TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30016277
Length (bp)2019
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30016277) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30016277) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30016277) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30016277) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016277

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016277SMESG000015087.1 dd_Smed_v4_2354_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.003 bits (149), Expect = 1.896e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  230 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 446          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.003 bits (149), Expect = 2.212e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  288 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.003 bits (149), Expect = 2.212e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  288 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.003 bits (149), Expect = 2.393e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  313 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 62.003 bits (149), Expect = 2.393e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  313 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 63.1586 bits (152), Expect = 6.911e-10
Identity = 38/148 (25.68%), Postives = 72/148 (48.65%), Query Frame = 1
Query: 1342 NENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFI------YSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            +++   + D ++ ++ +K+  +ET   N    G   WKI +  +++++  +      YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G   +     +   PS + + +P  + N
Sbjct:  393 HDDLMSVHDVRLAEMDLKLQVLETASFN----GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTL--MLMDQGPARKHLGDAFKPDPSSSSFRRPTGEMN 534          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: BX901915.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:28768979:-1 gene:ENSDARG00000109857.1 transcript:ENSDART00000191629.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX901915.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.566e-7
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  104 LRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 238          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: AL844899.1 (pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28760787:-1 gene:ENSDARG00000111038.1 transcript:ENSDART00000183806.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL844899.1)

HSP 1 Score: 52.7582 bits (125), Expect = 4.566e-7
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  104 LRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 238          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 51.9878 bits (123), Expect = 1.937e-6
Identity = 52/216 (24.07%), Postives = 101/216 (46.76%), Query Frame = 1
Query: 1174 LRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLK-------IKMMEMETKL---INAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            L  E  K+ ++  R +++EL    F+ +    N E++   + ++  ++++      +++  +I++ K+  L+       + ++EME K+     A   G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  332 LHSEKTKVVELSRRCQELELKVNTFENIVCVLNREMERSATTMEAYNRQHR----LDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 538          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf5 (Tnf receptor-associated factor 5 [Source:ZFIN;Acc:ZDB-GENE-071120-3])

HSP 1 Score: 50.447 bits (119), Expect = 2.758e-6
Identity = 54/239 (22.59%), Postives = 101/239 (42.26%), Query Frame = 1
Query: 1159 ELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLL-KQEKDKFIYSNPFFSGPSGYKMCLSVI----QSSRG-QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN--EGIQIYNIPCD------AFVNGNDQLLIKCRVE 1833
            EL   L R    ++ +  +    E L++H   L+Q      +LL     +IH +   C               N+ +++ +E      ++   GK  WK+ +   ++E    + S+PF++  SGYK+ +        S RG  + +   ++RG+++  L WPF+  +T+  +       + S T    D  SD+ + +P  D N   G   +   CD      A    ++ L IK +V+
Sbjct:   44 ELKEELPRLQASLDSLRQQVAVTESLREHLGALEQTCERHTRLL-----DIHVEQLQC---------------NEQRLRQLE------SSSYDGKLIWKVRDYWHRKESGAALSSSPFYTSRSGYKLSVRAYLGGDGSGRGSHMSLYITIMRGDFDSFLPWPFRQNITLTLLDQSGTRNHMSHTF-IPDVNSDS-FHRPTSDANVATGFTRFISHCDLENPRNAVFVRDETLFIKVKVD 254          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 59.6918 bits (143), Expect = 7.622e-9
Identity = 48/175 (27.43%), Postives = 82/175 (46.86%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLI-NAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN--EGIQIY------NIPCDAFVNGNDQLLIKCRVE 1833
            M D+ +  +EM +  +      G F WKI +L  +  D        +YS  F++   GYK+CL +  +  G      + + F +++GEY+  L WPFK+ VT   +   N    R S    + RP  + A + +P++D N   G  ++      N P  A++  N  L I+C ++
Sbjct:  208 MKDIVLNELEMRSACLEQTSYDGVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNN----RDSVFD-AFRPDVTSASFQRPINDMNVASGCPLFCPIAKLNSPKHAYIREN-TLYIRCIID 376          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 59.3066 bits (142), Expect = 1.419e-8
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 1360 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  V++  +    G   R     +   P+ + + KP  + N
Sbjct:  362 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSL--MLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMN 497          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 59.3066 bits (142), Expect = 1.518e-8
Identity = 38/142 (26.76%), Postives = 68/142 (47.89%), Query Frame = 1
Query: 1360 IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  V++  +    G   R     +   P+ + + KP  + N
Sbjct:  387 VHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSL--MLMDQGPSRRHLGDAFKPDPNSSSFKKPTGEMN 522          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 54.299 bits (129), Expect = 4.794e-7
Identity = 49/199 (24.62%), Postives = 83/199 (41.71%), Query Frame = 1
Query: 1309 IHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIEN---LLK---QEKDKFIYSNPFFSGPSGYKMCLSV------IQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 1848
            I K    C   NE     +   +  L  ++ EME++  +    G F W+I N   LLK   +E+   I+S  F++G  GYK+CL +       Q     I +  H ++GEY+  L WP +  + +  +    G   +        +P    + +P   RN         + +  +    +V  ND LL++C V    +L
Sbjct:  353 IAKMETQCTYVNE-----LKHTIRSLDNRLGEMESQQCS----GIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILDQSEGVAMQDQEEVMDTKPELLAFQRPTVARNPKGFGYVTFMHLQALKQRQYVK-NDTLLVRCSVTTHLDL 541          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 1.054e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  287 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 1.054e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  287 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 62.7734 bits (151), Expect = 1.055e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  312 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 55.0694 bits (131), Expect = 2.039e-7
Identity = 55/205 (26.83%), Postives = 91/205 (44.39%), Query Frame = 1
Query: 1276 EVKLLRSG--IDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIEN----LLKQEKDK--FIYSNPFFSGPSGYKMC------LSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN-EGI-QIYNIPCDAFVNG----NDQLLIKCRV 1830
            E +L+R    I E+  K E  +M      + I      L+ K+ EME +  N    G + WKI N    L  QE+++   I+S  F++G  GYK+C      L   Q     I +  H ++GEY+  L WPF+  + +  +      I ++       +P    + +P   RN +G   +  +  +A   G    +D LL++C V
Sbjct:  311 ESRLVRQDHQIRELTAKMETQSMYVGELKRTI----RTLEDKVAEMEAQQCN----GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEALIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q60803|TRAF3_MOUSE (TNF receptor-associated factor 3 OS=Mus musculus OX=10090 GN=Traf3 PE=1 SV=2)

