insulinoma-associated protein 1a

Overview
Nameinsulinoma-associated protein 1a
Smed IDSMED30016266
Length (bp)1206
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of insulinoma-associated protein 1a (SMED30016266) t-SNE clustered cells

Violin plots show distribution of expression levels for insulinoma-associated protein 1a (SMED30016266) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of insulinoma-associated protein 1a (SMED30016266) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for insulinoma-associated protein 1a (SMED30016266) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016266

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016266SMESG000041297.1 SmedASXL_004051SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016266SMESG000041297.1 dd_Smed_v4_28888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016266SMESG000041297.1 dd_Smed_v4_28888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016266SMESG000041297.1 dd_Smed_v4_28888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016266SMESG000041297.1 dd_Smed_v4_28888_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016266SMESG000041297.1 dd_Smed_v6_28888_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of insulinoma-associated protein 1a vs. Ensembl Human
Match: INSM2 (INSM transcriptional repressor 2 [Source:HGNC Symbol;Acc:HGNC:17539])

HSP 1 Score: 104.375 bits (259), Expect = 1.370e-23
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 2
Query:  449 KELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + L   +  LG + CQLC E YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+
Sbjct:  251 RGLGGSRTPLGEFICQLCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPR 316          
BLAST of insulinoma-associated protein 1a vs. Ensembl Human
Match: INSM1 (INSM transcriptional repressor 1 [Source:HGNC Symbol;Acc:HGNC:6090])

HSP 1 Score: 95.1301 bits (235), Expect = 1.189e-20
Identity = 44/80 (55.00%), Postives = 49/80 (61.25%), Query Frame = 2
Query:  419 PVINI------TEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHK 640
            PV+ +       E  R         LG + CQLC E YAD F LAQH C RI  VEYRC EC KVF+CPANLASH+RWHK
Sbjct:  239 PVLGLKIKEGPVEAPRGRAGGAARPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHK 318          
BLAST of insulinoma-associated protein 1a vs. Ensembl Celegans
Match: egl-46 (C2H2 zinc finger protein EGL-46 [Source:UniProtKB/TrEMBL;Acc:G5EFY4])

HSP 1 Score: 106.301 bits (264), Expect = 5.390e-26
Identity = 42/74 (56.76%), Postives = 58/74 (78.38%), Query Frame = 2
Query:  425 INITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + +TE++R+++ +I N +G+  C+LC   Y D F LAQH CPRI H EY+C +CDKVF+CPANLASH+RWHKP+
Sbjct:  160 VEVTEESRQKIDEIPNVIGDCICRLCKVKYEDVFKLAQHKCPRIAHEEYKCPDCDKVFSCPANLASHRRWHKPR 233          
BLAST of insulinoma-associated protein 1a vs. Ensembl Fly
Match: nerfin-2 (gene:FBgn0041105 transcript:FBtr0082177)

HSP 1 Score: 134.806 bits (338), Expect = 4.175e-34
Identity = 70/160 (43.75%), Postives = 89/160 (55.62%), Query Frame = 2
Query:  422 VINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDHSF 901
            V+ ITE+A+  LA I NK+G+Y CQLC   Y DAF+LAQH CPRI H+EY+CSEC+KVFNCPANLASH+RWHKPK+   GV   P +K    + D L+   +++                          ASD +  CHIC      Q  L+ H   H  
Sbjct:  435 VVEITEEAKAILASIDNKIGDYMCQLCRTVYDDAFMLAQHRCPRIVHIEYKCSECEKVFNCPANLASHRRWHKPKAEAAGV--NPAKKRVVETGD-LVQEATRS-----------------------GDDASDGIYPCHICGKTFRRQAYLKKHQASHQM 568          
BLAST of insulinoma-associated protein 1a vs. Ensembl Fly
Match: nerfin-2 (gene:FBgn0041105 transcript:FBtr0330083)

