHLLEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTTNPYDYSFISQGQVTVAGMDDGDELMATDSAFDILGFTAEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQDVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQICINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWVFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGRPEAHFALMHYAGVVDYNISGWLIKNKDPLNETVVGLYQKSSLKLLSVLFANYAAADADAAKKGGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEELRDDRLSKIITLMQSQCRGFLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKNRDFMTNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQVEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDVLSNMESVVKTKVSAWRDASDAARAHRHLHLSCQRLISDFTAQKAKLQTENGAPSSTHTPQYAIETIITMH-TGTFIEQRLSQ---------------RHIKHNEVKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQEAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLSEWKQKFEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIERKLSEKDEELEQAKRNNQRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKMVQSQFKEAQLQLDDALRLGDEYKEQAAMAERRSTLMLAEVEELRSALEQTERARKLAEQELIEASERVQLLHSQNTSLINQKKKLEGDMGVLQNEVEESVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNLARLQDLVDKLQMKVKAYKRPAEEAEEQANGNLSRYRKLQHELEEAEERADIAESQANKLRAKT 1916          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005582.1 (pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 gene:ENSPMAG00000004862.1 transcript:ENSPMAT00000005582.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1640.17 bits (4246), Expect = 0.000e+0
Identity = 1003/1904 (52.68%), Postives = 1347/1904 (70.75%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLL----GASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQR-YSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQ-LGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNL---SDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMAT-----KRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KKN+++   K  +I   V+   G K TV+T +G+T VVK   + QMNPPKF  IEDMA LTFLN+ SV  NL++RY   +IYTYSGLFC+ VNPY+  P+Y+SQ +  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AAA  K D         LEDQIV ANP LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE   LEKSRV  Q K ERNYHIFYQ+LS       D LLVT +P  +SFI+QG++T+ G+DD +E+  TD A+ ILGF+ EEK S++K T +IM+ G M FKQ+ REEQAEADGT +A+K S+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N +L+TK  RQ FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASDQ+ KAKLYDNHLGKS NF +      G+ EA F L HYAG V YNI+GWL KNKDPLNE+VVGL           L A+  A   DT K GTKKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K+PG +D  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQR Y IL PNA+P+G F++ ++  +K+L+ + +D   Y+ G+TKVFFKAG L  LE++RD++LS +I+L QA++RG L R+++ K+ ++R AL +IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM+   E+  KLKE + K+E  +KELEE++V+LLQ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE   + +   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L+AEE+KV++L K+KAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+ K+ + E+N  NS+IEDE  L A LQ+KIKELQARI+ELEE+LEAER ARAK EK +  +  ELEEISERLEE GGAT AQ + NKKREAE  KL+RDLEE+ +QHE     +RKK  D+  E  +QLD LQ+ K K+E+EKSEL+ +++D+ S +ES+ KTK   +K  + L+  V + +  L E    +     V  + Q EN     T  D  + I Q + +   +   Q       ++  ++AK+ L   ++ A  D D LRE  EEEQE K+++QR L +   E+ Q +   +     RTEE+EE ++K+  R+Q+ EE  E+  +KCS LEK K RLQ E+ED+++DVERAN  A+ L+KKQ+  DK++ EW++KY ESQ ELE + +E+R++S E+FKLK+  E S D +E+++RENKNL   ++EI DLTEQ+ EG + VHE+EK RK++E E+ +LQ ALEEAE++LE EE+K  RAQLE++Q + + +R+L+EK+EE E  ++N+ R +E++Q +LEAE R R EA+++KKK+E D+NE+E+ L  ANR  SE +K  K  Q Q                       +  R  GMM    +++  +  + +K+ +VA          L+ +S++    M        + +E D+ ++Q+++EE+    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   LKGGKK L KLE R+RELE EL+ EQ+R+ ET K ARK +RR KE+SYQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  NL++YRK+Q E+E++EERAD AE    KLRAK 
Sbjct:   29 FDMKKNVYVNHPKCEFIKALVQSVEGGKYTVETAEGQTVVVKDVDVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISDNAYQYMLTDRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKRDTSKGT----LEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIE--TLEKSRVTFQLKAERNYHIFYQILSQRKPELLDMLLVTTNPYDYSFISQGQVTVAGLDDGDELMATDSAYDILGFTGEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRIN-SLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGKLEADFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLALLFANYAAVDADTTKKGTKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRQYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARLRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKKFDFEMNTLNSRIEDEQALAAQLQKKIKELQARIEELEEELEAERAARAKVEKQRADVARELEEISERLEEAGGATAAQIEFNKKREAEFQKLRRDLEESTLQHEATASALRKKHADSVAELGEQLDNLQRVKQKLEKEKSELKMELDDIVSNMESVVKTKEISQKRLRVLDFCVIESRMSLIESQESVDSWNRVALKLQTENGAPSGTHTDTGALIQQRVQQRHIKNNEQFAHLPHPVQASAKAKSALAHAVQAARHDCDLLREQYEEEQEAKAELQRALSRANAEVAQWRTKYETDAIQRTEELEEAKKKLVQRLQDAEESVEAANAKCSSLEKTKQRLQNELEDMMVDVERANAAAAALDKKQRTFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKLKNAYEESLDHLETMKRENKNLQACTEEISDLTEQMSEGAKTVHELEKLRKQLEQEKVDLQAALEEAEASLEHEESKILRAQLELNQMKADIDRKLSEKDEELEQAKRNNLRAVETLQTALEAETRSRNEALRIKKKMEGDLNEMEIQLSHANRSASEAQKQLKIVQAQFK---------------------VRGRPTGMMELSYDKIIIIIVNHDKSTEVA---------FLSHYSMRMHVIMPPLQIIIIKXLEGDMGSLQSEVEEAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQHRLDEAEQIALKGGKKQLQKLEARVRELENELEAEQRRNAETVKGARKYERRAKELSYQTEEDKKNMARLQDLVDKLQMKVKAYKRQSEEAEEQANGNLSRYRKLQHELEEAEERADIAESQANKLRAKT 1894          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003821.1 (pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 gene:ENSPMAG00000003267.1 transcript:ENSPMAT00000003821.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1630.54 bits (4221), Expect = 0.000e+0
Identity = 944/1905 (49.55%), Postives = 1322/1905 (69.40%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTD--EAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP-----AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLA---EMXXXXXXXXXXXXXXXXXLALTERKLGMMHGE----LEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
             FD KK  ++ D K  ++   ++ + G KVTV T+ G+T  VK+  + QMNPPKF  IEDMA LTFLN+ SV  NL++RY   +IYTYSGLFC+ +NPY+  P+Y   V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA           KKG+LEDQIV+ANP++EA+GNAKT RN+NSSRFGKFIRIHFG +GK++ ADIE YLLEKSRV  Q   ERNYHIFYQ+ S       + LL+T +P  + FI+QGE+T+  +DD +E+  TD   A  ILGF+++EK+S++K T ++M+ G MKFKQ+ REEQAE DG  +A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV  S+GALA+S++ +MF W+V R+N+TL TK+ RQ FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE IDW FIDFGMDLQACI+LIEKPMGI+SILEE+CMFPKA+DQT K KLYD HLGK+  F +   P  G+HEAHF L HYAG+V YNI+GWLEKNKDPLN+SVV L   S   ++A+++A      ++   K G KKKG SF TVS +HRE+LNKLM NL +T PHF+RCI+PNE K PG +D +LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY +L PNAIP+G F++ K+  +K++ +++LD   Y+ G+TKVFF+AG L  LE++RD++LS L++  QA  RGYL R ++KK+ ++R +L +IQ NIR ++ ++ W W  L+ K+KP+L  A  E+EM    EE  K KE  EK+E  +KELEE+ ++++Q KNDL +Q+Q+ +++L DAEE+  +L+  K  +EG+IKE+++ + EEE   + +   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   +E ++K+ KEKKA  E  ++T + L+AEE+KV++L KAKAKLEQ +D++E +L +E+K+R DVE+ KRK+EG+LK  QE L DLE  K +L+E+LK+                     L   + ++  R++E                                    GGAT A  ++NKKREAE  KL+RDLEEA +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSE + +++DLSS LE + K K NLEK  + +E  +++++ K +E  R + +      R   EN E+ + LE+ E  + QL + K     Q+E+ K+ LE+E +AK  L   +++A  D D LRE  +EEQE K ++QR + K   E+ Q +   +     +TEE+EE ++K+  R+QE EE+ E++ SKC+ LEK K RL GE+EDL+IDVERA+  A+ L+KKQK   K++ EW++KY ESQ ELE S +ESR++S EVFKLK+  E + D +E+L+RENKNL +EI DLTEQLGE G+ +HE+EK+RK++E E+ E+Q ALEEAE++LE EE K  R QLE++Q + + +R++AEK+EE +  ++++QRT+ESMQASL+AE + R EA+++KKK+E D+NE+E+ L+ ANR  +E +K+ +  Q Q+    E++ Q         + +  +    + L +        +  + NM  H      +              +S QN+S + TKRK+E D+  +Q + EE+   +R A+E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ++L+EAE   +KGGKK + KLE R+RELE ELD EQ+R  ET K ARK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+KTYKRQ EEAEE A  NL+KYRK+Q E+E+++ERAD AE  + KLRA++
Sbjct:   28 PFDMKKECYVDDPKVEFVKAIIKSSEGGKVTVDTENGQTVTVKESQVHQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTINPYKWLPVYDPIVVAGYRGKKRQEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAALGDVTKKKEESKKGTLEDQIVEANPLMEAFGNAKTVRNDNSSRFGKFIRIHFGATGKLSSADIETYLLEKSRVTFQLPTERNYHIFYQIESQKKPELLEMLLITNNPYDYVFISQGEITVPSIDDGDELMATDVQSAIDILGFTNDEKLSIYKVTGALMHYGNMKFKQKQREEQAEPDGNEDADKAAYLMGLNSADLLKGLCYPRVKVGNEYVTKGQTVQQVHNSVGALARSVFEKMFLWMVIRINETLATKLARQHFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIDWVFIDFGMDLQACIDLIEKPMGIMSILEEQCMFPKANDQTFKEKLYDQHLGKN-QFFQKPKPSKGKHEAHFSLGHYAGNVDYNISGWLEKNKDPLNDSVVQLYQKSSLKMLAAVYATYAGADSDSGSKGGKKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCIIPNETKTPGTMDNNLVMHQLRCNGVLEGIRICRKGFPNRIVYGDFKQRYRVLNPNAIPEGQFMDSKKACEKLMASLELDDTQYKFGHTKVFFRAGLLGTLEEMRDDRLSLLLTRTQALARGYLSRVEFKKMLERRESLIIIQYNIRAFMGVKNWPWMNLYFKIKPLLKSAESEKEMANMKEEFIKTKEALEKSEARRKELEEKMISVVQDKNDLLIQVQSSEETLNDAEERCDQLIKTKIQLEGKIKEIQERVEEEEEMNAEITAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAVLDENVSKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKAKAKLEQQVDDLEGSLEQEKKVRMDVERTKRKMEGDLKLAQESLMDLENDKQQLDEKLKK------------------CVLLSHLVPQISERLEE-----------------------------------AGGATSAHIEMNKKREAEF-KLRRDLEEATLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEFKMEVDDLSSNLEQVTKAKVNLEKLCRTIEDQLAEVKTKEEEQIRSINDINTQRARLLAENGELSRKLEEKEVLVVQLSRGKLSYTQQVEDLKRQLEEEIKAKNALAHAVQSARHDCDLLREQFDEEQEAKGELQRAMSKANAEVAQWRTKYETDAIQKTEELEEAKKKLAVRLQEAEEQVEASNSKCASLEKTKQRLLGEVEDLMIDVERAHSAAAALDKKQKAFGKVLSEWKQKYEESQSELEASQKESRSLSTEVFKLKNAYEETLDHLETLKRENKNLQEEISDLTEQLGESGKALHEVEKSRKQLEQEKLEIQAALEEAEASLEHEEGKILRIQLELNQVKADIDRKIAEKDEELDQLKRSNQRTVESMQASLDAETKSRNEALRLKKKMEGDLNEMEIQLNHANRQAAESQKHLRNVQGQIKKYLEVRTQHLAHAKSTSRNTVTVYCCAKGLNLRPLRALTIIPCVCNMLYHCSVWAYI--------------YSRQNTSLINTKRKLEGDIVQLQNECEEAIQESRNADEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTVKDLQNRLDEAEQIAMKGGKKQIQKLETRVRELESELDSEQRRIAETIKGARKYERRVKELTYQAEEDRKNNLRLQDLVDKLQLKVKTYKRQSEEAEEQANTNLSKYRKLQHELEEADERADIAESQVNKLRARS 1863          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004078.1 (pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 gene:ENSPMAG00000003722.1 transcript:ENSPMAT00000004078.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 614/1054 (58.25%), Postives = 794/1054 (75.33%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKR 3258
            FD KKN+++   K  ++   V+   G K TV+T++GET  VK   + QMNPPKF  IEDMA LTFLN+ SV  NL++RY   +IYTYSGLFC+ VNPY+  P+Y+SQ +  Y+GK+R E PPHIFSIS         DRENQS+LITGESGAGKT NTK+VI YFA++AAA  K D         LEDQIV ANP LEA+GNAKT RN+NSSRFGKFIRIHFGT+GK+A ADIE   LEKSRV  Q K ERNYHIFYQ+LS       + LLVT++P  ++FI+QG++T+ G+DD +E+  TD A+ ILGF  EEK S++K T +IM+ G M FKQ+ REEQAEADGT +A+K S+L+G+N+ DL++ +  P+VKVGNEYVTKGQ+  QV YS+GALAKS+Y +MF W+V R+N++L+TK  RQ FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACIELIEKPMGI+SILEEECMFPKASDQ+ KAKLYDNHLGKS NF +      G+ EAHF L HYAG V YNI+GWL KNKDPLNE+VVGL   S   L+ASLFA       A DT K G KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K+PG +D  LVMHQL CNGVLEGIRICRKGFP+R++Y +F  RY IL PNA+P+G F++ ++  +K+L+ + +D   Y+ G+TKVFFKAG L  LE++RD++LS +I+L QA+ RG L R+++ K+ ++R AL +IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM+   E+  KLKE + K+E  +KELEE++V+LLQ KNDL +Q+Q EQD++ADAEE+  +L+  K   EG+IKEL + L EEE   + +   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L+AEE+KV++L K+KAKLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K +LEE+ K+
Sbjct:   29 FDMKKNVYVTHPKCEFVKALVQSVEGGKYTVETEEGETVTVKDADVMQMNPPKFDKIEDMAMLTFLNEPSVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYSSQCVNAYRGKKRQEAPPHIFSISLYISDLHSADRENQSILITGESGAGKTVNTKRVIQYFASIAAAGTKRDASKGT----LEDQIVSANPALEAFGNAKTLRNDNSSRFGKFIRIHFGTTGKLASADIE--TLEKSRVTFQLKAERNYHIFYQILSQRKPELLEMLLVTSNPYDYAFISQGQVTVAGLDDGDELMATDSAYDILGFVPEEKASVYKLTGAIMHFGNMHFKQKQREEQAEADGTEDADKASYLMGLNSADLIKGLCHPRVKVGNEYVTKGQNVQQVSYSIGALAKSVYEKMFNWMVVRINQSLETKAPRQHFIGVLDIAGFEIFDFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIELIEKPMGIMSILEEECMFPKASDQSFKAKLYDNHLGKSNNF-QKPRIVKGKPEAHFALVHYAGVVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLASLFANYAGADSAADTSKKGAKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNEEKKPGAMDNALVMHQLRCNGVLEGIRICRKGFPSRILYGDFTHRYRILNPNAVPEGQFMDSRKSAEKLLSTLDIDHTQYKFGHTKVFFKAGLLGTLEEMRDDRLSKIITLLQARCRGLLSRKEFAKIIERRDALLVIQYNIRAFMGVKNWPWMKLFFKIKPLLKSAETEKEMQNMKEDFLKLKEAYAKSEARRKELEEKSVSLLQEKNDLAMQVQAEQDNIADAEERCEQLIKSKISQEGKIKELTERLEEEEEMNAEVTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQAEEDKVNSLTKSKAKLEQQVDDLEGSLEQEKKVRMDLERAKRKLEGDLKLTQETIMDLENDKQQLEEKSKK 1075          
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005411.1 (pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 gene:ENSPMAG00000004885.1 transcript:ENSPMAT00000005411.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1120.53 bits (2897), Expect = 0.000e+0
Identity = 587/1063 (55.22%), Postives = 775/1063 (72.91%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDK-VTVK-TDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLV--DRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLY-------SLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-----APAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLK 3255
             FD KKN W+ DEKEG++   +++ +GD  V+VK T   E   VK+D +++MNPPKF  IEDMANLTFLN+ASV +NL++RY K  IYTYSGLFC+ +NPY+  PIY S+V   Y+GK+R E+PPH+FSISDNAYS+ML+  D+ NQS+LITGESGAGKTENTKKVI YFAN+   +K+ D         LEDQI+QANPVLEA+GNAKTTRNNNSSRFGKFIRIHF  SGK++GADIE YLLEKSRVISQQ  ER YHIFYQLLS    +  +++ +  +P  ++ I+QG  +++ +DD EEM LTDEAF +LGF+ EEKMSL+K T  IM+ G MKF+Q+PREEQAE DGT  A++V+ L G+++ +L + I +PKVKVGNEYV K Q+ DQV +       S+GALAK++Y+RMF WLV RVNKTLDT   RQ+FIGVLDIAGFEIF+FN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFG+DL ACI+L+EKPMGI SILEE+C+FPKA+D T KA +YDNHLGKS  F KPK  K    EA FEL HYAG+V YN  GWLEKNKDPLNE+VV L   S   L++ LF     A A   G    +KKG +F TVS  +RE LNKLM  L STSPHF+RCIVPNEFK+ GVVDAHL++HQL CNGVLEGIRICRKGFPNR +Y EF QRYSI+   A  +   + K +T+K+L +  L  + YR+G TKVFF+AG L +LED RD+ +   I+  QA  RG + RR ++K+ D+R A+ +IQ N+R +L LR W W++L+TKV+PM    ++EEE KK  EE+++  ++ EK  +  KEL E+  TL   +N L  QL  E+    DA+ +V+ L  Q+ ++EGR+ EL   L +EE + + L   +++L  ++ +LK +VE LE S+ K E+EK A + ++++  + V  ++E + K+QKEKK  +E  + T + L+ E++K+++L ++  K +  + E+E+ L +E+K+R +VEKAKRK+E +L+   + LN++ER K E+EE +K
Sbjct:   28 PFDIKKNCWVKDEKEGFLQALIQDDHGDNTVSVKFTVNNEIAKVKKDIVQEMNPPKFEQIEDMANLTFLNEASVLNNLKERYVKMRIYTYSGLFCVTINPYKWLPIYGSRVAKMYRGKKRNEVPPHLFSISDNAYSDMLITADKANQSMLITGESGAGKTENTKKVIQYFANIGGGTKQIDQSKQGS---LEDQIIQANPVLEAFGNAKTTRNNNSSRFGKFIRIHFAVSGKLSGADIETYLLEKSRVISQQPAERGYHIFYQLLSGKVPNLLEEIGLVNNPKEYASISQGVTSVENMDDAEEMMLTDEAFDVLGFTPEEKMSLYKLTGGIMHFGNMKFRQKPREEQAEVDGTEVADRVASLAGIDSSELQKGITRPKVKVGNEYVQKNQNMDQVYHLPQKCMSSIGALAKAIYDRMFKWLVARVNKTLDTTKPRQYFIGVLDIAGFEIFEFNSFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGINWVFIDFGLDLAACIDLLEKPMGIFSILEEQCVFPKATDATFKAAMYDNHLGKSAPFQKPKAGKKAGQEATFELVHYAGTVGYNTQGWLEKNKDPLNETVVSLFQNSSMPLLSVLFKEEEAADASSAGAKQKQKKGSAFQTVSVFYREQLNKLMATLHSTSPHFVRCIVPNEFKKSGVVDAHLILHQLACNGVLEGIRICRKGFPNRTLYPEFVQRYSIINLLA-GKTETDPKAITEKVLKSTNLVEDEYRIGFTKVFFRAGVLGKLEDFRDDCICRFITKLQASCRGKVFRRDFQKVLDKRDAMVIIQSNVRSFLQLRHWPWFRLYTKVRPMCIQLKEEEERKKKEEEMKRALQDAEKMVEDLKELTERVATLETERNALQEQLDAERGKKGDAQGRVTSLDRQRKELEGRVAELNARLEDEERTTTELTGRRRRLENEVQDLKIEVESLEGSVAKLEKEKKALENKVRTQTEEVNLRDETIVKLQKEKKQLEEANQATLDDLQIEQDKLAHLQRSNNKSQNKIAELEDLLDQEKKLRVEVEKAKRKLESDLRSTVDSLNEMERHKLEMEEVIK 1086          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO1 (Type II myosin heavy chain; required for wild-type cytokinesis and cell separation; localizes to the actomyosin ring; binds to myosin light chains Mlc1p and Mlc2p through its IQ1 and IQ2 motifs respectively [Source:SGD;Acc:S000001065])