HSP 1 Score: 62.7734 bits (151), Expect = 7.380e-9
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  312 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q13114|TRAF3_HUMAN (TNF receptor-associated factor 3 OS=Homo sapiens OX=9606 GN=TRAF3 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 1.149e-8
Identity = 57/234 (24.36%), Postives = 103/234 (44.02%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSK------IIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            + KIL ++R   +   +  EL++ +R       Q W   E+ + +K   + LQ    + V  L S      +   N  +     S+      + D ++ D+ ++   +ET   N    G   WKI +  +++++        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G+  R     +   P+ + + KP  + N
Sbjct:  313 ESKILHLQRVIDSQAEKLKELDKEIR----PFRQNW---EEADSMKSSVESLQ----NRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTL--MLMDQGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q6DJN2|TRF6B_XENLA (TNF receptor-associated factor 6-B OS=Xenopus laevis OX=8355 GN=traf6-b PE=2 SV=1)

HSP 1 Score: 56.225 bits (134), Expect = 7.499e-7
Identity = 44/174 (25.29%), Postives = 75/174 (43.10%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKL--INAEIC-GKFEWKIENLL------KQEKDKFIYSNPFFSGPSGYKMCLSV------IQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRV 1830
            +N+LK  +  +E KL  ++   C G F WKI+         ++EK   I+S  F++G  GYK+CL +       Q     I +  H ++GEY+  L WP    + +  +    G I +        +P    + +P   RN         + +  +    +V  ND L ++C V
Sbjct:  361 VNELKHTIRSLEDKLLDVDGHHCNGVFIWKIKGFSGLQKTQEEEKPVVIHSPGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLHGTIRLSILDQSEGAIIQDQEEVMDTKPDLLAFQRPTTQRNPKGFGYVTFMHLNTLKQRQYVK-NDTLFVRCAV 533          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 8.397e-7
Identity = 46/174 (26.44%), Postives = 83/174 (47.70%), Query Frame = 1
Query: 1375 MNDLK--IKMMEMETKLINAEIC-GKFEWKIEN----LLKQEKDK--FIYSNPFFSGPSGYKMC----LSVIQSSRGQIFVSF--HLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEG-------IQIYNIPCDAFVNGNDQLLIKCRV 1830
            +N+LK  I+ +E +   I A+ C G + WKI N    L  QE++K   I+S  F++G  GYK+C    L +  + R   ++S   H ++GEY+  L WPF+  + +  +      + ++       +P    + +P   RN         + +  +    F+  +D LL++C V
Sbjct:  347 VNELKRTIRTLEDKVAEIEAQQCNGIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAAVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIK-DDTLLVRCEV 519          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 55.8398 bits (133), Expect = 9.833e-7
Identity = 52/195 (26.67%), Postives = 86/195 (44.10%), Query Frame = 1
Query: 1300 IDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIEN----LLKQEKDK--FIYSNPFFSGPSGYKMC------LSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN-EGI-QIYNIPCDAFVNG----NDQLLIKCRV 1830
            I E+  K E  +M      + I      L+ K+ EME +  N    G + WKI N    L  QE+++   I+S  F++G  GYK+C      L   Q     I +  H ++GEY+  L WPF+  + +  +      I ++       +P    + +P   RN +G   +  +  +A   G    +D LL++C V
Sbjct:  321 IRELTAKMETQSMHVSELKRTI----RSLEDKVAEMEAQQCN----GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILDQSEAVIRQNHEEVMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQGTFIKDDTLLVRCEV 507          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 127.872 bits (320), Expect = 6.698e-30
Identity = 59/163 (36.20%), Postives = 99/163 (60.74%), Query Frame = 3
Query:   96 CNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKINV-NHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKF 581
            C++C  L++ AC + CGC FCS CI +Y+   + +CPG +  C+   + + ++I  DY V+ +I +  VKCP+E C+   EL  IE H++ C M+  +CPF V+GC + +++I ++  HL N  ++HS L+ID I+N   +   L  + +EL+ + N  K  F
Sbjct:   27 CDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRNDFFGLTTKEVELREDINLIKNHF 189          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 7.185e-18
Identity = 52/156 (33.33%), Postives = 83/156 (53.21%), Query Frame = 3
Query:   96 CNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKINV-NHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMEN 560
            C +CN+LM  AC + CGC +C  CI  YL     +CPG    C+   +N+   +  +  +S RI+  +VKCP   C + +EL  ++ H+  C    + CP   IGCE+  ++  EM  HL++   RH+ L++    +F  E++S  N N E   E+
Sbjct:   31 CILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIM----SFCNELKSEINHNNETTKED 182          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 1.517e-14
Identity = 43/135 (31.85%), Postives = 81/135 (60.00%), Query Frame = 3
Query:  249 HISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLK--------------NENIELKMENNQFKQKFANIELQWANQ 611
            +I +DYP++++I +  VKC +++C +  ELR +E+H + C  R ++CP++ IGC+K  I   ++  HL ++ + H+ LL+D + NF  E+E LK              NE  ELK++ ++ + +  +++ + ANQ
Sbjct:   15 NICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQ 149          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0L8HQP6 (MATH domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22008610mg PE=4 SV=1)