HSP 1 Score: 134.806 bits (338), Expect = 4.992e-34
Identity = 70/160 (43.75%), Postives = 89/160 (55.62%), Query Frame = 2
Query:  422 VINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDHSF 901
            V+ ITE+A+  LA I NK+G+Y CQLC   Y DAF+LAQH CPRI H+EY+CSEC+KVFNCPANLASH+RWHKPK+   GV   P +K    + D L+   +++                          ASD +  CHIC      Q  L+ H   H  
Sbjct:  435 VVEITEEAKAILASIDNKIGDYMCQLCRTVYDDAFMLAQHRCPRIVHIEYKCSECEKVFNCPANLASHRRWHKPKAEAAGV--NPAKKRVVETGD-LVQEATRS-----------------------GDDASDGIYPCHICGKTFRRQAYLKKHQASHQM 568          
BLAST of insulinoma-associated protein 1a vs. Ensembl Fly
Match: nerfin-1 (gene:FBgn0028999 transcript:FBtr0072592)

HSP 1 Score: 102.449 bits (254), Expect = 1.774e-23
Identity = 43/75 (57.33%), Postives = 56/75 (74.67%), Query Frame = 2
Query:  422 VINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            ++ ITE+ + ELA I+N +G+Y C+LC   + DAF LA+H C  I  +EYRC EC K FNCPANLASH+RWHKP+
Sbjct:  229 IVEITEETKAELAAIKNVIGDYVCRLCKIKFEDAFGLARHRCACIVLLEYRCPECGKQFNCPANLASHRRWHKPR 303          
BLAST of insulinoma-associated protein 1a vs. Ensembl Zebrafish
Match: insm1a (insulinoma-associated 1a [Source:NCBI gene;Acc:402941])

HSP 1 Score: 103.99 bits (258), Expect = 2.577e-24
Identity = 44/72 (61.11%), Postives = 52/72 (72.22%), Query Frame = 2
Query:  431 ITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + +K R + A     LG + CQLC E YAD F LAQH C RI  +EYRC ECDK+F+CPANLASH+RWHKPK
Sbjct:  163 VEQKPRSQCASGDKPLGEFVCQLCREAYADPFSLAQHKCSRIVRIEYRCPECDKLFSCPANLASHRRWHKPK 234          
BLAST of insulinoma-associated protein 1a vs. Ensembl Zebrafish
Match: insm1a (insulinoma-associated 1a [Source:NCBI gene;Acc:402941])

HSP 1 Score: 103.99 bits (258), Expect = 2.804e-24
Identity = 44/72 (61.11%), Postives = 52/72 (72.22%), Query Frame = 2
Query:  431 ITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + +K R + A     LG + CQLC E YAD F LAQH C RI  +EYRC ECDK+F+CPANLASH+RWHKPK
Sbjct:  163 VEQKPRSQCASGDKPLGEFVCQLCREAYADPFSLAQHKCSRIVRIEYRCPECDKLFSCPANLASHRRWHKPK 234          
BLAST of insulinoma-associated protein 1a vs. Ensembl Zebrafish
Match: insm1b (insulinoma-associated 1b [Source:NCBI gene;Acc:323882])

HSP 1 Score: 103.605 bits (257), Expect = 9.365e-24
Identity = 59/152 (38.82%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  440 KARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDH 895
            K R         LG + CQLC E Y+D F LAQH C RI  VEYRC EC+KVF+CPANLASH+RWHKP+     VQ  P Q + P              PF +   A+  S     +   +   + D L  C  C      Q  L  H++ H
Sbjct:  209 KPRPSSGGTNKPLGEFICQLCKEEYSDPFSLAQHKCSRIVRVEYRCPECEKVFSCPANLASHRRWHKPR-----VQSAPKQALQPAK------------PFPEELRAEFPSDRDTPSPGLSESGSEDGLYDCQHCGKRFKRQAYLRKHILGH 343          
BLAST of insulinoma-associated protein 1a vs. Ensembl Zebrafish
Match: INSM2 (INSM transcriptional repressor 2 [Source:NCBI gene;Acc:792891])

HSP 1 Score: 98.9821 bits (245), Expect = 3.114e-22
Identity = 43/66 (65.15%), Postives = 48/66 (72.73%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKK 673
            LG + CQLC E Y D F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP++      KK
Sbjct:  180 LGEFICQLCKEEYPDPFSLAQHKCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRTLSTADTKK 245          
BLAST of insulinoma-associated protein 1a vs. Ensembl Xenopus
Match: pfkfb3 (6-phosphofructo-2-kinase/fructose-2,6-biphosphatase 3 [Source:Xenbase;Acc:XB-GENE-963652])