HSP 1 Score: 652.129 bits (1681), Expect = 0.000e+0
Identity = 431/1144 (37.67%), Postives = 647/1144 (56.56%), Query Frame = 1
Query:  109 GDSFDSKKNMWIPDEKEGYIA--ITVEETNGDKVTVKTDK-------GETKV-----VKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKR------------RGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXX--XXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTA----DPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEK---PMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXX------------XXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAP-NAIPQGF-----VEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQ----YKKLQDQRVALSLIQRNIRKY-LVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQN---VTLLQAKNDLFLQLQTEQDSLADAEE-----KVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSE---LEEQLKRKEIELNGANSKIEDESNLVATLQRK 3333
            G S  S   +WIPDEKE ++   +   + N +K T + ++         T+V     V+   +  +NP  F  +E+M+ LT LN+ SV  NL +RY  +LIYTYSGLF +A+NPY    +Y+   I  Y  K               ++PPHIF+I++ AY N+L + ++QS+L+TGESGAGKTENTKK++ Y A++ + S  +    S      S E +I+Q+NP+LE++GNA+T RNNNSSRFGKFI+I F   G I GA IE+YLLEKSR++ Q   ERNYHIFYQLLS    S    L + +    D  + S  NQ    I G++D E  K    A +I+GFS ++   +F+    I+ +G ++F    R EQA       A  +   LGV+ KD   AIL+P+ K G E+V++ ++  Q  + L AL+++LY R+F ++V  +NK LD       +IG+LDIAGFEIF+ N FEQ+CINYTNE+LQQFFN+HMFVLEQ EY KE I W++ID+G DLQ  I+LIE    P G+L +L+EE + PK++D++  +KL       S  F      K  + +  F L HYAG V Y + GWL KNKDPLN++++ LL +S+  +++ LF P  +                    +  +F T S  HRE    L+  L ST PHF+RCI+PN  K+    +  L++ QL CNGVLEGIR+ R+G+PNR+ + EF QRY IL P N+    F        KQ  + +LT++QLDT +Y++GNTK+FFKAG LA LE  +D KL++++    A IRGY +R++     +KL+  RV    I    R Y  +++   W+ LF ++KP+L  +      KK  E++ KLK + ++ E  KK LEE+N   V  L+   DL   L  E+++L   E      K S   LQK   +  + E ++   E+   A  LEEA +K+      L++ + + E++L+K   +     +QI  LN ++ +++   + +++ K   +   K+ ++ + ++EE++ + N   +  E+ LD     L +   I      A  +++  + +N +L +  E  K E   L  QLK KE EL     KI++    +AT  ++
Sbjct:    4 GQSCSSNMIVWIPDEKEVFVKGELMSTDINKNKFTGQEEQIGIVHPLDSTEVSNLVQVRISDVFPVNPSTFDKVENMSELTHLNEPSVLYNLEKRYDCDLIYTYSGLFLVAINPYHNLNLYSEDHINLYHNKHNRLSKSRLDENSHEKLPPHIFAIAEEAYENLLSEGKDQSILVTGESGAGKTENTKKILQYLASITSGSPSNIAPVSGSSIVESFEMKILQSNPILESFGNAQTVRNNNSSRFGKFIKIEFNEHGMINGAHIEWYLLEKSRIVHQNSKERNYHIFYQLLSGLDDSELKNLRLKSRNVKDYKILSNSNQD--IIPGINDVENFKELLSALNIIGFSKDQIRWIFQVVAIILLIGNIEFVS-DRAEQASFKNDVSA--ICSNLGVDEKDFQTAILRPRSKAGKEWVSQSKNSQQAKFILNALSRNLYERLFGYIVDMINKNLDHGSATLNYIGLLDIAGFEIFENNSFEQLCINYTNEKLQQFFNNHMFVLEQSEYLKENIQWDYIDYGKDLQLTIDLIESKGPPTGVLPLLDEEAVLPKSTDESFYSKLISTWDQNSSKF------KRSRLKNGFILKHYAGDVEYTVEGWLSKNKDPLNDNLLSLLSSSQNDIISKLFQPEGEKSSSAGVEANISNQEVKKSARTSTFKTTSSRHREQQITLLNQLASTHPHFVRCIIPNNVKKVKTFNRRLILDQLRCNGVLEGIRLAREGYPNRIAFQEFFQRYRILYPENSTTTTFSSKLKASTKQNCEFLLTSLQLDTKVYKIGNTKLFFKAGVLADLEKQKDVKLNNIMIKLTATIRGYTVRKEITYHLQKLKKTRV----IGNTFRLYNRLVKEDPWFNLFIRIKPLLTSSNDMTRTKKFNEQINKLKNDLQEMESKKKFLEEKNQKTVNELENTQDL---LNQEKENLRKNESLLNRVKTSSETLQKQ-FDDLVSEKDEISREKLEVAQNLEEAHQKIQG----LQETIREREATLEKLHSKNNELIKQISDLNCDISKEQSSQSLIKESKLKLENEIKRLKDVINSKEEEIKSFNDKLSSSEEDLDIKLVTLEKNCNI------AMSRLQSLVTENSDLRSKNENFKKEKAALNNQLKNKESELLKMKEKIDNHKKELATFSKQ 1118          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO2 (Type V myosin motor involved in actin-based transport of cargos; required for the polarized delivery of secretory vesicles, the vacuole, late Golgi elements, peroxisomes, and the mitotic spindle; MYO2 has a paralog, MYO4, that arose from the whole genome duplication [Source:SGD;Acc:S000005853])

HSP 1 Score: 522.316 bits (1344), Expect = 3.194e-156
Identity = 312/832 (37.50%), Postives = 473/832 (56.85%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITV---EETNG---------DKVTVKTDKGETKVVKQDSLEQM-NPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFP-IYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQG-ELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTL-DTKVKRQF--FIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSF-----------------MTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDK--------ILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLV 2481
            SF+     W P ++ G+I   V   E  +G         D   V  D  +    K  SL  + NPP     ED+ +L++LN+ +V   ++QRY +  IYTYSG+  IA NP+ R   +YT  +I  Y GKRRGE+ PH+F+I++ AY  M  D++NQ+++++GESGAGKT + K ++ YFA+V   +        +   + E +I+  NP++EA+GNAKTTRN+NSSRFGK++ I F     I GA I  YLLE+SR++ Q   ERNYHIFYQL++       ++L +T D + + ++NQG +  I+G+DD +E K+T +A +++G + E +  +FK   +++++G ++ K+   +    AD     +    LLG++A +  + + K ++   +E +    +  Q L +  ++AK +Y+ +F WLV  +N  L +  V  Q   FIGVLDI GFE F+ N FEQ CINY NE+LQQ FN H+F LEQEEY KE I+W FI+F  D Q CI+LIE  +GILS+L+EE   P  SD++   KLY   L KSP       P+ GQ    F + HYA  V Y++ G++EKN+D +++  + +L AS    + ++    E   K   + K                      T+  M ++SL +LM  + ST+ H+IRCI PN  K+    D  +V+ QL   GVLE IRI   GFP+R  + EF  RY IL P+       + K+ T++        IL A   D + Y++GNTK+FFKAG LA LE +R  K+ + I + Q +IR    R+QY ++     A+  +Q NI+ +++
Sbjct:    2 SFEVGTRCWYPHKELGWIGAEVIKNEFNDGKYHLELQLEDDEIVSVDTKDLNNDKDQSLPLLRNPPILEATEDLTSLSYLNEPAVLHAIKQRYSQLNIYTYSGIVLIATNPFDRVDQLYTQDMIQAYAGKRRGELEPHLFAIAEEAYRLMKNDKQNQTIVVSGESGAGKTVSAKYIMRYFASVEEENSATVQHQVEMSET-EQKILATNPIMEAFGNAKTTRNDNSSRFGKYLEILFDKDTSIIGARIRTYLLERSRLVYQPPIERNYHIFYQLMAGLPAQTKEELHLT-DASDYFYMNQGGDTKINGIDDAKEYKITVDALTLVGITKETQHQIFKILAALLHIGNIEIKKTRNDASLSAD-EPNLKLACELLGIDAYNFAKWVTKKQIITRSEKIVSNLNYSQALVAKDSVAKFIYSALFDWLVENINTVLCNPAVNDQISSFIGVLDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFN-DNQPCIDLIENKLGILSLLDEESRLPAGSDESWTQKLYQT-LDKSPTNKVFSKPRFGQ--TKFIVSHYALDVAYDVEGFIEKNRDTVSDGHLEVLKASTNETLINILEGLEKAAKKLEEAKKLELEQAGSKKPGPIRTVNRKPTLGSMFKQSLIELMNTINSTNVHYIRCIKPNADKEAWQFDNLMVLSQLRACGVLETIRISCAGFPSRWTFEEFVLRYYILIPHEQWDLIFKKKETTEEDIISVVKMILDATVKDKSKYQIGNTKIFFKAGMLAYLEKLRSNKMHNSIVMIQKKIRAKYYRKQYLQISQ---AIKYLQNNIKGFII 823          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO4 (Type V myosin motor involved in actin-based transport of cargos; required for mRNA transport, including ASH1 mRNA, and facilitating the growth and movement of ER tubules into the growing bud along with She3p; MYO4 has a paralog, MYO2, that arose from the whole genome duplication [Source:SGD;Acc:S000000027])