HSP 1 Score: 73.9442 bits (180), Expect = 3.698e-10
Identity = 58/203 (28.57%), Postives = 100/203 (49.26%), Query Frame = 1
Query: 1216 NEQIELLKQHFKQLQQEHNDEVKLLRS--GIDEIHKKNENCAMANENFSKI--IDGKMNDLKIKMMEMETKLI-------NAEICGKFE----WKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDR----PSDARWGKPVDDRN 1752
             E++ +L Q  ++L++  + +V++L+S   I ++        + ++  +++  ID ++    +++ EM +KL        +AE+  K      WK  + LK  K  FIYS PF+S   GYKMC  V  +  G      +   F +++GEY++ LTWPFK+ VT+  +    G         YSDR    P+   + KP  D N
Sbjct:  179 TEKLIVLDQDLQRLKEGTDKQVQILKSKESITDMTTIQNLSTLIDQLLTQVTSIDRQIGLHDMRIEEMNSKLTSVTHPNYDAEVLMKISNYSRWK--SALKTSKTSFIYSEPFYSSKYGYKMCAKVYLNGDGIGKGTHLSFYFTIMKGEYDNILTWPFKHKVTLTVLDQFGGE------KNYSDRFLPDPNSKSFHKPSSDYN 373          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A2B4SA99 (TNF receptor-associated factor 6-B OS=Stylophora pistillata OX=50429 GN=traf6-b PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.522e-9
Identity = 45/175 (25.71%), Postives = 83/175 (47.43%), Query Frame = 1
Query: 1261 QEHNDEVKLLRS----GIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSV----IQSSRG-QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPV 1740
             EH++E+ LLR      +D +HK                      +++K+++   +L N    G++ WKIEN+ +  +D        +YS  F++ P GYKMCL +    ++S  G  + +  H++RG+++  L WPF  G T+  +    G++    T     +P  + + +PV
Sbjct:  299 HEHSNEIDLLRHQLKETLDRVHKLK--------------------VEVKLLQQGQQLCN----GQYIWKIENMDRCCQDAVSGVSPVMYSPGFYTSPCGYKMCLRINLNGVKSGVGTHVALHVHMMRGDHDKHLEWPFSKGFTLSIVDQSEGSLQYHITKTVVTKPEPSVFQRPV 449          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: ENSAMXT00000035169.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:3354744:3362219:1 gene:ENSAMXG00000029095.1 transcript:ENSAMXT00000035169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.923e-7
Identity = 28/81 (34.57%), Postives = 43/81 (53.09%), Query Frame = 1
Query: 1438 GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 1647
            G   WKI +  +++ +        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+
Sbjct:    4 GTLIWKIRDYKRRKAEAVASKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTL 84          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:103028261])