HSP 1 Score: 98.9821 bits (245), Expect = 2.266e-22
Identity = 44/69 (63.77%), Postives = 51/69 (73.91%), Query Frame = 2
Query:  440 KARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            K+R  L K +  LG + CQLC E Y D F LAQH C RI  VEYRC ECDK+F+CPANLASH+RWHKP+
Sbjct:  159 KSRSPLGK-RPPLGEFICQLCKEQYPDPFALAQHKCSRIVRVEYRCPECDKIFSCPANLASHRRWHKPR 226          
BLAST of insulinoma-associated protein 1a vs. Ensembl Xenopus
Match: hoxa10 (homeobox A10 [Source:Xenbase;Acc:XB-GENE-478888])

HSP 1 Score: 98.9821 bits (245), Expect = 4.072e-22
Identity = 53/143 (37.06%), Postives = 69/143 (48.25%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDHSFA 904
            LG + CQLC E Y+D F LAQH C RI  VEYRC EC KVF+CPANLASH+RWHKP+         P+   +    + L D ++ +P                    ++   + D L  C  C      Q  L  H++ H  A
Sbjct:  227 LGEFICQLCKEEYSDPFSLAQHKCSRIVRVEYRCPECHKVFSCPANLASHRRWHKPRP--------PVASTAQAKEEPLSDRDTPSP-------------------GASESGSEDGLYECPRCARKFRRQAYLRKHLLSHQAA 342          
BLAST of insulinoma-associated protein 1a vs. Ensembl Mouse
Match: Insm2 (insulinoma-associated 2 [Source:MGI Symbol;Acc:MGI:1930787])

HSP 1 Score: 105.145 bits (261), Expect = 3.256e-24
Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  449 KELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK-SPDWGVQKKPIQKISP 694
            + L  ++  LG + CQLC   YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+ +P     K P   ++P
Sbjct:  191 RALGGVRTPLGEFICQLCKHQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACAASKPPHAPLTP 273          
BLAST of insulinoma-associated protein 1a vs. Ensembl Mouse
Match: Insm1 (insulinoma-associated 1 [Source:MGI Symbol;Acc:MGI:1859980])

HSP 1 Score: 95.9005 bits (237), Expect = 5.392e-21
Identity = 44/80 (55.00%), Postives = 49/80 (61.25%), Query Frame = 2
Query:  419 PVINI------TEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHK 640
            PV+ +       E  R         LG + CQLC E YAD F LAQH C RI  VEYRC EC KVF+CPANLASH+RWHK
Sbjct:  244 PVLGLKIKEGPVEAPRGRAGGATRPLGEFICQLCKEEYADPFALAQHKCSRIVRVEYRCPECAKVFSCPANLASHRRWHK 323          
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Match: sp|Q6P0F9|INS1A_DANRE (Insulinoma-associated protein 1a OS=Danio rerio OX=7955 GN=insm1a PE=2 SV=1)

HSP 1 Score: 103.99 bits (258), Expect = 2.117e-23
Identity = 44/72 (61.11%), Postives = 52/72 (72.22%), Query Frame = 2
Query:  431 ITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + +K R + A     LG + CQLC E YAD F LAQH C RI  +EYRC ECDK+F+CPANLASH+RWHKPK
Sbjct:  163 VEQKPRSQCASGDKPLGEFVCQLCREAYADPFSLAQHKCSRIVRIEYRCPECDKLFSCPANLASHRRWHKPK 234          
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Match: sp|Q9JMC2|INSM2_MOUSE (Insulinoma-associated protein 2 OS=Mus musculus OX=10090 GN=Insm2 PE=1 SV=2)

HSP 1 Score: 105.145 bits (261), Expect = 2.277e-23
Identity = 46/83 (55.42%), Postives = 56/83 (67.47%), Query Frame = 2
Query:  449 KELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK-SPDWGVQKKPIQKISP 694
            + L  ++  LG + CQLC   YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+ +P     K P   ++P
Sbjct:  191 RALGGVRTPLGEFICQLCKHQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRPTPACAASKPPHAPLTP 273          
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Match: sp|Q96T92|INSM2_HUMAN (Insulinoma-associated protein 2 OS=Homo sapiens OX=9606 GN=INSM2 PE=1 SV=3)