HSP 1 Score: 505.753 bits (1301), Expect = 3.395e-151
Identity = 298/837 (35.60%), Postives = 474/837 (56.63%), Query Frame = 1
Query:  115 SFDSKKNMWIPDEKEGYIAITVEETNGDKVT----VKTDKGETKVVKQDSLEQ----------MNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFP-IYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQ-GELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTL-DTKVKRQ----FFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLY-------DNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF---------APAE---DXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQV--------TDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLV 2481
            SF+     W P +++G+I   V + +  + T    +K + GET  ++ +S E            NPP     +D+  L++LN+ +V   +++RY    IYTYSG+  IA NP+ +   +Y+ ++I  Y  KR+ E+ PH+F+I++ AY  M+ ++ NQ+V+++GESGAGKT + K ++ YFA+V  ++ ++ +    +   +E QI+  NP++EA+GNAKTTRN+NSSRFGK+++I F  +  I G+ I  YLLEKSR++ Q + ERNYHIFYQ+L    +    +L +++ P  + + NQ G+  I G+D+  E K+T +A S++G + E ++ +FK    ++++G ++ K   R + + +      +    LLG++  +  + I+K ++   +E +    + +Q L +  ++AK +Y+ +F WLV  +NKTL D ++ +Q     FIG+LDI GFE F+ N FEQ CINY NE+LQQ FN H+F LEQEEY KE I+W FI+F  D Q CI+LIE  +GILS+L+EE   P  SD++  +KLY        N +   P FG          +  F + HYA  V Y + G++EKN+D ++   + +  A+   +   +          AP E   +       +      T+  M ++SL +LM  + ST+ H+IRCI PN  K+P   D  +V+ QL   GVLE IRI   GFP+R  + EF QRY +L   ++  G +    +           IL A   D+  Y++GNTK+FFKAG LA LE +R  K++ +  + Q +IR    R QY +  +   ++   Q  IR  LV
Sbjct:    2 SFEVGTKCWYPHKEQGWIGGEVTKNDFFEGTFHLELKLEDGETVSIETNSFENDDDHPTLPVLRNPPILESTDDLTTLSYLNEPAVLHAIKKRYMNGQIYTYSGIVLIAANPFDKVDHLYSREMIQNYSSKRKDELEPHLFAIAEEAYRFMVHEKANQTVVVSGESGAGKTVSAKYIMRYFASVQESNNREGEVEMSQ---IESQILATNPIMEAFGNAKTTRNDNSSRFGKYLQILFDENTTIRGSKIRTYLLEKSRLVYQPETERNYHIFYQILEGLPEPVKQELHLSS-PKDYHYTNQGGQPNIAGIDEAREYKITTDALSLVGINHETQLGIFKILAGLLHIGNIEMKM-TRNDASLSSEEQNLQIACELLGIDPFNFAKWIVKKQIVTRSEKIVTNLNYNQALIARDSVAKFIYSTLFDWLVDNINKTLYDPELDQQDHVFSFIGILDIYGFEHFEKNSFEQFCINYANEKLQQEFNQHVFKLEQEEYVKEEIEWSFIEFS-DNQPCIDLIENKLGILSLLDEESRLPSGSDESWASKLYSAFNKPPSNEVFSKPRFG----------QTKFIVSHYAVDVEYEVEGFIEKNRDSVSLGHLDVFKATTNPIFKQILDNRELRSDDAPEEQNTEKKIMIPARLSQKKPTLGSMFKKSLGELMAIINSTNVHYIRCIKPNSEKKPWEFDNLMVLSQLRACGVLETIRISCAGFPSRWTFDEFVQRYFLLTDYSLWSGILYNPDLPKEAIVNFCQSILDATISDSAKYQIGNTKIFFKAGMLAFLEKLRTNKMNEICIIIQKKIRARYYRLQYLQTME---SIKKCQSQIRSLLV 819          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO5 (One of two type I myosin motors; contains proline-rich tail homology 2 (TH2) and SH3 domains; MYO5 deletion has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO5 has a paralog, MYO3, that arose from the whole genome duplication [Source:SGD;Acc:S000004715])

HSP 1 Score: 403.29 bits (1035), Expect = 1.007e-117
Identity = 254/746 (34.05%), Postives = 397/746 (53.22%), Query Frame = 1
Query:  286 IEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSL------GALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE--KPMGILSILEEECMFP----KASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAG-TLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRK 2472
            + D+  L+ ++D ++ +NL++R+    IYTY G   I+VNP+R   IYT  V+ +YKGK R E+PPH+F+I+++ Y NM    ENQ V+I+GESGAGKTE  K+++ Y A             ++  G ++D ++  NP+LE++G AKT RNNNSSR GK++ I F    +    +I  YLLEK RV+SQ K ERN+HIFYQ       +Y     V            G ++ + +DD ++ + T +A  ++G   EE+  +F+   +I+ +G + F +   E  A+   T+  + V++LL ++++ L++++++ ++   N  + +G      L  +       ALAK++YN +F W+V+RVNK+L      +  IG+LDI GFEIF+ N FEQICINY NE+LQQ F       EQE Y++E I W  I +  D +   +LIE  +P GI + + +          A+DQ    +L  N    +P+F              F + HYAG V Y+I G  +KNKD L + +V L+G +    +A++F    D          G  +       +S N L++ L    P +IR I PNE K P   D   V+HQ+   G+ E +RI R GF  R ++ +F +R+ +L+P+    G    +  T   +  I  D+++    Y+LG T VF K   TL  LE +RD    ++ +  Q   R +L RR          A + IQR IR+
Sbjct:   38 VSDLTLLSKISDEAINENLKKRFLNATIYTYIGHVLISVNPFRDLGIYTDAVMNEYKGKNRLEVPPHVFAIAESMYYNMKSYNENQCVIISGESGAGKTEAAKRIMQYIA-------AASSTHTESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNNQFEPCAGNITNYLLEKQRVVSQIKNERNFHIFYQFTKGASDAYRQTFGVQKPEQYVYTAAAGCISAETIDDLQDYQETLKAMRVIGLGQEEQDQIFRMLAAILWIGNVSFIEN-EEGNAQVRDTSVTDFVAYLLQIDSQLLIKSLVE-RIMETNHGMKRGSVYHVPLNIVQADAVRDALAKAIYNNLFDWIVSRVNKSLQAFPGAEKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKSEQETYEREKIQWTPIKY-FDNKVVCDLIEARRPPGIFAAMNDSVATAHADSNAADQAFAQRL--NLFTTNPHFDLRSNK--------FVIKHYAGDVTYDIDGITDKNKDQLQKDLVELIGTTTNTFLATIFPDTVDRESKRRPPTAGDKII------KSANDLVETLSKAQPSYIRTIKPNETKSPNDYDDRQVLHQIKYLGLQENVRIRRAGFAYRQVFEKFVERFYLLSPHCSYAGDYTWQGDTLDAVKYILQDSSIPQQEYQLGVTSVFIKTPETLFALEHMRDRYWHNMAARIQRAWRRFLQRRI--------DAATKIQRTIRE 749          
BLAST of Myosin heavy chain vs. Ensembl Yeast
Match: MYO3 (One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization; MYO3 has a paralog, MYO5, that arose from the whole genome duplication [Source:SGD;Acc:S000001612])

HSP 1 Score: 400.208 bits (1027), Expect = 2.178e-116
Identity = 265/785 (33.76%), Postives = 409/785 (52.10%), Query Frame = 1
Query:  208 VKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQ------SKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE--KPMGILSILEEECMFP----KASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNL----YRLGNTKVFFKAG-TLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIR------KYLVLRTW 2493
            VK  K  +  +K+ + +  N  K + I D+  L+ ++D S+ +NL++R+   +IYTY G   I+VNP+R   IYT+ V+  YKGK R E+PPH+F+I+++ Y N+    ENQ V+I+GESGAGKTE  K+++ Y A          +  S+  G ++D ++  NP+LE++G AKT RNNNSSR GK++ I F +  +    +I  YLLEK RV+ Q K ERN+HIFYQ       +Y     V            G  T D +DD ++ + T EA   +G   EE+  +F+   +I+ +G + F +   E  A+   T+  + V++LL V+A  L++ +++ ++   +  + +G       +  Q      ALAK++YN +F W+V RVN +L         IG+LDI GFEIF+ N FEQICINY NE+LQQ F       EQE Y++E I W  I +  D +   +LIE   P GIL+ + +          A+DQ    +L  N    +P F              F + HYAG V Y+I G  +KNKD L + ++ L+G +    ++++F    D          G  +       +S N+L++ L    P +IR I PN+ K P   D H V+HQ+   G+ E +RI R GF  R  + +F +R+ +L+P+    G       T + +  I  D  +    ++LG T VF K   +L  LED+RD+   ++ +  Q   R +L RR    ++        IQR IR      KY+ LR +
Sbjct:   13 VKEPKKRSAKIKKATFD-ANKKKEVGISDLTLLSKISDESINENLKKRFKNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYNENQCVIISGESGAGKTEAAKRIMQYIA-------AASNSHSESIGKIKDMVLATNPLLESFGCAKTLRNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDTYKQMFGVQMPEQYIYTAAAGCTTADTIDDVKDYEGTLEAMRTIGLVQEEQDQIFRMLAAILWIGNISFIEN-EEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVE-RIMQTSHGMKRGSVYHVPLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSFEQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKY-FDNKVVCDLIEAKNPPGILAAMNDSIATAHADSNAADQAFAQRL--NLFNSNPYFELRAN--------KFVIKHYAGDVTYDINGITDKNKDQLQKDLIELIGTTTNTFLSTIFPDDVDKDSKRRPPTAGDKII------KSANELVETLSKAEPSYIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPDCSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNMAARIQRAWRRFLQRRIDAAIK--------IQRTIREKKGGNKYVKLRDY 762          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: MYHC-ST (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG0])

HSP 1 Score: 629.017 bits (1621), Expect = 0.000e+0
Identity = 313/520 (60.19%), Postives = 389/520 (74.81%), Query Frame = 1
Query:   46 DPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTAD-PALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELI 1599
            DP+DP  I L +D+  ++ Q    F+SKK +WIPD KEGY A  V+ T GD   V+T+ G+   + ++  EQMNPPK+   EDM+NLT+LN+ASV  NL+QRY+  LIYTYSGLFC+A+NPYRR PIYT +++  Y+GKR+ E PPH+F I DNAY NML DRENQS+LITGESGAGKTENTKKVI Y A+V+    K D++  K+ G SLEDQ++Q NP+LEAYGNAKT RNNNSSRFGKFIR HFG  GK+AGADIE YLLEKSRVI QQ+ ERNYHIFYQ+L    K  HD+LL+ ++  A +++  +G    DG+DD EE   T+ A   LGFS EEK+S++K   + ++ G  KFKQRPREEQAE     + +K SFL+ +   D ++ I+KP++KVG EYV +G++  QV YS+GAL KSLY RMF WLV R N+TL TK +R FFIGVLDIAGFEIF FN FEQ+CIN TNE+LQQFFNHHMF+LEQEEYK+E I WEFIDFG DL+  I LI
Sbjct:    4 DPNDPLAI-LRIDKSQIMAQ-AKEFESKKWVWIPDPKEGYKAAEVKSTKGDNFLVETNDGQEVEINKNDTEQMNPPKYEKTEDMSNLTYLNEASVVHNLKQRYFSGLIYTYSGLFCVAINPYRRLPIYTDKIVFAYRGKRKTEAPPHVFCICDNAYQNMLQDRENQSMLITGESGAGKTENTKKVIQYLAHVSGGISKADEEHKKQTGGSLEDQVIQTNPILEAYGNAKTIRNNNSSRFGKFIRCHFGPQGKLAGADIESYLLEKSRVIYQQEIERNYHIFYQILYGAPKDLHDQLLLESNKTADYAYTAKGCERADGIDDVEEWANTELAADTLGFSAEEKLSMYKICAACLHWGNSKFKQRPREEQAEVADPKDLDKTSFLMKLPGADFVKNIVKPRIKVGREYVNQGRNLQQVNYSIGALTKSLYERMFLWLVDRANQTLMTKDRRAFFIGVLDIAGFEIFQFNSFEQLCINVTNEKLQQFFNHHMFILEQEEYKREGIHWEFIDFGHDLEPTINLI 521          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO41819 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3A8])

HSP 1 Score: 521.931 bits (1343), Expect = 6.952e-159
Identity = 297/794 (37.41%), Postives = 454/794 (57.18%), Query Frame = 1
Query:  136 MWIPDEKEGYIAITVEETNGDKVT-VKTDKGETKVV--KQDSLEQMNPPKFMMIE-DMANLTFLNDASVFDNLRQRYYK-NLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGEL-TIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLF-------AP---AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIR 2469
            +WIP     +I   + +   DK+  +  + G   ++  ++  L  +  P+ ++ E D+  L++L++ +V  NL  R+ + N IYTY G+  +A+NPY   P+Y   ++  Y+G+  G+M PHIF+++++A+ +M+ D  NQSV+++GESGAGKT + K  + YF+ V  AS +           +E +++  NP++EA GNAKT RN+NSSRFGK++ I F  +  I GA +  YLLEKSRV+ Q   ERNYH+FYQ+  A  +    K    A P  FS++NQG+   +D +DD +  +   EA S++G +D+E++ LF+  ++I+++G ++  Q   +E    +     E  + LLG++   L + +   K+    E + K  S  +  Y   A++K +Y+++F W+V  +N TL +  K   FIGVLDI GFE F+ N FEQ CINY NE+LQQ F  H+F LEQ+EY +E I W FI+F  D Q CI+LIE  +GIL +L+EEC  PK SD     KLY  HL KS +F KP+          F +HH+A  V Y ++G++EKN+D +N+  + LL AS++ +V  +F       AP   A         K G  F +V      SL+KLM+ L ST+PH++RCI PN+ K P        + QL   GVLE IRI   G+P+R  Y EF  RY +L P+       + ++    IL     D +++++G TK+FF+AG +A LE +R +KL     + Q   R Y   R++K     R A  LIQ  +R
Sbjct:    3 VWIPHPDLVWIGGELTKDIEDKILEILLEDGREIIIDTRKSRLPPLRNPEILVGENDLTTLSYLHEPAVLHNLNVRFIQSNAIYTYCGIVLVAINPYEELPLYGPDIVAAYRGRSMGDMDPHIFAVAEDAFQSMIRDERNQSVIVSGESGAGKTVSAKYAMRYFSAVGGASTETQ---------IEKKVIATNPIMEAIGNAKTIRNDNSSRFGKYLEISFDRNHHIIGAHMRTYLLEKSRVVFQAAEERNYHVFYQM-CAACELPEMKDFRLAHPDNFSYLNQGDAPVVDSIDDADCFEELREALSMVGINDDEQLMLFRILSAILHLGNVEILQAGDDECTVEENDFHLEMTAVLLGIDKNQLRKWLCNRKIVTVGEVLIKPLSITEANYGREAISKRIYSQLFKWVVNTINCTLTSTSKPHSFIGVLDIYGFETFEINSFEQFCINYANEKLQQQFTQHVFKLEQDEYVREEIQWSFINF-YDNQPCIDLIEAKLGILDLLDEECKMPKGSDSQWAQKLYKQHLQKSKHFSKPRMSNLA-----FVIHHFADHVEYFVSGFVEKNRDTVNDEHLALLRASEDEMVGEMFTENDAHSAPRKRAASRAGKQGGKGGKMFKSVGSQFSVSLSKLMETLNSTTPHYVRCIKPNDTKAPFEFHPKRSIQQLRACGVLETIRISAAGYPSRWTYREFFARYIMLLPSK-KINRKKPRETIKLILETFIKDEDMFQMGKTKIFFRAGQVAYLEKLRGDKLRRSCVMIQKNYRCY---REHKLYLRMRKAAILIQAWVR 776          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO49515 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGF6])