HSP 1 Score: 52.373 bits (124), Expect = 1.102e-6
Identity = 33/105 (31.43%), Postives = 52/105 (49.52%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLINAEIC---GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 1647
            M DL++   E E  L   + C   G F WKI +  ++ +D        ++S  F+S   GYKMCL +  +  G      + + F ++RG+Y+  L WPF   VT+
Sbjct:  360 MRDLQLA--ESEQALRELQFCTYDGVFVWKISDFSRRRQDALAGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGSHLSLFFVVMRGKYDALLKWPFSQKVTL 462          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 51.6026 bits (122), Expect = 2.454e-6
Identity = 52/216 (24.07%), Postives = 101/216 (46.76%), Query Frame = 1
Query: 1174 LRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLK-------IKMMEMETKL---INAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            L  E  K+ ++  R +++EL    F+ +    N E++   + ++  ++++      +++  +I++ K+  L+       + ++EME K+     A   G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  329 LHSEKTKVAELSRRCQELELKVGTFENIVCVLNREMERSATTMEAYNRQHR----LDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 535          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 50.8322 bits (120), Expect = 4.210e-6
Identity = 52/248 (20.97%), Postives = 111/248 (44.76%), Query Frame = 1
Query: 1141 SMRETDELNRLLRRETEKINQIWPRN---EQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENL-LKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQI--------YNIPCDAFVNGNDQLLIKCRVE 1833
            S+ E  EL   ++RE + +  +   +   E++  L+     L+    ++V + +S  + +    + C    ++ ++++D  +  L+      + +L +    GK  WK+ +   K+E    + S PF++  SGYK+   V     G      + +   L+RG+++  L WPF+  VT+ A+  ++GN    S + ++   +   + +P  + N  +             P +A    +D L IK +V+
Sbjct:  307 SVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLR----EQVAMTQSLREHLGALGQTC----QSHTRLLDIHVQQLQCSEQRFQ-QLESTSYDGKLIWKVHDYHRKKEAGTALNSPPFYTSHSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTL-AVLDQSGNRNHVS-LSFTPDLASNNFRRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKVD 543          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 50.447 bits (119), Expect = 4.635e-6
Identity = 41/140 (29.29%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            + DL I  ME + + ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  288 LRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 422          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.707 bits (169), Expect = 7.441e-13
Identity = 50/209 (23.92%), Postives = 91/209 (43.54%), Query Frame = 1
Query: 1225 IELLKQHFKQLQQEH----------------------NDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            +E+L QH +QLQ  H                       + ++ L + +       E C M  +  + + DG ++  + ++  +ET    A   GK  WKI +  +++++        +YS PF++ P GYKMC     +  G      + + F ++RGEY+  L WPF+  VT+  +    G   R  +  ++  P+   + +P  D N
Sbjct:  180 LEMLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRALEAALGNPGPCEERCHMHEQRLT-MHDGLLDTAERRLQVLET----AGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLD--QGAARRHLSDTFTPDPASGSFRRPDGDMN 381          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.1662 bits (165), Expect = 2.819e-12
Identity = 37/140 (26.43%), Postives = 68/140 (48.57%), Query Frame = 1
Query: 1366 DGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            D ++ ++ ++   +ET   N    GK  WKI +  ++++D        +YS PF++ P GY+MC     +  G      + + F ++RGEY+  L WPF+  VT+  +    G   R  +  +   P+ + + +P  D N
Sbjct:  305 DTRLAEMDLRFQVLETASYN----GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLD--QGAARRQLSDTFKPDPASSSFRRPTSDMN 438          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO43806 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXN6])

HSP 1 Score: 53.1434 bits (126), Expect = 1.713e-8
Identity = 30/105 (28.57%), Postives = 55/105 (52.38%), Query Frame = 3
Query:   96 CNICNELMIKACSAPCGCSFCSDCIEQYLD---GADKFCPGTSRYCEMTKINVNHISIDYPVSIR--ITETLVKCPKEN--CQFQAELRMIENHMKACNMRPISC 389
            C IC E++ +A   PCG SFC  C+E +++   G ++ CP +   C       + I +   +++R  +   +V CP  +  C+   +L  +E H+K+C+  P+ C
Sbjct:   18 CGICAEVLERAVLTPCGHSFCGVCLETWMNAKLGENEKCPASCPSCRADLYQGDTIPV---LALRGIVDGLIVHCPNADNGCKLVLKLEGVEGHLKSCSHAPVQC 119          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 55.8398 bits (133), Expect = 4.325e-8
Identity = 48/173 (27.75%), Postives = 79/173 (45.66%), Query Frame = 1
Query: 1378 NDLKIKMMEMETKLINAEICGKFEWKIENLLK--QE----KDKFIYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRN----GNIYRSSTIKYSDRPSDARWGKPVDDRN--EGIQIY----NIPCDAFVNGNDQLLIKCRVE 1833
            +DLK++M+E  +        G + WKI+   +  QE    K   IYS PF+ G  GYK C  V  +  G      + + F L+RGE++  L WPF+  VT   +        G+ +R         P+ + + +P  + N   G  ++    N+   A+V  +D + IK  V+
Sbjct:  364 HDLKLQMLEATSYD------GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLLDQDRVHDIGDTFRPD-------PTSSSFKRPTSNMNIASGCPLFISHTNLQTRAYVR-DDTMFIKIAVD 522          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 55.0694 bits (131), Expect = 6.663e-8
Identity = 31/91 (34.07%), Postives = 47/91 (51.65%), Query Frame = 1
Query: 1438 GKFEWKIENLLKQEKDK------FIYSNPFFSGPSGYKMCLSVIQSSRGQ-------IFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNG 1671
            G F WKI+   ++  +        IYS+PF++   GYK+C  +  +  G        IF++  L+RGEY+  L WPF+  +TI  I   NG
Sbjct:  380 GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIA--LMRGEYDSILPWPFQETITITLIDQDNG 468          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 54.6842 bits (130), Expect = 8.644e-8
Identity = 52/197 (26.40%), Postives = 88/197 (44.67%), Query Frame = 1
Query: 1276 EVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAE--IC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSV----IQSSRGQ-IFVSFHLIRGEYNDKLTWPFKYGVTI------DAITTR---NGNIYRSSTIKYSDRPSDARWGK--------PVDDRNEGIQIYN 1773
            EV +L S  DE  +         E+     D ++ +L  K+M +ET+ I  E  +C G F WK++N  +  +         I+S PF++   GYKMCL +    +    G+ + +  H+++G+++  L WPF   +T+      D I +R   +  +     +    RP+  R  K        P+D   EG  I N
Sbjct:  275 EVDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETLVAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTEGQYIKN 471          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO38873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SBN4])