HSP 1 Score: 104.375 bits (259), Expect = 6.577e-23
Identity = 43/66 (65.15%), Postives = 49/66 (74.24%), Query Frame = 2
Query:  449 KELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            + L   +  LG + CQLC E YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+
Sbjct:  251 RGLGGSRTPLGEFICQLCKEQYADPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPR 316          
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Match: sp|Q7T3H2|INS1B_DANRE (Insulinoma-associated protein 1b OS=Danio rerio OX=7955 GN=insm1b PE=2 SV=1)

HSP 1 Score: 103.605 bits (257), Expect = 7.070e-23
Identity = 59/152 (38.82%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  440 KARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDH 895
            K R         LG + CQLC E Y+D F LAQH C RI  VEYRC EC+KVF+CPANLASH+RWHKP+     VQ  P Q + P              PF +   A+  S     +   +   + D L  C  C      Q  L  H++ H
Sbjct:  209 KPRPSSGGTNKPLGEFICQLCKEEYSDPFSLAQHKCSRIVRVEYRCPECEKVFSCPANLASHRRWHKPR-----VQSAPKQALQPAK------------PFPEELRAEFPSDRDTPSPGLSESGSEDGLYDCQHCGKRFKRQAYLRKHILGH 343          
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Match: sp|A7UKY7|INSM1_XENLA (Insulinoma-associated protein 1 OS=Xenopus laevis OX=8355 GN=insm1 PE=2 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 1.362e-21
Identity = 54/140 (38.57%), Postives = 68/140 (48.57%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDH 895
            LG + CQLC E Y+D F LAQH C RI  VEYRC EC KVF+CPANLASH+RWHKP+ P        +  + P   +AL D ++ +P                         + D L  C  C      Q  L  H++ H
Sbjct:  219 LGEFICQLCKEEYSDPFSLAQHKCSRIVRVEYRCPECHKVFSCPANLASHRRWHKPRPPA-------VPAVQPKE-EALSDRDTPSP----------------------ESGSEDGLYECPRCARKFRRQAYLRKHLLSH 328          
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Match: A0A443SD91 (Insulinoma-associated protein 1a-like protein OS=Leptotrombidium deliense OX=299467 GN=B4U80_06694 PE=4 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 4.131e-32
Identity = 62/87 (71.26%), Postives = 71/87 (81.61%), Query Frame = 2
Query:  413 SVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKK 673
            S+ V+ ITE+AR ELAKI+NK+G+Y CQLC E Y DAF LAQH C RI HVEYRC ECDKVFNCPANLASH+RWHKP++   GV KK
Sbjct:  162 SLNVVVITEEARAELAKIENKIGDYICQLCKEKYEDAFGLAQHRCSRIVHVEYRCPECDKVFNCPANLASHRRWHKPRN---GVTKK 245          
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Match: A0A1Y3BJP5 (C2H2-type domain-containing protein OS=Euroglyphus maynei OX=6958 GN=BLA29_008609 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.000e-31
Identity = 55/79 (69.62%), Postives = 64/79 (81.01%), Query Frame = 2
Query:  413 SVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKS 649
            S+ ++ IT +AR E+AKI NK+G+Y C LC E Y DAF LAQH C RI H+EYRC ECDKVFNCPANLASH+RWHKPKS
Sbjct:   16 SLNIVIITAEARAEIAKIDNKIGDYVCALCKEYYVDAFALAQHRCSRIVHIEYRCPECDKVFNCPANLASHRRWHKPKS 94          
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Match: A0A1W7RAC9 (Insulinoma-associated protein 1a OS=Hadrurus spadix OX=141984 PE=4 SV=1)