HSP 1 Score: 452.21 bits (1162), Expect = 2.312e-135
Identity = 272/747 (36.41%), Postives = 418/747 (55.96%), Query Frame = 1
Query:  286 IEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGE-LTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFL-----------LGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVK-RQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEK-PMGILSILEEECMFP-KASDQTLKAKL---YDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFK-AGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIR 2469
            + DM  L  L + ++ +NL  RY    IYTY G   +++NPYR+FP+YT +VI +Y+ +   E+PPHI++I+D+AY +M    ++Q ++ITGESG+GKTE +K ++ Y A V    ++ D         +++Q++Q+NP+LEA+GNAKT RN+NSSRFGK++ I F   G   G  I  YLLEKSR++ Q KGERN+HIFY LL     +  D L +T D   + ++NQ E +++   DD+E+  + ++A  ++GF+++E  +++K  ++I+N+G  +      EE   +DGT   E V+ L           L  + + L+ ++ +  V+   E V    +  Q  Y+  ALAK++Y R+FAW+V RVN ++  + + ++  IGVLDI GFEIF  N FEQ  INY NE+LQQ F       EQEEY +E I+W  I++  +   C ELIEK   GIL++L+EEC+ P + SD T   KL   + +H        K           +F L HYAG V Y++ G+L+KN D L   +   + +    L   LF     T     + K     T +   +ES+ +LMKNL S +P++IRCI PNE K  GV D  L+ HQ+   G++E IR+ R GF  R  Y    QRY +L P   P      +    ++L  + +    Y  G TK+F +   TL  LE+ R + +  L  + Q   RG+  ++QY+ ++   + ++   R  R
Sbjct:   23 VSDMVLLEPLTEDAIMENLWDRYNAKAIYTYIGNVVVSINPYRKFPLYTREVIAEYRSRNIYELPPHIYAIADDAYRSMRDHNKDQCIIITGESGSGKTEASKVIMQYVAAVCGKGREVDR--------VKEQLLQSNPILEAFGNAKTLRNDNSSRFGKYMDIEFDFKGDPVGGVITKYLLEKSRLVYQNKGERNFHIFYHLLRGASDNLLDDLRLTRDFDGYHYLNQSECVSVPTKDDKEDFSVVEKAMEVVGFTEDEISAVYKLLSAILNLGNTEL-----EEFTTSDGT---EAVTVLNEQVLKNTCEMLQCDVELLLNSLRERTVETKTERVHTPLNVAQASYARDALAKAVYQRLFAWIVDRVNDSIQVRKRGKRKVIGVLDIYGFEIFVDNSFEQFIINYCNEKLQQIFIELTLKSEQEEYVREGIEWTTIEYFNNAVIC-ELIEKNHSGILALLDEECLRPGEVSDLTFLEKLDKQWIHHEHYESRKDKKYLSDKTLPHGYFRLKHYAGKVTYDVDGFLDKNNDLLFRGLSQCMYSCNHPLTKKLFPEGCPTKSSKRRPK-----TTATQFKESVAELMKNLKSKNPNYIRCIKPNERKAAGVFDERLIKHQVRYLGLMENIRVRRAGFAFRQEYPVALQRYKMLCPRTWPNWLGAPRDGIVELLKHLNVKPTEYAYGRTKIFIRNPRTLFALEEKRKDGMEDLAVIIQKIFRGWRRKKQYQNMRRSEITIAKYYRRFR 747          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO45563 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSH2])

HSP 1 Score: 442.195 bits (1136), Expect = 6.335e-135
Identity = 269/758 (35.49%), Postives = 422/758 (55.67%), Query Frame = 1
Query:  151 EKEGYIAITVEETNGDKVTVKTDKGETKVVKQ---DSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKY-KGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGE-LTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSF---LLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTL------DTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELI-EKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQ 2379
            E +  I   V+E  G  V +  D+G+  V+ +   +SL+ M+P     +E+M  L  L++A +  NL  RY  N IYTY G   +AVNPY  FPIY +  I +Y K     ++PPHI++  + +++ M  ++ NQ V+I+GESGAGKTE+TK ++ Y   V+                +E+QI+ ANP+LEA+GNAKT RN+NSSRFGK+I +HF  S  I GA I+ YLLE+SR+++Q   ERNYHIFY++L AG      K L       + +++QG  LT +G+DD  E  +  +A + L F++EE   +F+   +++++G + F+ +  E+  EA      E V+    LL V  + + +A  +       E +    S ++      A  K LY+++F W+V ++N ++      D    RQ  IGVLDI GFE FD N FEQ+CINY NE LQQFF   +F  EQEEY +E I+W F+ F +D Q  ++++ EKPM  +++++EE  FP+ +D++   KL  NH   + +F         + ++ F + H+AG+V Y+ TG+L+KN++  +  +V L+ +SK     ++F      G    K+      T+    R SL+ LMK L S    F+RC+ PN +K+P   D  L   QL  +G+LE +RI + G+  R  + EF  RY +L  +++    +  +  +  I T++    N ++LG  ++F K      LE+ R + LSS I   Q
Sbjct:   18 ENDVAIGACVKEVQGASVILVDDEGKEVVIDRSVAESLKHMHPSSVEGVENMIELGDLDEAGILRNLLIRYRANKIYTYVGSVLVAVNPYCSFPIYGTAYISRYQKAVNATDLPPHIYATGEMSFAMMKREKHNQCVVISGESGAGKTESTKFILQYLTAVSGRHST-----------IEEQILDANPILEAFGNAKTIRNDNSSRFGKYIDVHFNDSWVIEGAKIDHYLLEQSRIVAQMPNERNYHIFYRML-AGMSPQEKKSLHLTHAQDYYYLSQGNCLTCEGMDDAYEYDVIRKAMTALWFTEEETQFIFRSIAAVLHLGNISFEAK-MEDNIEACDVMNPETVAAAADLLQVPKEHMEEAFTRKSTFAEGEMIYSPVSVERATDIRDAFVKGLYSKVFIWIVNKINSSIYKPRGKDDTSGRQS-IGVLDIFGFEKFDMNSFEQLCINYANENLQQFFVAQIFKNEQEEYDREGIEWNFVTF-VDNQEVLDMLAEKPMNFIALIDEESRFPQGTDESFLDKLNYNH-KDNKHF----VRPKSRVQSQFGVVHFAGTVYYDTTGFLDKNRNTFSADLVDLISSSKCNFFLNMFFKERSMGTETRKRSP----TLGVQFRRSLDVLMKTLASCRSFFVRCVKPNNYKKPMEFDRELCWQQLRYSGMLETVRIRKSGYAMRHTFEEFVTRYHMLVRDSLRD--MSSRDASHLIATSLLGQEN-WKLGTKRIFLKESQDVLLEESRAQLLSSKIIFLQ 748          
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Match: EDO36037 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJR5])

HSP 1 Score: 429.098 bits (1102), Expect = 4.891e-126
Identity = 260/794 (32.75%), Postives = 425/794 (53.53%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTD--KGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFP-IYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREE---QAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQF-FIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIE-KPMGILSILEEECMFPKASDQTLKAKL---YDNHLGKS-PNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAED-----------XXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRD---EKLSSLISLFQAQIRGYLMRRQYKK 2421
             D  + +W+PD + GY+  ++ +   D++TV+ D  KG+      D            +ED   L FLN+ ++ +NLR RY K+ IYTY     +AVNPY     +YT + IMKY GK  G +PPH+F+I+D AY +M   +++QS++++GESGAGKTE+TK ++ Y               S  +G +E +IV+ANP+LE++GNAKT RN NSSRFGK++ +HF     + G  I  YLLE+SR+  Q KGERNYH+FY+L +   K   D L +T     F+++NQG L+   +DD  + K  D +   +GFS EEK ++++   +++++G + F+         Q  +  + E    + LLGV+ ++L QA+    +  G   V      +Q   +  ALAKS+Y ++F  +V +VN+         F +IGVLDIAGFE ++ N FEQ CINY NE+LQQFFN  +    +    + +I+ + +   ++ Q+   LIE K  GIL IL+EE   PK +     + +   + NH   + P        +  + +  F + H+AG+V Y+   +++KN D L+  +  L+  SK+  V SLF  A              G      K  +F++V    R  L +LM  L ST   FIRCI PN      + +   ++ QL C G++  + + + G+P+R  ++E  Q Y    P+ + +  ++ +     +  A+ +    Y+ G++K+FF+ G  A+ + +     E L  L+S    ++  +L+R ++++
Sbjct:    1 MDGGRKLWVPDNEHGYLLGSIVDIGSDEITVQLDGFKGKHVTAPYDRTFPAEKDSNKDVEDNCALMFLNEGTLLNNLRVRYKKDKIYTYVANILLAVNPYHEVKELYTKETIMKYHGKSLGTLPPHVFAIADKAYRDMRAYKQSQSIVVSGESGAGKTESTKYILRYLTE---------SWGSGDQGRIEQRIVEANPLLESFGNAKTMRNINSSRFGKYVEVHFNEKVIVVGGFISHYLLEQSRICMQSKGERNYHVFYRLCAGAPKQIKDMLRLTR-AQDFNYLNQGSLSDPNLDDTSDFKRMDASMDNVGFSKEEKSNIYRVVAAVLHLGNIIFEDIDDTHGGCQVSSKCSDEVNITAKLLGVSPEELQQALTTRLMSAGGADVRVPLKLEQAYAARDALAKSIYTKLFDHIVAQVNQCF--PFTSSFTYIGVLDIAGFEYYELNSFEQFCINYCNEKLQQFFNDRILKQYRIIPAQPSINQDRVTPAIN-QSGSHLIEAKKTGILDILDEESKLPKPTSAHFTSDIHLKHKNHFRLALPRKSPLMYHRNLRDDEGFLIRHFAGAVCYHTQEFIDKNNDALHNDLAELISESKDSFVKSLFPSASGNGDRIIGGVTMAGSGRQGSKKLAFVSVGSKFRTQLQQLMDKLDSTGASFIRCIKPNGKMSANLFEGGSILSQLECAGMVSVLALMQDGWPSRTQFTELYQMYKNFLPSKLAR--LDPRMFCRALFHALGMSDKDYKFGSSKIFFRPGKFAEFDAVMQTDPENLKKLVS----KVTTWLIRTRWRR 775          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: vmhc (ventricular myosin heavy chain [Source:NCBI gene;Acc:100415781])

HSP 1 Score: 1714.12 bits (4438), Expect = 0.000e+0
Identity = 1015/1899 (53.45%), Postives = 1384/1899 (72.88%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA---------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KK  ++PD  E ++  T+   +GDKVTV+T  G+T  VK   + Q NPPKF  IEDMA LTFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHIFSISD+AY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AA S K D    K    LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHF T GK+A ADIE YLLEKSRV+ Q K ER+YHIFYQ+LS       + LL+T +P  + FI+QGE  +  +DD EE+  TD AF +LGF+ EEK S++K T +IM+ G MKFKQRPREEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNE+VTKGQS +QV Y++GAL+K++Y +MF W+V R+N++L+TK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+A LFA              GK   KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P AIP+G F++ ++  +K+L ++ +D + Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QA+ RG L R +Y+K+ ++R AL +IQ NIR ++ ++ W W KLF K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+   L+  K  +E + KEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L++EE+KV+ L K KAKLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  NSKIEDE +++A LQ+K+KELQAR++ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA +QHE     +RKKQ D+  +  +Q+D LQ+ K K+E+EKSEL+ +++D+ S +E + K+K  LEK+ + LE  +++ +NK DE  R L +      + Q EN E+ + +E+ ES I+QL + K     QLE+ K+ LE+E +AK  L   +++A  D D LRE  EEEQE K+++QR + K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++DVER+N +A+ L+KKQ+N D+++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E + + +E+L+RENKNL +EI DLTEQLGEGG+ +HE+EK RK++E E+ E+Q ALEEAE +LE EE+K  R QLE +Q + E ER+L+EK+EE E +++N QRT++++Q+SLEAE R R EA+++KKK+E D+NE+E+ L  ANR  +E +K  K     L + Q Q++E     + + E +A+ ER+  ++  ELEE++   +  E++RK+AE E  +  +++     QN+  +  K+K+E+D   +Q ++E++    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQK+  ET K  RK +RR+KE++YQ +ED+KN  R+Q LI+ LQ K+K YKR  EEAEE A V+L+K+RK+Q E++++EERAD AE  + KLR K+
Sbjct:   31 FDIKKECFVPDPVEEFVKGTITSRDGDKVTVETQNGKTVTVKDSDILQQNPPKFDKIEDMAMLTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVLAYRGKKRSEAPPHIFSISDSAYQYMLSDRENQSILITGESGAGKTVNTKRVIQYFASIAAGSNKKDTAKDKGT--LEDQIIQANPALEAFGNAKTIRNDNSSRFGKFIRIHFDTRGKVASADIETYLLEKSRVVCQLKAERDYHIFYQILSNKKPELLEMLLITNNPYDYFFISQGETQVPSIDDAEELMATDSAFDVLGFTQEEKNSVYKLTGAIMHYGNMKFKQRPREEQAEADGTEDADKAAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQSVNQVNYAIGALSKAVYEKMFLWMVIRINQSLETKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSNNF-QKPRVVKGKPEAHFSLVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSTLKLLAILFANYAGADLVLGEASEGKKEKKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPAAIPEGQFIDSRKGAEKLLGSLDVDHSQYKFGHTKVFFKAGLLGLLEEMRDERLSKIITAIQARSRGLLSRIEYQKMVERRDALLVIQWNIRSFMGVKNWPWMKLFFKIKPLLRSAEAEKEMANMKEEFLKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLCDAEERCEGLIKNKIQLEAKAKELSERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKLKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESVMDLENDKQQLEERLKKKDFEISQLNSKIEDEQSIIAQLQKKLKELQARVEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLQHEATAATLRKKQADSVADLGEQIDNLQRVKQKLEKEKSELKLELDDVVSNMEHIVKSKTFLEKTCRTLEDQMNEYRNKCDEYQRSLNDFTTQKAKLQAENDELSRQMEEKESLISQLTRGKNSYNQQLEDLKRQLEEEIKAKNALAHAVQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAVAATLDKKQRNFDRVLAEWKQKYEESQCELESSQKEARSLSTELFKLKNSYEEALEHLETLKRENKNLQEEISDLTEQLGEGGKTLHELEKVRKQLEQEKSEIQSALEEAEGSLEHEESKILRTQLEFNQIKAEMERKLSEKDEEMEQSKRNMQRTIDTLQSSLEAECRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKSIHAHLKDCQIQLDESSKGNDDLRENMAIVERRNTLLQAELEELRAALEQTERSRKLAEQELLDVSERVQLLHSQNTGLINQKKKLESDTVQLQTEVEDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELENEVELEQKKSSETVKGIRKYERRIKELTYQTEEDRKNIARLQDLIDKLQLKVKAYKRAAEEAEEQANVHLSKFRKLQHELDEAEERADIAESQVNKLRVKS 1926          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: myh6 (myosin, heavy chain 6, cardiac muscle, alpha [Source:ZFIN;Acc:ZDB-GENE-031112-1])