HSP 1 Score: 52.373 bits (124), Expect = 4.337e-7
Identity = 26/77 (33.77%), Postives = 40/77 (51.95%), Query Frame = 1
Query: 1450 WKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTI 1647
            WKI N+  +  +         YS  FF+GP GYKMC  +  +  G      + + F ++RGE++  L WPF+  VT+
Sbjct:  337 WKITNVANKRSEATSGRVTSFYSPCFFTGPHGYKMCARIYLNGDGMGRNHHVSLFFVIMRGEFDALLRWPFRQKVTL 413          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 61.6178 bits (148), Expect = 1.340e-9
Identity = 39/138 (28.26%), Postives = 67/138 (48.55%), Query Frame = 1
Query: 1372 KMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRN 1752
            ++ D+ ++   +ET   N    G   WKI +  ++++D        +YS PF++G  GYKMC  V  +  G      + + F ++RGEY+  L WPFK  VT+  +    G   +     +   PS + + +PV + N
Sbjct:  280 RLADMDLRFQVLETASYN----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTL--MLMDQGPSRKHLGDAFKPDPSSSSFRRPVAEMN 411          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 51.6026 bits (122), Expect = 2.540e-6
Identity = 42/140 (30.00%), Postives = 66/140 (47.14%), Query Frame = 1
Query: 1375 MNDLKIKMMEMETKLINAEIC-GKFEWKIENLLKQEKDKF------IYSNPFFSGPSGYKMCLSVIQSSRG-----QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRP--SDARWGKPVDDRN 1752
            + DL I  ME + K ++A    G F WKI +  K+ +D        ++S  F++   GYKMCL +  +  G      + + F ++RG  +  L WPF   VT+  +   N    R   I  + RP  S + + +PV D N
Sbjct:  398 LRDLSIVEMEGKMKDMSAATYDGIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNN----REHIID-AFRPDISSSSFQRPVSDMN 532          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015087.1 (SMESG000015087.1)

HSP 1 Score: 515.383 bits (1326), Expect = 1.397e-178
Identity = 248/249 (99.60%), Postives = 249/249 (100.00%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 1848
            QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITT+NGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL
Sbjct:  190 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTKNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 438          

HSP 2 Score: 347.051 bits (889), Expect = 5.885e-113
Identity = 165/173 (95.38%), Postives = 167/173 (96.53%), Query Frame = 3
Query:   96 CNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKINVNHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 614
            C ICNEL+I ACSAPCGC FCSDCIE YL+G DKFCPGTSRYCEMTKIN NHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ
Sbjct:   18 CKICNELLINACSAPCGCRFCSDCIEHYLNGVDKFCPGTSRYCEMTKINANHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 190          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000015087.1 (SMESG000015087.1)

HSP 1 Score: 515.383 bits (1326), Expect = 2.324e-178
Identity = 248/249 (99.60%), Postives = 249/249 (100.00%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 1848
            QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITT+NGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL
Sbjct:  198 QEKILEMERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTKNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL 446          

HSP 2 Score: 347.436 bits (890), Expect = 7.103e-113
Identity = 165/173 (95.38%), Postives = 167/173 (96.53%), Query Frame = 3
Query:   96 CNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKINVNHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 614
            C ICNEL+I ACSAPCGC FCSDCIE YL+G DKFCPGTSRYCEMTKIN NHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ
Sbjct:   26 CKICNELLINACSAPCGCRFCSDCIEHYLNGVDKFCPGTSRYCEMTKINANHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 198          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 257.299 bits (656), Expect = 9.662e-78
Identity = 139/203 (68.47%), Postives = 161/203 (79.31%), Query Frame = 3
Query:    9 LYDKMSESIYKIMXXXXXXXXXXXXXXXXCNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKIN-VNHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 614
            + DKMSESIYKIMKEN FEI NEI +E +C ICNELMIKACSAPCGC FCSDCIEQYLDG DKFCPGTSR C+M  IN  N I ID   +++I+E +VKCP++NC+F+ EL MIENH++ C+ RPIS PF  IGC+  E +  EMKAHL+ DNY HS LL D INN  GE+ES+KNENIELK EN+QFKQK  NIELQ ANQQ
Sbjct:    4 ILDKMSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQQ 206          