HSP 1 Score: 1701.8 bits (4406), Expect = 0.000e+0
Identity = 1013/1895 (53.46%), Postives = 1374/1895 (72.51%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFA------PAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAK 5781
            FD K   ++ D+K  ++   ++  +G  VTVK + G T  VK+  +   NPPKF  IEDMA  TFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y   V+  Y+GK+R E PPHIFSISDNAY  ML DRENQSVLITGESGAGKT NTK+VI YFA++AA       D SK    LEDQI+QANP LEA+GNAKT RN+NSSRFGKFIRIHFGTSGK++ ADIE YLLEKSRV  Q K ERNYHIFYQ+LS       D LL+T +P  +S+I+QGE+T+  ++D EE+  TD AF +LGF+ EEKM ++K T +IM+ G MKFKQ+ REEQAE DGT  A+K ++L+G+N+ DL++ +  P+VKVGNEYVTKGQ  DQV Y++GALAKS+Y +MF W+V R+N++LDTK  RQ+FIGVLDIAGFEIFDFN FEQ+CINYTNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDLQACI+LIEKPMGILSILEEECMFPKASDQT KAKLYDNHLGK+  F +      G+ EAHF L HYAG+V YNI+GWL KNKDPLNE+VVGL   S   L++ LF+        +  G  G KKKG SF TVS +HRE+LNKLM NL +T PHF+RC++PNE K PGV+D  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL  +AIP+G F++ K+  +K+L ++ +D   Y+ G+TKVFFKAG L  LE++RDE+LS +I+  QA  R  LMR Q+ KL ++R AL +IQ N+R +L ++ W W KLF K+KP+L  A  E+EM    +E  KLKE  EK+E  +KELEE+ VTLLQ KNDL LQ+Q+EQD+L DAEE+  +L+  K  +E ++KE+ + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +  ++E + K+ KEKKA  E  ++T + L++EE+K ++L KAKAKLEQ +D++E +L +E+K+R D+E++KRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  NSK+EDE      LQ+K+KE QA+I+ELEE+L+AER ARAK EK + +L  ELE+ISERLEE GGAT AQ +LNKKR+AE  KL+R+ EE+ +QHE     +RKK  D+  E  + +D LQ+ K K+E+EK+EL+ +++DLSS +ES+ K+K N+EK  + LE  +++ + K +E  R + +      R   EN E  + LE+ ES I+QL + K     Q+E+ ++ LE+E +AK  L   +++A  D D LRE  EEEQE K+++QR L K   E+   +   +  G  RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++D+ER+N  ++ L+KKQ+  DK++ EW++K+ ESQ ELE S +ESR++S E+FKLK+  E S DQ+E+++RENKNL +EI DLT+QLGEGGR+ HE+EK RK++E E++ELQ ALEEAE +LE EE+K  RAQLE +Q + E ER+LAEK+EE E  ++N+QR LES+Q+SL++E R R EA+++KKK+E D+NE+E+ L+ ANR  ++ +K  K  Q  L + Q Q+++  H  + + E + L ER+  ++  ELEE++   +  E++RK+AE E  +A +++     QN+S +  K+K EADL  +Q ++EE     R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE RIRELE ELD EQKR  E+ K  RK +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K+YK   +EAEE A  N+AK RK+Q E+E++EERAD AE  + KLRAK
Sbjct:   31 FDIKTECFVVDDKVEFMKGQIQSKDGGMVTVKKEDGNTVTVKESDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYDYDVVAAYRGKKRSEAPPHIFSISDNAYQYMLTDRENQSVLITGESGAGKTVNTKRVIQYFASIAAVGGAGKKDSSKGT--LEDQIIQANPALEAFGNAKTARNDNSSRFGKFIRIHFGTSGKLSSADIETYLLEKSRVTFQLKAERNYHIFYQILSNQKPELLDLLLITNNPYDYSYISQGEVTVASINDSEELMATDSAFDVLGFTQEEKMGVYKLTGAIMHYGNMKFKQKQREEQAEPDGTEAADKSAYLMGLNSADLIKGLCHPRVKVGNEYVTKGQGVDQVYYAIGALAKSVYEKMFNWMVVRINQSLDTKQDRQYFIGVLDIAGFEIFDFNTFEQLCINYTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLQACIDLIEKPMGILSILEEECMFPKASDQTFKAKLYDNHLGKNKMF-EKPRAAKGKAEAHFALVHYAGTVDYNISGWLVKNKDPLNETVVGLYQKSSLKLLSVLFSNYSGTDGGDKGGSKGAKKKGSSFQTVSALHRENLNKLMTNLKTTHPHFVRCLIPNEKKIPGVMDNCLVMHQLRCNGVLEGIRICRKGFPNRVLYGDFKQRYRILNASAIPEGQFIDCKKSAEKLLGSLSIDHTQYKFGHTKVFFKAGLLGTLEEMRDEQLSRIITRIQANARRLLMREQFVKLVERRDALMVIQWNLRSFLGVKNWPWMKLFFKIKPLLKSAESEKEMANMKDEFNKLKEAMEKSETRRKELEEKIVTLLQEKNDLTLQIQSEQDTLTDAEERCEQLIKSKIQLEAKLKEMNERLEDEEELNADLTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLVEEIASQDENILKLTKEKKALQEAHQQTLDDLQSEEDKANSLTKAKAKLEQQVDDLEGSLEQEKKVRMDLERSKRKLEGDLKLTQENMMDLENDKQQLEEKLKKKDFEISQVNSKLEDEQTNSVQLQKKLKESQAKIEELEEELDAERAARAKVEKQRSELSRELEDISERLEEVGGATSAQVELNKKRDAEFQKLRREFEESTLQHEATAAALRKKHADSVAELGEHIDNLQRVKQKLEKEKNELKLELDDLSSSMESVVKSKANIEKMCRTLEDNMNEYKCKFEEAQRTINDLTTQRARLLTENGEFGRQLEEKESLISQLTRGKNSYNQQVEDLRRQLEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRALSKSNTEVAAWRTKYETDGIQRTEELEEAKKKLVQRLQEAEEAIEAVNAKCSSLEKTKHRLQNEIEDLMLDLERSNAASAALDKKQRTFDKVLAEWKQKFEESQSELEASQKESRSLSTELFKLKNAFEESLDQLETIKRENKNLQEEISDLTDQLGEGGRSAHELEKIRKQLEQEKNELQSALEEAEGSLEHEESKILRAQLEFNQVKAEIERKLAEKDEEMEQAKRNYQRMLESLQSSLDSETRSRNEALRVKKKMEGDLNEMEIQLNQANRQAADAQKQVKTLQGFLKDAQLQLDDTQHSNDDLRENITLLERRNNLIQSELEELRAALEQTERSRKLAEQELTDATERIQLLHSQNTSLINQKKKHEADLLNLQNEIEEIIQEHRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARIRELENELDAEQKRGTESIKGVRKYERRIKELTYQTEEDRKNLARLQDLVDKLQLKVKSYKHAADEAEEAANANMAKVRKLQHELEEAEERADIAEAQVNKLRAK 1922          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000007991.2 (myosin heavy chain, fast skeletal muscle [Source:NCBI gene;Acc:100125431])

HSP 1 Score: 1700.64 bits (4403), Expect = 0.000e+0
Identity = 1005/1920 (52.34%), Postives = 1385/1920 (72.14%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXX-----XXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            M+   P  I+L    +  ++     FD+K   ++ D  E Y+   + +    K TV+TD G+T  VK+D +   NPPKF  IEDMA +T LN+  V  NL+ R+   +IYTYSGLFC+ VNPY+  P+Y S V+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +AA   K +    K +GSLEDQIV ANP+LEAYGNAKT RN+NSSRFGKFIRIHFG+SGK+A ADIE YLLEKSRV  Q   ER+YHIFYQL++       + LL+T +P  +  I+ GE+T+  ++D EE   TD A  ILGF+ +EK++++K T ++M+ G MKFKQ+ REEQAE DGT  A+K+++L+G+N+ D+++A+  P+VKVGNE VTKGQ+  QV  S+ AL KS+Y +MF W+V R+N+ LDTK  RQFFIGVLDIAGFEIFD+N  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDL ACIELIEKP+GI SILEEECMFPKASD T K KL+D HLGKS  F +   P  G+ EAHF L HYAG+V YNITGWL+KNKDPLN+SVV L   S   L+  L+A    T      K G KKKGGSF TVS + RE+L KLM NL ST PHF+RC++PNE K PG+++ HLV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ ++K+L +I +D   Y+ G+TKVFFKAG L QLE++RDEKL+SL+++ QA  R Y+MR+++ K+  +R A+  IQ NIR ++ ++ W W KL+ K+KP+L  A  E+E+++  E  EK+K +       KKELEE+ V+LLQ KNDL LQ+ +E ++L+DAEE+   L+  K  +E ++KE  + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +  ++E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+K+R D+E+AKRK+EG+LK  QE + DLE  K + +E++K+K+ E++   SKIEDE +L A LQ+KIKELQARI+ELEE++EAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEE+ +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSE + +I+DL S +E++ K KGNLEK  + LE  +S+L+ K DE  RQL +A  +  R Q EN E+ + LE+ E+ ++QL + KQ    Q+EE K+++E+E +AK  L   +++A  D D LRE  EEEQE K+++QR + K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  SKC+ LEK K RLQGE+EDL+IDVERAN LA+ L+KKQ+N DK++ EW++KY ESQ ELE + +E+R++S E+FK+K+  E + DQ+E+++RENKNL  EI DLTEQLGE G+++HE+EK +K +E E+ E+Q ALEEAE  LE EE+K  R QLE++Q + E +R+LAEK+EE E  ++N QR +ESMQ++L+AEVR R +A+++KKK+E D+NE+E+ L  ANR  +E +K  +  Q QL + Q  +++    +E + EQ+A+ ER+ G+M  E+EE++   +  E+ RKVAE E  +  +++     QN+S + TK+K+EADL  +Q ++EE+   AR A E+ KKAI D   + +E+K+EQ+ +   E+ +KNLE  +K+LQ +L+EAE   +KGGKK L KLE R+ ELE E++ EQKR  E  K  RK +RR+KE++YQ +EDKKN +R+Q L++ LQ K+K YKRQ EEAEE A  +++++RK+Q E+E+++ERAD AE  + KLRAK+
Sbjct:    7 MEQYGPASIFLRKPERERIEAQNTPFDAKTAYFVVDPDELYVKCKLVKKEAGKATVETDGGKTVTVKEDDIHPRNPPKFDKIEDMAMMTHLNEPCVLYNLKDRFASWMIYTYSGLFCVVVNPYKWLPVYDSVVVAAYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAALGGKKEQSSGKMQGSLEDQIVAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGSSGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLMTGHKPELLEALLITTNPYDYPMISMGEITVKSINDVEEFIATDTAIDILGFTGDEKINIYKLTGAVMHHGNMKFKQKQREEQAEPDGTEVADKIAYLMGLNSADMLKAVCYPRVKVGNEMVTKGQTVPQVHNSVMALCKSVYEKMFLWMVLRINEMLDTKQPRQFFIGVLDIAGFEIFDYNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPLGIFSILEEECMFPKASDTTFKNKLHDQHLGKSKGF-EKPKPAKGKAEAHFALVHYAGTVDYNITGWLDKNKDPLNDSVVQLYQKSSNKLLTHLYAAHSSTEASGGAKKGGKKKGGSFQTVSALFRENLAKLMTNLKSTHPHFVRCLIPNETKTPGLMENHLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDVDHTQYKFGHTKVFFKAGLLGQLEEMRDEKLASLVTMTQALCRAYVMRKEFVKMMKRREAIYSIQYNIRSFMNVKNWPWLKLYFKIKPLLKSAETEKELQEMKENYEKMKTDLAAALAKKKELEEKMVSLLQEKNDLQLQV-SEVENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKLRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATSAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLCSNMEAVAKMKGNLEKMCRTLEDQLSELKAKNDENVRQLNDANALKARLQTENGEITRQLEEKEALVSQLTRGKQAFTQQIEELKRHIEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANSLAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQLGETGKSIHELEKAKKSVETEKAEIQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEEMEQIKRNSQRVIESMQSTLDAEVRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRAQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDISERVALLHSQNTSLLNTKKKLEADLVQVQGEVEEAIQEARNAEEKAKKAITDAAMMAEELKKEQDTSAHVERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLEIRVHELEAEVEAEQKRGAEAIKGVRKYERRMKELTYQTEEDKKNMNRLQDLVDKLQLKVKVYKRQAEEAEEQANTHMSRFRKVQHELEEAQERADIAESQVNKLRAKS 1924          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000016518.2 (myosin-7 [Source:NCBI gene;Acc:101164097])

HSP 1 Score: 1698.33 bits (4397), Expect = 0.000e+0
Identity = 996/1891 (52.67%), Postives = 1386/1891 (73.29%), Query Frame = 1
Query:  118 FDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAP-AEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            FD KK  ++PD +  Y+  TV   +GDKVT +T+ G+T  VK+  +   NPPKF  IEDMA  TFL++ +V  NL++RY   +IYTYSGLFC+ VNPY+  P+Y  +V++ Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA++AAA     D  ++KKG+LEDQI+Q NP LEA+GNAKT RN+NSSRFGKFIRIHF   GK+A ADIE YLLEKSRV  Q K ER+YHIFYQ+LS       + LL+T +P  ++FI+QGE T+  ++D EE+  TD+AF +LGF+ EEK S++K + +IM+ G MKFKQ+ REEQAEADGT +A+K ++L+G+N+ DL++ +  P+VKVGNE+VTKGQ+ +QV Y++GAL+K++Y +MF W+V R+N++LDTK  RQ+FIGVLDIAGFEIFDFN FEQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+W FIDFGMDLQACI+LIEKPMGI+SILEEECMFPKASD T KAKLYDNHLGKS NF +      G+ EAHF L HYAG+V YNI  WL KNKDPLNE+VVGL   S   L+A+LFA  A      G+KKKG SF TVS +HRE+LNKLM NL ST PHF+RCI+PNE K PG ++  LVMHQL CNGVLEGIRICRKGFPNR++Y +FKQRY IL P++IP+G F++ K+ ++K+L ++ +D N Y+LG+TKVFFKAG L  LE++RD++L+ +I+  QA+ RG L R +++K+ ++R AL +IQ NIR ++ ++ W W KL+ K+KP+L  A  E+EM    EE  KLKE + K+E  +KELEE+ V+LLQ KNDL LQ+Q EQD+L DAEE+   L+  K  +E +IKEL + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +   ++ +AK+ KEKKA  E  ++T + L++EE+KV+ L KAKAKLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE + DLE  K +LEE+LK+K+ E++  N KIEDE  + A LQ+K+KELQARI+ELEE+LEAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEEA + HE     +RKKQ D+  +  +Q+D LQ+ K K+E+EKSEL+ +++D+ S +E + K+K NLEK  ++LE  +++ + K +E  R + +      + Q EN E  + LE+ +S ++QL + KQ    Q+++ K+ LE+E +AK  L   +++A  D D LRE  EEEQE K+++QR + K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  +KCS LEK K RLQ EIEDL++DVER+N  A+ L+KKQ+N DK++ EW++KY ESQ ELE S +E+R++S E+FKLK+  E + + +E+++RENKNL +EI DLTEQ+GEGG+++HE+EK RK++E E+ E+Q ALEEAE++LE EE K  R QLE +Q + + ER++AEK+EE E  ++N QR ++++Q+SLEAE R R EA+++KKK+E D+NE+E+ L  ANR  +E +K  K     L + Q Q++E     + + E +A+ ER+  ++  ELEE++   +  E++RK+AE E  +  +++     QN+  +  K+K+E+D   +Q ++E++    R A E+ KKAI D   + +E+K+EQ+ +   E+ +KN+E  +K+LQ +L+EAE   +KGGKK + KLE R+RELE E++ EQ++  +  K  +K +RR+KE++YQ +ED+KN  R+Q L++ LQ K+K+YK+  EE+EE A  NL K+RK+Q E++++EERAD AE  + KLRAK+
Sbjct:   31 FDMKKECFVPDPEVEYVKATVTSRDGDKVTAETEFGKTVTVKECDVHPQNPPKFDKIEDMAMFTFLHEPAVLFNLKERYAAWMIYTYSGLFCVTVNPYKWLPVYNQEVVVAYRGKKRSEAPPHIFSISDNAYQYMLSDRENQSILITGESGAGKTVNTKRVIQYFASIAAAPGLKKDAAAEKKGTLEDQIIQCNPALEAFGNAKTIRNDNSSRFGKFIRIHFDNRGKLASADIETYLLEKSRVTYQLKAERDYHIFYQILSQAKPELLEMLLITNNPYDYAFISQGETTVASINDAEELMATDDAFDVLGFTQEEKNSIYKLSGAIMHFGNMKFKQKQREEQAEADGTEDADKAAYLMGLNSADLIKGLCHPRVKVGNEWVTKGQNVNQVYYAVGALSKAVYEKMFLWMVIRINQSLDTKQPRQYFIGVLDIAGFEIFDFNTFEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWTFIDFGMDLQACIDLIEKPMGIMSILEEECMFPKASDATFKAKLYDNHLGKSSNF-QKPRNVKGKPEAHFSLVHYAGTVDYNINNWLVKNKDPLNETVVGLYQKSTMKLLANLFANYAGADSGGGSKKKGSSFQTVSALHRENLNKLMTNLRSTHPHFVRCIIPNETKTPGAMENPLVMHQLRCNGVLEGIRICRKGFPNRILYGDFKQRYRILNPSSIPEGQFIDNKKASEKLLGSLDIDHNQYKLGHTKVFFKAGLLGLLEEMRDDRLALIITRIQARSRGVLARIEFQKIVERRDALLVIQWNIRAFMGVKNWPWMKLYFKIKPLLKSAETEKEMANMKEEFAKLKEAYAKSEARRKELEEKMVSLLQEKNDLQLQVQAEQDNLGDAEERCEGLIKSKIQLEAKIKELTERLEDEEEMNAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMAALDDIIAKLTKEKKALQEAHQQTLDDLQSEEDKVNTLTKAKAKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESVMDLENDKQQLEERLKKKDFEISQLNGKIEDEQAMCAQLQKKLKELQARIEELEEELEAERAARAKVEKQRADLARELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEEATLHHESTTASLRKKQADSVADLGEQIDNLQRVKQKLEKEKSELKLELDDVVSNMEQIVKSKNNLEKMCRSLEDQMNEYKTKSEEGQRTINDFTMQKAKLQTENGEFQRQLEEKDSLVSQLTRGKQSYTQQIDDLKRQLEEEVKAKNALAHAVQSARHDCDLLREQYEEEQEAKAELQRSMSKANSEVAQWRTKYETDAIQRTEELEEAKKKLAQRLQEAEEAVEAVNAKCSSLEKTKHRLQNEIEDLMVDVERSNAAAAALDKKQRNFDKVLAEWKQKYEESQSELESSQKEARSLSTELFKLKNSYEEALEHLETMKRENKNLQEEISDLTEQIGEGGKSIHELEKIRKQLEQEKSEIQTALEEAEASLEHEEGKILRVQLEFNQIKADMERKIAEKDEEMEQAKRNQQRVVDTLQSSLEAETRSRNEALRIKKKMEGDLNEMEIQLSQANRQAAEAQKQLKAVHAHLKDSQLQLDESLRANDDMKENIAIIERRNNLLQAELEELRAALEQTERSRKLAEQELLDVSERVQLLHSQNTGLINQKKKLESDTVQLQTEVEDAVQECRNAEEKAKKAITDAAMMAEELKKEQDTSAHLERMKKNMEQTIKDLQHRLDEAEQIAMKGGKKQVQKLEARVRELENEVESEQRKAGDAIKGVKKYERRIKELTYQTEEDRKNLSRLQDLVDKLQLKVKSYKKAAEESEEQANTNLTKFRKLQHELDEAEERADIAESQVNKLRAKS 1920          
BLAST of Myosin heavy chain vs. Ensembl Medaka
Match: ENSORLT00000002485.2 (myosin heavy chain, fast skeletal muscle [Source:NCBI gene;Acc:101164155])

HSP 1 Score: 1689.47 bits (4374), Expect = 0.000e+0
Identity = 997/1916 (52.04%), Postives = 1381/1916 (72.08%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXX-XLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQG-FVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKN 5784
            M+   P  IYL    K  ++     FD+K   ++ + +E Y+   + +  G K TV+T    T  VK++ +  MNPPKF  IEDMA +T LN+ +V  NL++R+   +IYTYSGLFC+ VNPY+  P+Y +QV+  Y+GK+R E PPHIFSISDNAY  ML DRENQS+LITGESGAGKT NTK+VI YFA +A A  K  +  S K   SLEDQI+ ANP+LEAYGNAKT RN+NSSRFGKFIRIHFG++GK+A ADIE YLLEKSRV  Q   ER+YHIFYQL++       + LL+T +P  +  I+QGE+T+  ++D EE   TD A  ILGFS EEKM ++K T ++M+ G MKFKQ+ REEQAE DGT  A+K+++L+G+N+ D+++A+  P+VKVGNE VTKGQ+  QV  ++ AL KS+Y +MF W+V R+N+ LDTK  RQFFIGVLDIAGFEIFD+N  EQ+CIN+TNE+LQQFFNHHMFVLEQEEYKKE I+WEFIDFGMDL ACIELIEKPMGI SILEEECMFPKA+D + K KL+D HLGK+  F +   P  G+ EAHF L HYAG+V YNITGWL+KNKDPLN+SVV L   S   L+  L+A        G KKKGGSF TVS + RE+L KLM NL ST PHF+RC++PNE K PG+++  LV+HQL CNGVLEGIRICRKGFP+R++Y +FKQRY +L  + IP+G F++ K+ ++K+L +I +D + Y+ G+TKVFFKAG L  LE++RDEKL+ L+++ QA  RG+LMR+++ K+ ++R A+  IQ N+R ++ ++ W W KL+ K+KP+L  A  E+E+++     EK+K +       KKELEE+ V+LLQ KNDL LQ+  E ++L+DAEE+   L+  K  +E ++KE  + L +EE   + L   K+KL  +  ELKKD++DLE +L K E+EK A + ++K+L + +  ++E +AK+ KEKKA  E  ++T + L+AEE+KV+ L KAK KLEQ +D++E +L +E+KIR D+E+AKRK+EG+LK  QE + DLE  K + +E++K+K+ E++   SKIEDE +L A LQ+KIKELQARI+ELEE++EAER ARAK EK +  L  ELEEISERLEE GGAT AQ ++NKKREAE  KL+RDLEE+ +QHE     +RKKQ D+  E  +Q+D LQ+ K K+E+EKSE + +I+DLSS +E++ K+KGNLEK  + LE  +S+L+ K DE  RQL +      R Q EN E  + LE+ E+ ++QL + KQ    Q+EE K+++E+E +AK  L   +++A  D D LRE  EEEQE K+++QR + K  +E+ Q +   +     RTEE+EE ++K+  R+QE EE  E+  SKC+ LEK K RLQGE+EDL+IDVERAN LA+ L+KKQ+N DK++ EW++KY ESQ ELE + +E+R++S E+FK+K+  E + DQ+E+++RENKNL  EI DLTEQ+GE G+++HE+EK +K +E E+ ELQ ALEEAE  LE EE+K  R QLE++Q + E +R+LAEK+EE E  ++N QR +ESMQ++L+AEVR R +A+++KKK+E D+NE+E+ L  ANR  +E +K  +  Q QL + Q  +++    +E + EQ+A+ ER+ G+M  E+EE++   +  E+ RKVAE E  +A +++     QN+S + TK+K+EAD   +Q +++++   AR A E+ KKAI D   + +E+K+EQ+ +   E+ +KNLE  +K+LQ +L+EAE   +KGGKK L KLE R+RELE E++ EQ+R  +  K  RK +RR+KE++YQ +EDKKN  R+Q L++ LQ K+K YKRQ EEAEE A  ++A+ RK+Q E+E+++ERAD AE  + KLRAK+
Sbjct:    7 MEAYGPAAIYLRKPEKERIEAQAAPFDAKTAYFVAEPEEMYLKGKLIKREGGKATVET----TLTVKEEDIHPMNPPKFDKIEDMAMMTHLNEPAVLYNLKERFASWMIYTYSGLFCVVVNPYKWLPVYDAQVVNAYRGKKRIEAPPHIFSISDNAYQFMLTDRENQSILITGESGAGKTVNTKRVIQYFATIAVAGGKKSEGSSGKMQGSLEDQIIAANPLLEAYGNAKTVRNDNSSRFGKFIRIHFGSTGKLASADIETYLLEKSRVTFQLSAERSYHIFYQLMTGHKPELLEALLITTNPYDYPMISQGEITVKSINDVEEFIATDTAIDILGFSAEEKMGIYKLTGAVMHHGNMKFKQKQREEQAEPDGTEVADKIAYLMGLNSADMLKALCYPRVKVGNEMVTKGQTVPQVNNAVSALCKSVYEKMFLWMVIRINEMLDTKQPRQFFIGVLDIAGFEIFDYNSLEQLCINFTNEKLQQFFNHHMFVLEQEEYKKEGIEWEFIDFGMDLAACIELIEKPMGIFSILEEECMFPKATDTSFKNKLHDQHLGKTKAF-EKPKPAKGKAEAHFALVHYAGTVDYNITGWLDKNKDPLNDSVVQLYQKSSNKLLCYLYAA-----HGGGKKKGGSFQTVSALFRENLGKLMTNLRSTHPHFVRCLIPNESKTPGLMENFLVIHQLRCNGVLEGIRICRKGFPSRILYGDFKQRYKVLNASVIPEGQFIDNKKASEKLLGSIDVDHSQYKFGHTKVFFKAGLLGTLEEMRDEKLAELVTMTQALCRGFLMRKEFVKMMERRDAIFTIQYNVRSFMNVKNWPWLKLYFKIKPLLKSAETEKELQEMKGNYEKMKTDLAAALAKKKELEEKMVSLLQEKNDLQLQVAAETENLSDAEERCEGLIKSKIQLEAKLKETTERLEDEEEINAELTAKKRKLEDECSELKKDIDDLELTLAKVEKEKHATENKVKNLTEEMASQDESIAKLTKEKKALQEAHQQTLDDLQAEEDKVNTLTKAKTKLEQQVDDLEGSLEQEKKIRMDLERAKRKLEGDLKLAQESIMDLENDKQQSDEKIKKKDFEISQLLSKIEDEQSLGAQLQKKIKELQARIEELEEEIEAERAARAKVEKQRADLSRELEEISERLEEAGGATAAQIEMNKKREAEFQKLRRDLEESTLQHEATAAALRKKQADSVAELGEQIDNLQRVKQKLEKEKSEYKMEIDDLSSNMEAVAKSKGNLEKMCRTLEDQLSELKAKNDENVRQLNDINVQKARLQTENGEFARQLEEKEALVSQLTRGKQAFTQQIEELKRHVEEEVKAKNALAHAVQSARHDCDLLREQFEEEQEAKAELQRGMSKANSEVAQWRTKYETDAIQRTEELEESKKKLAQRLQEAEESIEAVNSKCASLEKTKQRLQGEVEDLMIDVERANALAANLDKKQRNFDKVLAEWKQKYEESQAELEGAQKEARSLSTELFKMKNSYEEALDQLETMKRENKNLQQEISDLTEQIGENGKSIHELEKAKKTVENEKIELQTALEEAEGTLEHEESKILRVQLELNQVKGEIDRKLAEKDEEMEQIKRNSQRVIESMQSTLDAEVRSRNDALRVKKKMEGDLNEMEIQLSHANRQAAEAQKQLRNVQGQLKDAQLHLDDALRGQEDMKEQVAMVERRNGLMLAEIEELRAALEQTERGRKVAEQELVDASERVALLHSQNTSLLNTKKKLEADFVQVQGEVDDAVQEARNAEEKAKKAITDAAMMAEELKKEQDTSSHLERMKKNLEVTVKDLQHRLDEAENLAMKGGKKQLQKLESRVRELEAEVETEQRRGADAVKGVRKYERRVKELTYQTEEDKKNVSRLQDLVDKLQLKVKAYKRQAEEAEEQANTHMARLRKVQHELEEAQERADIAETQVNKLRAKS 1912          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 3370.48 bits (8738), Expect = 0.000e+0
Identity = 1928/1943 (99.23%), Postives = 1928/1943 (99.23%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS               RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS---------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED 1928          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 3368.56 bits (8733), Expect = 0.000e+0
Identity = 1927/1943 (99.18%), Postives = 1927/1943 (99.18%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLS                RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLS----------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED 1927          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 3358.16 bits (8706), Expect = 0.000e+0
Identity = 1928/1967 (98.02%), Postives = 1928/1967 (98.02%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYM------------------------HRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYM                        HRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS               RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRVNYPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS---------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED 1952          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 3355.84 bits (8700), Expect = 0.000e+0
Identity = 1916/1943 (98.61%), Postives = 1920/1943 (98.82%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAED  + G +KKGG+  T+S  HRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS               RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSS---------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED 1928          
BLAST of Myosin heavy chain vs. Planmine SMEST
Match: SMESG000056451.1 (SMESG000056451.1)