HSP 2 Score: 216.468 bits (550), Expect = 2.146e-62
Identity = 136/298 (45.64%), Postives = 184/298 (61.74%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELN----------RLLRRETE----KINQIWPR--------NEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMA-----NENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSV----------IQSSRG-----------QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIY----NIPCDAFVNGNDQLLIKCRVEEE 1839
            Q+KI EME   M +  E ++LN          R LR E E     IN I  +          QI+ LKQ+ +Q QQE NDE ++ R  I++++++N N A        E F ++IDG++N+L+++M+EMET+ INA+I G+FEWKIENL +Q KDK+I+S PF+SGP+GYKMCLSV           Q  RG           +I V F+++RG+ +DKL WPFKY VTID I T NG+I+RS TIKYSDRP  A W KPV DRNE I +Y    +IP ++    N++LLIKCR+E E
Sbjct:  206 QQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPDHIPLNSPPIRNNRLLIKCRLERE 503          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070126.1 (SMESG000070126.1)

HSP 1 Score: 245.743 bits (626), Expect = 3.174e-76
Identity = 133/199 (66.83%), Postives = 157/199 (78.89%), Query Frame = 3
Query:   21 MSESIYKIMXXXXXXXXXXXXXXXXCNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKIN-VNHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 614
            MSESIYKIMKE KFEI +EI RE +CNICNELMIKACSAPCGC FCSDCIEQYLDGADKFCPGTSR C+M  IN  N I I+   +++I+E +VKCP++NC+F+ EL MI NH++ C+  PISCPF  IGC+  E++  EMK HL+ DNY HS LLID INN   E+ES+KNE IE+K EN+QFKQK  NIELQ ANQ 
Sbjct:    1 MSESIYKIMKEKKFEIVSEISRELKCNICNELMIKACSAPCGCCFCSDCIEQYLDGADKFCPGTSRRCQMKMINYANDIVIENRANVKISEIIVKCPRQNCEFEDELEMIANHVRTCDKCPISCPFNAIGCKVNEVMNDEMKTHLNQDNYIHSKLLIDIINNLLSEMESMKNEIIEIKRENSQFKQKIDNIELQSANQH 199          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 253.062 bits (645), Expect = 4.026e-76
Identity = 137/199 (68.84%), Postives = 158/199 (79.40%), Query Frame = 3
Query:   21 MSESIYKIMXXXXXXXXXXXXXXXXCNICNELMIKACSAPCGCSFCSDCIEQYLDGADKFCPGTSRYCEMTKIN-VNHISIDYPVSIRITETLVKCPKENCQFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYRHSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQ 614
            MSESIYKIMKEN FEI NEI +E +C ICNELMIKACSAPCGC FCSDCIEQYLDG DKFCPGTSR C+M  IN  N I ID   +++I+E +VKCP++NC+F+ EL MIENH++ C+ RPIS PF  IGC+  E +  EMKAHL+ DNY HS LL D INN  GE+ES+KNENIELK EN+QFKQK  NIELQ ANQQ
Sbjct:    1 MSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQQ 199          

HSP 2 Score: 216.468 bits (550), Expect = 1.849e-62
Identity = 136/298 (45.64%), Postives = 184/298 (61.74%), Query Frame = 1
Query: 1102 QEKILEMERKTMNSMRETDELN----------RLLRRETE----KINQIWPR--------NEQIELLKQHFKQLQQEHNDEVKLLRSGIDEIHKKNENCAMA-----NENFSKIIDGKMNDLKIKMMEMETKLINAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSV----------IQSSRG-----------QIFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSDARWGKPVDDRNEGIQIY----NIPCDAFVNGNDQLLIKCRVEEE 1839
            Q+KI EME   M +  E ++LN          R LR E E     IN I  +          QI+ LKQ+ +Q QQE NDE ++ R  I++++++N N A        E F ++IDG++N+L+++M+EMET+ INA+I G+FEWKIENL +Q KDK+I+S PF+SGP+GYKMCLSV           Q  RG           +I V F+++RG+ +DKL WPFKY VTID I T NG+I+RS TIKYSDRP  A W KPV DRNE I +Y    +IP ++    N++LLIKCR+E E
Sbjct:  199 QQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQLQIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYKWPDHIPLNSPPIRNNRLLIKCRLERE 496          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF31.896e-924.36TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.212e-924.36TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.212e-924.36TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.393e-924.36TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF32.393e-924.36TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf36.911e-1025.68TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
BX901915.14.566e-729.29pep chromosome:GRCz11:CHR_ALT_CTG5_1_18:28764891:2... [more]
AL844899.14.566e-729.29pep chromosome:GRCz11:CHR_ALT_CTG5_2_4:28756846:28... [more]
traf2a1.937e-624.07Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf52.758e-622.59Tnf receptor-associated factor 5 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hspb67.622e-927.43heat shock protein family B (small) member 6 [Sour... [more]
ssh21.419e-826.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh21.518e-826.76slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf4.794e-724.62epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Traf31.054e-924.36TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.054e-924.36TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf31.055e-924.36TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf62.039e-726.83TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q60803|TRAF3_MOUSE7.380e-924.36TNF receptor-associated factor 3 OS=Mus musculus O... [more]
sp|Q13114|TRAF3_HUMAN1.149e-824.36TNF receptor-associated factor 3 OS=Homo sapiens O... [more]
sp|Q6DJN2|TRF6B_XENLA7.499e-725.29TNF receptor-associated factor 6-B OS=Xenopus laev... [more]
sp|Q3ZCC3|TRAF6_BOVIN8.397e-726.44TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
sp|B5DF45|TRAF6_RAT9.833e-726.67TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZID86.698e-3036.20TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
T1E1017.185e-1833.33TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
A0A0F7GWW31.517e-1431.85TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A0L8HQP63.698e-1028.57MATH domain-containing protein OS=Octopus bimaculo... [more]
A0A2B4SA991.522e-925.71TNF receptor-associated factor 6-B OS=Stylophora p... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000035169.13.923e-734.57pep primary_assembly:Astyanax_mexicanus-2.0:9:3354... [more]
traf2b1.102e-631.43TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2a2.454e-624.07TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf54.210e-620.97TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a4.635e-629.29TNF receptor-associated factor 2-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000002130.17.441e-1323.92pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000000074.12.819e-1226.43pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO438061.713e-828.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494644.325e-827.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352376.663e-834.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487738.644e-826.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO388734.337e-733.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
traf31.340e-928.26TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.22.540e-630.00TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000015087.11.397e-17899.60SMESG000015087.1[more]
SMESG000015087.12.324e-17899.60SMESG000015087.1[more]
SMESG000070162.19.662e-7868.47SMESG000070162.1[more]
SMESG000070126.13.174e-7666.83SMESG000070126.1[more]
SMESG000070162.14.026e-7668.84SMESG000070162.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016277 ID=SMED30016277|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=2019bp
TATAAATCTTATATGATAAAATGTCTGAAAGCATTTACAAAATTATGAAA
GAAAACAAATTTGAAATTGAGAATGAAATCATCAGAGAATTTAGATGCAA
TATTTGTAATGAATTGATGATAAAAGCTTGTAGCGCGCCTTGCGGATGTT
CCTTTTGTTCTGATTGCATTGAGCAATACCTGGACGGAGCTGATAAATTC
TGTCCAGGAACATCAAGATACTGTGAAATGACAAAGATAAATGTAAATCA
TATATCAATAGATTATCCGGTCAGCATTCGAATTACAGAAACGTTAGTGA
AGTGCCCAAAGGAAAATTGTCAATTTCAAGCCGAATTGCGAATGATAGAA
AACCACATGAAAGCATGCAACATGCGGCCAATCAGCTGTCCGTTTGCTGT
AATTGGCTGTGAGAAAATTGAAATAATAATAAGTGAAATGAAAGCCCATC
TCTCTAATGATAATTATCGCCATAGCAATTTATTAATTGATCAAATCAAT
AATTTCTTCGGTGAAGTGGAATCGTTGAAAAATGAAAATATTGAATTGAA
GATGGAAAACAATCAATTCAAACAAAAATTTGCTAATATCGAGTTACAAT
GGGCAAATCAGCAAGTAAATTGATTGATTTAAATATTGAAATTAAGTTTA
CCACTCGTTTATTTTTTGTCAGCCTTTTTTCAGATCTTTACTTCTTTCAT
TGAGTTAAAAAACAGACAAATCTATTTCTTCAACTAGCCAATGGGATTCA
GAATTTCTCACAGAGAATTTTCTATTTAATAAATACTCTGATATTTACTT
GCAACTGGTTTTCAATGACCAGAAATCTTGTTGAGAGGAATAAATTGATA
AAATACATTTCAACCTGCAAACCCGCTTGAGCATAATTTGAATTTCTGGT
GCTTGATTTTGATTTTCTTATCATTGTTCATTTGAAAAGTAATATCCAAT
TGCATTAATTATGTAAAAAGCTGGCTCTCTTTTCCACACAATTCGATTTT
CTTAGCGGAATATTTGGCAATTAAATCAAACCATTTTTCGTATCAAAGTA
CTTTATAAAAAAATTATATTCAATTTGGCTAGGATTGACGATTTATGATT
GCAGGAGAAAATTCTTGAAATGGAAAGGAAAACAATGAACAGTATGAGAG
AAACCGATGAATTGAATCGATTATTGAGAAGGGAGACGGAAAAAATCAAT
CAAATTTGGCCACGGAATGAGCAAATTGAATTATTGAAGCAGCATTTTAA
ACAACTGCAGCAGGAGCATAATGATGAAGTGAAATTGCTGAGGAGTGGTA
TCGATGAAATTCATAAGAAAAATGAAAATTGCGCAATGGCCAATGAAAAC
TTCTCAAAAATAATTGATGGGAAAATGAATGATTTGAAAATTAAAATGAT
GGAGATGGAAACCAAATTAATTAATGCAGAAATTTGCGGGAAATTTGAAT
GGAAAATTGAAAATCTATTAAAACAAGAAAAAGACAAATTCATCTACAGC
AATCCATTTTTTTCAGGGCCATCTGGCTACAAAATGTGCTTGAGTGTAAT
TCAGAGTTCGCGTGGTCAGATTTTTGTTTCTTTCCATTTGATTCGTGGGG
AATACAATGACAAATTGACATGGCCATTCAAGTATGGTGTGACAATTGAT
GCGATCACTACAAGAAATGGAAATATCTATCGCAGTAGTACTATAAAATA
CTCTGATCGTCCTAGTGATGCCAGATGGGGGAAACCAGTAGATGACAGAA
ATGAGGGAATCCAGATATATAACATCCCATGCGATGCATTTGTCAACGGA
AATGACCAATTGCTGATCAAATGCAGAGTGGAAGAAGAACATAATTTATA
GCTGAAATTGTGATTCAAATGAATAAAATCTCAACAAATATTTGATACAA
TTTATGTATATTACGCACCCGTCTCCATTTGCTCACATAAATATACAAAT
GCGCGCAAATATAGGATTGCCATAAATAATAAAACGGATTGAGCTAAATT
AACAGCAAGTGGAAGATCG
back to top