HSP 1 Score: 3353.15 bits (8693), Expect = 0.000e+0
Identity = 1915/1943 (98.56%), Postives = 1919/1943 (98.76%), Query Frame = 1
Query:   43 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVXXXXXXXXXXXXXXXXXLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGXXXXXXXGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDXXXXXXXXXXXSFMTVSYMHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKXXXXXXXXXXNSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLXXXXXXXXXXXXXXHQXXXXXXXXXXXXXXQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQXXXXXXXXXXXXLRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGXXXXXXXXXXXXXXXXXXDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQXXXXXXXXXXXXXXQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKSQRAQLEISQARQXXXXXXXXXXXXXXGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMXXXXXXXXXXXXXXXXXLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIXXXXXXXXXXXXXXXNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNXXXXXXXXXXXXXPGTKISITATSIRSED 5871
            MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAED  + G +KKGG+  T+S  HRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLS                RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED
Sbjct:    1 MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETNGDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNLRQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIFSISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKDDDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTSGKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTADPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTSIMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVKVGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQFFIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEAIDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDNHLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNESVVGLLGASKECLVASLFAPAEDPSQSGKRKKGGAMQTISSTHRESLNKLMKNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGFPNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGNTKVFFKAGTLAQLEDIRDEKLS----------------RQYKKLQDQRVALSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLKEEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVLQKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESSLQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESLKAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELKQNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKELQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQTDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQLQKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQNKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQAQLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQLVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSKCSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKYSESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIHDLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQRAQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTEAMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQHHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAIDKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIFDNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKKALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKNQDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERADQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED 1927          
The following BLAST results are available for this feature:
BLAST of Myosin heavy chain vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYH60.000e+053.74myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH70.000e+053.79myosin heavy chain 7 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH80.000e+052.85myosin heavy chain 8 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH10.000e+052.74myosin heavy chain 1 [Source:HGNC Symbol;Acc:HGNC:... [more]
MYH20.000e+052.32myosin heavy chain 2 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myo-50.000e+053.37MYOsin heavy chain structural genes [Source:UniPr... [more]
unc-540.000e+053.12Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.12Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
unc-540.000e+053.12Myosin-4 [Source:UniProtKB/Swiss-Prot;Acc:P02566][more]
myo-30.000e+050.08Myosin-3 [Source:UniProtKB/Swiss-Prot;Acc:P12844][more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mhc0.000e+057.14gene:FBgn0264695 transcript:FBtr0301827[more]
Mhc0.000e+057.09gene:FBgn0264695 transcript:FBtr0307496[more]
Mhc0.000e+056.60gene:FBgn0264695 transcript:FBtr0080896[more]
Mhc0.000e+056.55gene:FBgn0264695 transcript:FBtr0080900[more]
Mhc0.000e+056.45gene:FBgn0264695 transcript:FBtr0080903[more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
myh7ba0.000e+052.71myosin, heavy chain 7B, cardiac muscle, beta a [So... [more]
myh7ba0.000e+052.84myosin, heavy chain 7B, cardiac muscle, beta a [So... [more]
myh7l0.000e+053.48myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
myh7l0.000e+053.48myosin heavy chain 7-like [Source:ZFIN;Acc:ZDB-GEN... [more]
smyhc20.000e+053.25slow myosin heavy chain 2 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pde1b0.000e+053.89phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
pde1b0.000e+054.13phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
pde1b0.000e+053.69phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
pde1b0.000e+052.82phosphodiesterase 1B [Source:Xenbase;Acc:XB-GENE-9... [more]
ENSXETT00000000925.10.000e+054.01myosin heavy chain 15 [Source:NCBI gene;Acc:100487... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Myh60.000e+053.84myosin, heavy polypeptide 6, cardiac muscle, alpha... [more]
Myh60.000e+053.84myosin, heavy polypeptide 6, cardiac muscle, alpha... [more]
Myh70.000e+053.82myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh70.000e+053.82myosin, heavy polypeptide 7, cardiac muscle, beta ... [more]
Myh80.000e+052.80myosin, heavy polypeptide 8, skeletal muscle, peri... [more]
back to top
BLAST of Myosin heavy chain vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P24733|MYS_ARGIR0.000e+063.92Myosin heavy chain, striated muscle OS=Argopecten ... [more]
sp|F1PT61|MYH16_CANLF0.000e+054.42Myosin-16 OS=Canis lupus familiaris OX=9615 GN=MYH... [more]
sp|P05661|MYSA_DROME0.000e+055.88Myosin heavy chain, muscle OS=Drosophila melanogas... [more]
sp|P02563|MYH6_RAT0.000e+053.95Myosin-6 OS=Rattus norvegicus OX=10116 GN=Myh6 PE=... [more]
sp|P49824|MYH7_CANLF0.000e+053.93Myosin-7 OS=Canis lupus familiaris OX=9615 GN=MYH7... [more]
back to top
BLAST of Myosin heavy chain vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O960630.000e+092.79Myosin heavy chain (Fragment) OS=Dugesia japonica ... [more]
O960620.000e+079.20Myosin heavy chain OS=Dugesia japonica OX=6161 GN=... [more]
A0A5K3EWP60.000e+072.53Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A068YE180.000e+072.58Myosin heavy chain OS=Echinococcus multilocularis ... [more]
A0A068WWT70.000e+072.58Myosin heavy chain OS=Echinococcus granulosus OX=6... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000010358.20.000e+053.79pep primary_assembly:Astyanax_mexicanus-2.0:23:342... [more]
myh7bb0.000e+052.35myosin, heavy chain 7B, cardiac muscle, beta b [So... [more]
MYH60.000e+052.21myosin heavy chain 6 [Source:HGNC Symbol;Acc:HGNC:... [more]
ENSAMXT00000001735.20.000e+052.55pep primary_assembly:Astyanax_mexicanus-2.0:9:3082... [more]
ENSAMXT00000042907.10.000e+052.83myosin heavy chain, fast skeletal muscle-like [Sou... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000002731.10.000e+052.67pep scaffold:Pmarinus_7.0:GL478284:11062:40470:1 g... [more]
ENSPMAT00000005582.10.000e+052.68pep scaffold:Pmarinus_7.0:GL481917:38212:72095:-1 ... [more]
ENSPMAT00000003821.10.000e+049.55pep scaffold:Pmarinus_7.0:GL477325:10535:35195:1 g... [more]
ENSPMAT00000004078.10.000e+058.25pep scaffold:Pmarinus_7.0:GL478761:5289:25008:-1 g... [more]
ENSPMAT00000005411.10.000e+055.22pep scaffold:Pmarinus_7.0:GL476612:1285:44967:1 ge... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MYO10.000e+037.67Type II myosin heavy chain; required for wild-type... [more]
MYO23.194e-15637.50Type V myosin motor involved in actin-based transp... [more]
MYO43.395e-15135.60Type V myosin motor involved in actin-based transp... [more]
MYO51.007e-11734.05One of two type I myosin motors; contains proline-... [more]
MYO32.178e-11633.76One of two type I myosins; localizes to actin cort... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
MYHC-ST0.000e+060.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO418196.952e-15937.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495152.312e-13536.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO455636.335e-13535.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO360374.891e-12632.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin heavy chain vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vmhc0.000e+053.45ventricular myosin heavy chain [Source:NCBI gene;A... [more]
myh60.000e+053.46myosin, heavy chain 6, cardiac muscle, alpha [Sour... [more]
ENSORLT00000007991.20.000e+052.34myosin heavy chain, fast skeletal muscle [Source:N... [more]
ENSORLT00000016518.20.000e+052.67myosin-7 [Source:NCBI gene;Acc:101164097][more]
ENSORLT00000002485.20.000e+052.04myosin heavy chain, fast skeletal muscle [Source:N... [more]
back to top
BLAST of Myosin heavy chain vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000056451.10.000e+099.23SMESG000056451.1[more]
SMESG000056451.10.000e+099.18SMESG000056451.1[more]
SMESG000056451.10.000e+098.02SMESG000056451.1[more]
SMESG000056451.10.000e+098.61SMESG000056451.1[more]
SMESG000056451.10.000e+098.56SMESG000056451.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016281 ID=SMED30016281|Name=Myosin heavy chain|organism=Schmidtea mediterranea sexual|type=transcript|length=5986bp
CTAAAATTTAGTTGATTTCGATTGTTTGAATAAAAATATCTAATGGACCC
ATCAGATCCTGATTTTATCTACTTGGGAGTCGACAGGAAAGCTTTATTGA
AGCAATATGGCGACTCGTTTGATAGTAAAAAGAACATGTGGATACCGGAT
GAAAAGGAGGGGTACATCGCAATTACCGTTGAAGAAACAAATGGCGATAA
AGTAACTGTTAAAACCGATAAAGGAGAAACTAAAGTCGTCAAGCAAGACT
CCTTGGAACAAATGAATCCCCCCAAATTCATGATGATTGAAGACATGGCG
AATTTAACATTTCTCAATGATGCCAGTGTATTTGATAATCTGAGACAAAG
ATATTACAAAAATCTGATTTATACTTACTCCGGACTGTTCTGTATTGCAG
TGAATCCTTATCGAAGATTTCCGATTTATACGTCCCAAGTAATTATGAAA
TATAAAGGAAAACGTAGAGGAGAAATGCCACCGCATATTTTCTCAATTTC
GGATAATGCTTACTCAAATATGCTTGTCGATCGAGAAAATCAGTCTGTTT
TGATTACTGGAGAAAGTGGTGCTGGGAAAACTGAAAACACGAAAAAAGTT
ATTACTTACTTCGCCAATGTAGCAGCAGCAAGTAAAAAAGATGATGACGA
TCCATCGAAGAAAAAAGGTTCATTGGAAGATCAAATTGTACAAGCCAATC
CTGTACTGGAGGCATACGGAAACGCCAAAACAACTAGAAATAATAATTCG
TCAAGATTTGGAAAATTCATCCGAATTCATTTTGGCACTAGTGGAAAAAT
TGCAGGAGCTGATATTGAGTTTTATTTGTTGGAGAAATCTCGTGTTATCT
CACAGCAAAAAGGAGAAAGAAATTACCATATTTTCTATCAATTGCTTTCG
GCAGGAGGGAAAAGTTACCACGATAAACTTTTGGTTACTGCTGATCCTGC
TCTGTTTTCTTTTATCAACCAAGGAGAATTGACGATTGACGGTGTTGATG
ATGAGGAAGAAATGAAACTTACTGATGAAGCCTTTAGTATTCTTGGGTTT
TCCGATGAAGAGAAAATGAGTTTGTTTAAATGCACTACTTCAATCATGAA
TATGGGAGAAATGAAATTTAAACAAAGACCCCGTGAAGAACAAGCCGAGG
CTGATGGTACAACAGAAGCTGAAAAAGTCTCTTTCTTACTTGGAGTGAAT
GCCAAAGATCTAATGCAAGCAATTCTTAAACCCAAAGTCAAAGTAGGAAA
CGAATATGTAACGAAAGGTCAAAGCAAAGATCAGGTTTTATATTCTCTTG
GAGCCTTAGCAAAATCTTTATATAACAGAATGTTTGCTTGGTTGGTTACT
CGCGTGAACAAAACGCTGGACACAAAAGTCAAAAGACAGTTTTTCATTGG
TGTCTTAGATATTGCCGGATTTGAAATATTTGATTTCAATGGTTTCGAAC
AAATTTGTATCAACTATACTAATGAGAGACTCCAACAATTTTTCAATCAC
CATATGTTTGTTCTTGAACAAGAGGAATATAAAAAAGAGGCCATTGACTG
GGAGTTCATAGATTTTGGAATGGATCTCCAAGCTTGCATTGAGTTGATTG
AAAAGCCTATGGGTATTTTGTCGATTTTAGAGGAAGAATGTATGTTTCCC
AAAGCAAGCGATCAAACATTGAAAGCTAAATTGTACGATAATCACTTGGG
TAAAAGTCCGAATTTCGGAAAACCAAAACCACCAAAACCAGGACAACACG
AAGCCCATTTCGAATTACATCATTATGCTGGCAGTGTTCCATATAATATT
ACTGGGTGGTTGGAGAAAAATAAGGATCCATTGAACGAAAGTGTTGTTGG
ATTACTCGGAGCATCTAAAGAATGTCTAGTAGCTTCTTTATTTGCACCGG
CTGAAGATACAGGAAAACCCGGAACCAAGAAAAAGGGTGGATCCTTTATG
ACTGTGTCATATATGCACAGGGAATCATTGAATAAATTGATGAAAAATCT
AATGAGTACAAGTCCACATTTTATTCGTTGCATTGTCCCCAATGAATTCA
AACAACCAGGAGTTGTTGATGCGCATTTGGTTATGCACCAACTTCATTGC
AACGGTGTATTGGAAGGTATTAGGATTTGCAGAAAAGGATTCCCAAATAG
AATGATCTATTCTGAATTCAAACAAAGATATTCAATTTTGGCACCGAATG
CCATTCCACAAGGATTTGTTGAAGGCAAACAGGTCACTGATAAAATCCTC
ACAGCCATTCAACTGGACACAAATCTTTATCGCTTAGGAAATACCAAAGT
ATTTTTTAAAGCTGGAACATTGGCTCAACTTGAAGATATAAGAGACGAGA
AACTTTCGTCGTTGATATCGTTGTTTCAAGCTCAAATTAGGGGATATTTA
ATGAGACGGCAATACAAAAAACTTCAAGATCAAAGAGTTGCTCTGTCTTT
GATTCAAAGAAATATTAGAAAATATTTGGTTTTGAGAACATGGACCTGGT
GGAAATTGTTCACTAAAGTAAAGCCTATGCTTAATATTGCTCGCCAAGAA
GAAGAAATGAAAAAGGCAGCCGAAGAATTAGAAAAGCTGAAAGAGGAATT
TGAAAAAACTGAAAAATATAAGAAAGAACTTGAAGAACAAAATGTTACTT
TACTTCAAGCAAAGAACGATTTATTCTTGCAGTTGCAAACTGAACAAGAT
AGTTTAGCTGACGCTGAAGAGAAAGTATCTAAATTAGTTCTACAAAAGGC
TGACATGGAAGGAAGAATTAAAGAACTTGAGGACTCACTTTCAGAAGAAG
AAAATTCAGCTTCAACATTAGAAGAAGCAAAAAAGAAACTCAATGCTGAC
ATCGATGAATTGAAGAAAGATGTTGAAGATTTGGAATCATCTTTACAAAA
AGCAGAACAAGAAAAAGTTGCAAAGGATCAGCAGATTAAATCCCTCAACG
ACAATGTTCGTGAAAAAGAAGAACAATTAGCCAAAATGCAAAAGGAAAAG
AAAGCTGCTGATGAATTACAAAAAAAAACAGAAGAATCATTGAAAGCCGA
AGAAGAGAAAGTCAGTAACCTCAATAAAGCTAAAGCTAAATTAGAACAAG
CCCTGGATGAAATGGAAGAAAATCTTGGTCGAGAACAAAAAATTAGAGCA
GATGTTGAAAAAGCAAAACGAAAAGTTGAAGGTGAACTTAAACAGAATCA
AGAGTTATTAAATGACTTGGAGCGCATAAAATCCGAACTTGAGGAACAAT
TAAAACGAAAAGAAATTGAATTGAATGGTGCTAACTCTAAAATCGAAGAT
GAATCTAATTTAGTTGCAACACTTCAACGGAAGATCAAAGAACTTCAAGC
CAGAATCCAAGAATTAGAAGAAGACCTTGAGGCGGAAAGACAAGCAAGGG
CAAAAGCTGAGAAAGCTAAACATCAATTGGAAGCGGAACTTGAGGAAATC
AGTGAAAGACTAGAAGAACAAGGAGGTGCAACTCAAGCCCAAACAGATTT
AAATAAAAAACGAGAAGCTGAACTCATAAAATTAAAGCGAGACTTGGAAG
AGGCTAATATGCAACACGAACAAGCCTTGGTGCAAATGAGAAAGAAACAA
CAAGATACTAGCAATGAATTCGCAGATCAGTTAGATCAATTGCAAAAATC
AAAATCAAAGATTGAAAGAGAAAAGAGTGAACTTAGAGCAGACATTGAAG
ATTTATCAAGTCAGCTGGAATCACTGAATAAGACCAAGGGAAATCTTGAA
AAGTCAAATAAAGCATTAGAAACCACAGTTTCAGATCTTCAAAACAAACT
CGATGAATTAAGCAGACAATTGACAGAAGCAGGAAACGTCAACAATCGAA
ATCAACATGAAAATAGTGAAATGCACAAAACCTTAGAAGACGCCGAATCA
CAAATAAACCAACTCGGAAAGGCTAAACAACAACTCCAAGCGCAGCTAGA
AGAGGCTAAACAAAATTTGGAAGATGAATCACGCGCAAAAGCAAAACTTA
ATGGAGATTTAAGAAATGCGATGAGTGATTTAGATGCATTACGGGAATCA
TTGGAAGAAGAACAAGAAGGCAAAAGCGATGTTCAAAGACAGCTTGTGAA
AGTCCAAAATGAATTACAGCAACTTAAAGCAAATTCTCAAGGTACTGGAG
GAGTGAGAACAGAAGAAATGGAAGAATTCAGACGAAAGATGAATGCCAGA
ATCCAAGAACTAGAAGAAGAATCGGAATCAAATAAATCTAAATGCAGTCA
ATTAGAAAAAATGAAATCCAGACTTCAAGGAGAAATTGAAGATTTAGTGA
TAGATGTTGAAAGAGCCAATGGATTAGCATCGCAACTGGAAAAGAAACAG
AAAAATGTTGACAAATTAATAGGCGAATGGCAAAAAAAATATTCAGAAAG
TCAACAGGAACTAGAAGTATCACTGAGAGAATCAAGAACAGTTTCCGCTG
AAGTTTTCAAATTGAAATCACAATTAGAAAATTCTCAAGATCAAATCGAA
AGTTTAAGAAGAGAAAATAAAAATCTATCTGATGAAATTCATGACTTAAC
TGAACAATTGGGAGAAGGAGGACGAAATGTACATGAAATTGAAAAGACTC
GAAAAAGAATTGAAATTGAAAGAGATGAATTACAACATGCATTAGAAGAA
GCTGAATCAGCTTTGGAACAAGAAGAAGCTAAAAGCCAAAGAGCTCAGTT
AGAAATAAGTCAAGCCCGTCAAGAATCTGAAAGAAGACTTGCAGAAAAAG
AAGAAGAATTTGAAGGTACACGAAAAAATCATCAACGAACACTCGAATCC
ATGCAAGCATCTCTTGAAGCTGAAGTTAGAGGACGAACTGAAGCAATGAA
AATGAAAAAGAAGCTGGAGCATGATATTAATGAGCTTGAAGTTGGGTTAG
ACACGGCTAATAGACTGAAATCTGAACAAGAGAAAAATGCTAAGAAATAT
CAGCAACAATTAGCAGAAATGCAAGCTCAAGTTGAAGAACAGCATCATCA
ACGAGAGCAAGTTAGTGAACAGCTTGCGTTAACAGAACGAAAATTAGGTA
TGATGCACGGAGAGCTGGAGGAAATGAAAAATATGTGTGATCATGCTGAA
AAAAATAGAAAAGTCGCTGAATCTGAAAAGAATGAAGCCATTGATAAACT
AAATGAGTTTTCAATTCAAAATTCTTCATTCATGGCAACTAAAAGAAAGA
TGGAAGCAGATTTAGCAGCAATGCAAGCTGACTTAGAAGAATCTACAAAT
GCAGCTAGACAAGCTAATGAACAATTGAAAAAGGCAATATTTGATAATAC
TCGACTTTTCGATGAAATTAAACAAGAACAAGAACATGCTCAACAAGCTG
AAAAAGCAAGAAAGAATTTGGAGAGCCAGTTGAAAGAATTGCAATCAAAA
CTTGAAGAAGCAGAAGCAAATGTACTTAAAGGAGGCAAAAAGGCTTTGAG
TAAATTAGAGCAAAGAATAAGGGAATTGGAAGGCGAACTAGATGGTGAAC
AAAAACGACATGTTGAAACTCAAAAGAATGCTAGAAAGTCAGATAGGCGA
CTGAAAGAAATTTCGTACCAGATCGACGAGGATAAAAAGAATCAAGATCG
AATGCAACAACTTATTGAAAGTTTACAAGCAAAAATAAAGACTTATAAAC
GACAAGTAGAAGAAGCTGAAGAAATCGCTGCTGTGAATTTGGCAAAATAT
CGCAAAATTCAACAAGAGATTGAAGATTCTGAAGAGCGAGCTGATCAAGC
TGAACAAGCTTTACAAAAATTAAGAGCAAAGAATAGAAGCTCGGTATCTG
TTAGTCGAGGAGCAAGTTCTGGACCTGGAACCAAAATTTCTATAACTGCG
ACATCAATCCGCAGTGAGGACTAATCTGACAGAAAAAATTCATCATTAGG
AAATATGCAATTAGTTAGCCAATATTTCCCTTAGACTAGATTTTAAACCT
TTAAGACATTTTTTTCAAATTAATAAAACGTTTTGA
back to top