protein sequence of SMED30016277-orf-1

>SMED30016277-orf-1 ID=SMED30016277-orf-1|Name=SMED30016277-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=201bp
MSESIYKIMKENKFEIENEIIREFRCNICNELMIKACSAPCGCSFCSDCI
EQYLDGADKFCPGTSRYCEMTKINVNHISIDYPVSIRITETLVKCPKENC
QFQAELRMIENHMKACNMRPISCPFAVIGCEKIEIIISEMKAHLSNDNYR
HSNLLIDQINNFFGEVESLKNENIELKMENNQFKQKFANIELQWANQQVN
*
back to top

protein sequence of SMED30016277-orf-2

>SMED30016277-orf-2 ID=SMED30016277-orf-2|Name=SMED30016277-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=244bp
MERKTMNSMRETDELNRLLRRETEKINQIWPRNEQIELLKQHFKQLQQEH
NDEVKLLRSGIDEIHKKNENCAMANENFSKIIDGKMNDLKIKMMEMETKL
INAEICGKFEWKIENLLKQEKDKFIYSNPFFSGPSGYKMCLSVIQSSRGQ
IFVSFHLIRGEYNDKLTWPFKYGVTIDAITTRNGNIYRSSTIKYSDRPSD
ARWGKPVDDRNEGIQIYNIPCDAFVNGNDQLLIKCRVEEEHNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000122negative regulation of transcription from RNA polymerase II promoter
GO:0000209protein polyubiquitination
GO:0001503ossification
GO:0001843neural tube closure
GO:0002726positive regulation of T cell cytokine production
GO:0007249I-kappaB kinase/NF-kappaB signaling
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0009887animal organ morphogenesis
GO:0019886antigen processing and presentation of exogenous peptide antigen via MHC class II
GO:0030316osteoclast differentiation
GO:0031666positive regulation of lipopolysaccharide-mediated signaling pathway
GO:0032147activation of protein kinase activity
GO:0032743positive regulation of interleukin-2 production
GO:0042088T-helper 1 type immune response
GO:0042102positive regulation of T cell proliferation
GO:0042475odontogenesis of dentin-containing tooth
GO:0042981regulation of apoptotic process
GO:0043011myeloid dendritic cell differentiation
GO:0043122regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0043507positive regulation of JUN kinase activity
GO:0045084positive regulation of interleukin-12 biosynthetic process
GO:0045410positive regulation of interleukin-6 biosynthetic process
GO:0045453bone resorption
GO:0045672positive regulation of osteoclast differentiation
GO:0045892negative regulation of transcription, DNA-templated
GO:0045944positive regulation of transcription from RNA polymerase II promoter
GO:0046849bone remodeling
GO:0048468cell development
GO:0050852T cell receptor signaling pathway
GO:0051023regulation of immunoglobulin secretion
GO:0051091positive regulation of sequence-specific DNA binding transcription factor activity
GO:0051092positive regulation of NF-kappaB transcription factor activity
GO:0051865protein autoubiquitination
GO:0070498interleukin-1-mediated signaling pathway
GO:0070534protein K63-linked ubiquitination
GO:0070555response to interleukin-1
GO:0071222cellular response to lipopolysaccharide
GO:0071345cellular response to cytokine stimulus
GO:1901224positive regulation of NIK/NF-kappaB signaling
GO:1904996positive regulation of leukocyte adhesion to vascular endothelial cell
GO:2000679positive regulation of transcription regulatory region DNA binding
GO:0016567protein ubiquitination
GO:0006955immune response
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0019901protein kinase binding
GO:0031435mitogen-activated protein kinase kinase kinase binding
GO:0031624ubiquitin conjugating enzyme binding
GO:0031625ubiquitin protein ligase binding
GO:0031996thioesterase binding
GO:0042802identical protein binding
GO:0042826histone deacetylase binding
GO:0043422protein kinase B binding
GO:0047485protein N-terminus binding
GO:0061630ubiquitin protein ligase activity
GO:0046872metal ion binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005811lipid particle
GO:0005829cytosol
GO:0005886plasma membrane
GO:0009898cytoplasmic side of plasma membrane
GO:0032991macromolecular complex
GO:0035631CD40 receptor complex
GO:0048471perinuclear region of cytoplasm
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR018957Znf_C3HC4_RING-type
IPR013323SIAH-type
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
IPR008974TRAF-like
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 58..239
e-value: 3.5E-24
score: 87.4
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 106..237
NoneNo IPR availablePANTHERPTHR10131:SF127coord: 6..215
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 6..215