protein sequence of SMED30016281-orf-1

>SMED30016281-orf-1 ID=SMED30016281-orf-1|Name=SMED30016281-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1944bp
MDPSDPDFIYLGVDRKALLKQYGDSFDSKKNMWIPDEKEGYIAITVEETN
GDKVTVKTDKGETKVVKQDSLEQMNPPKFMMIEDMANLTFLNDASVFDNL
RQRYYKNLIYTYSGLFCIAVNPYRRFPIYTSQVIMKYKGKRRGEMPPHIF
SISDNAYSNMLVDRENQSVLITGESGAGKTENTKKVITYFANVAAASKKD
DDDPSKKKGSLEDQIVQANPVLEAYGNAKTTRNNNSSRFGKFIRIHFGTS
GKIAGADIEFYLLEKSRVISQQKGERNYHIFYQLLSAGGKSYHDKLLVTA
DPALFSFINQGELTIDGVDDEEEMKLTDEAFSILGFSDEEKMSLFKCTTS
IMNMGEMKFKQRPREEQAEADGTTEAEKVSFLLGVNAKDLMQAILKPKVK
VGNEYVTKGQSKDQVLYSLGALAKSLYNRMFAWLVTRVNKTLDTKVKRQF
FIGVLDIAGFEIFDFNGFEQICINYTNERLQQFFNHHMFVLEQEEYKKEA
IDWEFIDFGMDLQACIELIEKPMGILSILEEECMFPKASDQTLKAKLYDN
HLGKSPNFGKPKPPKPGQHEAHFELHHYAGSVPYNITGWLEKNKDPLNES
VVGLLGASKECLVASLFAPAEDTGKPGTKKKGGSFMTVSYMHRESLNKLM
KNLMSTSPHFIRCIVPNEFKQPGVVDAHLVMHQLHCNGVLEGIRICRKGF
PNRMIYSEFKQRYSILAPNAIPQGFVEGKQVTDKILTAIQLDTNLYRLGN
TKVFFKAGTLAQLEDIRDEKLSSLISLFQAQIRGYLMRRQYKKLQDQRVA
LSLIQRNIRKYLVLRTWTWWKLFTKVKPMLNIARQEEEMKKAAEELEKLK
EEFEKTEKYKKELEEQNVTLLQAKNDLFLQLQTEQDSLADAEEKVSKLVL
QKADMEGRIKELEDSLSEEENSASTLEEAKKKLNADIDELKKDVEDLESS
LQKAEQEKVAKDQQIKSLNDNVREKEEQLAKMQKEKKAADELQKKTEESL
KAEEEKVSNLNKAKAKLEQALDEMEENLGREQKIRADVEKAKRKVEGELK
QNQELLNDLERIKSELEEQLKRKEIELNGANSKIEDESNLVATLQRKIKE
LQARIQELEEDLEAERQARAKAEKAKHQLEAELEEISERLEEQGGATQAQ
TDLNKKREAELIKLKRDLEEANMQHEQALVQMRKKQQDTSNEFADQLDQL
QKSKSKIEREKSELRADIEDLSSQLESLNKTKGNLEKSNKALETTVSDLQ
NKLDELSRQLTEAGNVNNRNQHENSEMHKTLEDAESQINQLGKAKQQLQA
QLEEAKQNLEDESRAKAKLNGDLRNAMSDLDALRESLEEEQEGKSDVQRQ
LVKVQNELQQLKANSQGTGGVRTEEMEEFRRKMNARIQELEEESESNKSK
CSQLEKMKSRLQGEIEDLVIDVERANGLASQLEKKQKNVDKLIGEWQKKY
SESQQELEVSLRESRTVSAEVFKLKSQLENSQDQIESLRRENKNLSDEIH
DLTEQLGEGGRNVHEIEKTRKRIEIERDELQHALEEAESALEQEEAKSQR
AQLEISQARQESERRLAEKEEEFEGTRKNHQRTLESMQASLEAEVRGRTE
AMKMKKKLEHDINELEVGLDTANRLKSEQEKNAKKYQQQLAEMQAQVEEQ
HHQREQVSEQLALTERKLGMMHGELEEMKNMCDHAEKNRKVAESEKNEAI
DKLNEFSIQNSSFMATKRKMEADLAAMQADLEESTNAARQANEQLKKAIF
DNTRLFDEIKQEQEHAQQAEKARKNLESQLKELQSKLEEAEANVLKGGKK
ALSKLEQRIRELEGELDGEQKRHVETQKNARKSDRRLKEISYQIDEDKKN
QDRMQQLIESLQAKIKTYKRQVEEAEEIAAVNLAKYRKIQQEIEDSEERA
DQAEQALQKLRAKNRSSVSVSRGASSGPGTKISITATSIRSED*
back to top
Aliases
The feature 'Myosin heavy chain' has the following synonyms
Synonym
Dj-mhc
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0051015actin filament binding
GO:0005524ATP binding
GO:0003774motor activity
GO:0005515protein binding
GO:0004222metalloendopeptidase activity
GO:0000166nucleotide binding
GO:0003779actin binding
GO:0016597amino acid binding
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000061enteric musculature
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000240body wall musculature
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0002028dorsal-ventral muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0004520embryonic pharynx radial muscle cell
PLANA:0004524embryonic pharynx circular muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR001609Myosin_head_motor_dom
IPR000048IQ_motif_EF-hand-BS
IPR027401Myosin_IQ_contain_sf
IPR004009Myosin_N
IPR002928Myosin_tail
IPR027417P-loop_NTPase
IPR001590Peptidase_M12B
Vocabulary: cellular component
TermDefinition
GO:0016459myosin complex
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 931..1043
NoneNo IPR availableCOILSCoilCoilcoord: 1058..1092
NoneNo IPR availableCOILSCoilCoilcoord: 43..360
NoneNo IPR availableCOILSCoilCoilcoord: 727..793
NoneNo IPR availableCOILSCoilCoilcoord: 819..881
NoneNo IPR availableCOILSCoilCoilcoord: 488..578
NoneNo IPR availableCOILSCoilCoilcoord: 889..923
NoneNo IPR availableCOILSCoilCoilcoord: 368..480
NoneNo IPR availableCOILSCoilCoilcoord: 1100..1127
NoneNo IPR availableCOILSCoilCoilcoord: 685..719
NoneNo IPR availableCOILSCoilCoilcoord: 587..659
NoneNo IPR availableGENE3DG3DSA:1.20.5.340coord: 42..167
e-value: 7.3E-36
score: 125.0
coord: 278..390
e-value: 1.6E-5
score: 26.9
NoneNo IPR availableGENE3DG3DSA:1.20.5.1050coord: 168..277
e-value: 9.3E-6
score: 27.7
NoneNo IPR availableGENE3DG3DSA:1.20.5.370coord: 780..826
e-value: 5.6E-11
score: 44.4
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 772..795
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 159..223
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1123..1157
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 391..433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 772..796
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 393..412
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 413..433
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1027..1052
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 346..370
NoneNo IPR availablePANTHERPTHR34491:SF5coord: 1..1131
NoneNo IPR availablePANTHERPTHR34491FAMILY NOT NAMEDcoord: 1..1131
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 634..755
NoneNo IPR availableSUPERFAMILYSSF57997Tropomyosincoord: 935..1129
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 42..167
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 438..555
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 157..274
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 834..948
NoneNo IPR availableSUPERFAMILYSSF90257Myosin rod fragmentscoord: 270..357
IPR027401Myosin IQ motif-containing domain superfamilyGENE3DG3DSA:4.10.270.10coord: 1..41
e-value: 4.4E-17
score: 64.0
IPR002928Myosin tailPFAMPF01576Myosin_tail_1coord: 47..1127
e-value: 1.0E-166
score: 556.8