HSP 1 Score: 131.724 bits (330), Expect = 4.042e-31
Identity = 63/118 (53.39%), Postives = 79/118 (66.95%), Query Frame = 2
Query:  329 SPVTNIKSTKSATGRIYQGSIKNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQ 682
            SPV+      S +      S +      S+ V+ +TE+AR ELAKI+NK+G+Y CQLC + +ADAF LAQH C RI HVEYRC EC+KVFNCPANLASH+RWHKP++P        IQ
Sbjct:  115 SPVSGTFIRDSDSEDDLPMSTRRGDIDPSLNVVVVTEEARAELAKIENKIGDYVCQLCKDHFADAFGLAQHRCSRIVHVEYRCPECEKVFNCPANLASHRRWHKPRAPTVQTATSTIQ 232          
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Match: V4B5U2 (Uncharacterized protein (Fragment) OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_96643 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 1.172e-30
Identity = 58/99 (58.59%), Postives = 70/99 (70.71%), Query Frame = 2
Query:  350 STKSATGRIYQGSIKNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            S     GR+  G I+      S  ++ +T +AR EL +I+N++G+Y CQLC E Y DAF LAQH C RI HVEYRC ECDKVFNCPANLASH+RWHKPK
Sbjct:   50 SDSEDEGRVVCGDIE-----PSFNLVEVTPEARAELERIENRIGDYICQLCKEYYEDAFQLAQHRCSRIVHVEYRCPECDKVFNCPANLASHRRWHKPK 143          
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Match: Q9VH29 (Nervous fingers 2, isoform A OS=Drosophila melanogaster OX=7227 GN=nerfin-2 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 1.240e-30
Identity = 70/160 (43.75%), Postives = 89/160 (55.62%), Query Frame = 2
Query:  422 VINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDHSF 901
            V+ ITE+A+  LA I NK+G+Y CQLC   Y DAF+LAQH CPRI H+EY+CSEC+KVFNCPANLASH+RWHKPK+   GV   P +K    + D L+   +++                          ASD +  CHIC      Q  L+ H   H  
Sbjct:  435 VVEITEEAKAILASIDNKIGDYMCQLCRTVYDDAFMLAQHRCPRIVHIEYKCSECEKVFNCPANLASHRRWHKPKAEAAGV--NPAKKRVVETGD-LVQEATRS-----------------------GDDASDGIYPCHICGKTFRRQAYLKKHQASHQM 568          
BLAST of insulinoma-associated protein 1a vs. Ensembl Cavefish
Match: insm1a (insulinoma-associated 1a [Source:NCBI gene;Acc:402941])

HSP 1 Score: 104.375 bits (259), Expect = 2.415e-24
Identity = 48/81 (59.26%), Postives = 54/81 (66.67%), Query Frame = 2
Query:  425 INITEKARKELAKIQNK--LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWG 661
            I    +   E   +Q K  LG + CQLC E YAD F LAQH C RI  VEYRC EC+KVF+CPANLASH+RWHKPK P  G
Sbjct:  178 IKEAPEGHDEGRAVQQKQSLGEFVCQLCREAYADPFALAQHRCSRIVRVEYRCPECEKVFSCPANLASHRRWHKPKPPSAG 258          
BLAST of insulinoma-associated protein 1a vs. Ensembl Cavefish
Match: insm1b (insulinoma-associated 1b [Source:NCBI gene;Acc:323882])

HSP 1 Score: 100.523 bits (249), Expect = 7.886e-23
Identity = 42/58 (72.41%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKS 649
            LG + CQLC E YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP++
Sbjct:  254 LGEFICQLCKEEYADPFSLAQHKCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPRA 311          
BLAST of insulinoma-associated protein 1a vs. Ensembl Cavefish
Match: ENSAMXT00000025908.2 (insulinoma-associated protein 1a-like [Source:NCBI gene;Acc:103046881])

HSP 1 Score: 93.2041 bits (230), Expect = 1.433e-20
Identity = 39/57 (68.42%), Postives = 42/57 (73.68%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            LG + CQLC E Y D   LA H C RI  VEYRC ECDK F+CPANLASH+RWHKPK
Sbjct:  197 LGEFMCQLCKERYPDPLSLAHHKCSRIVRVEYRCDECDKAFSCPANLASHRRWHKPK 253          
BLAST of insulinoma-associated protein 1a vs. Ensembl Sea Lamprey
Match: insm1b (insulinoma-associated 1b [Source:NCBI gene;Acc:323882])

HSP 1 Score: 100.908 bits (250), Expect = 1.353e-23
Identity = 46/79 (58.23%), Postives = 53/79 (67.09%), Query Frame = 2
Query:  419 PVINITEKARKELAKIQNKL---GNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            PV+ +  K     AK ++     G Y CQLC E Y D F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+
Sbjct:  188 PVLGLRIKEEPVDAKPRSSRPMGGGYVCQLCKEEYGDPFALAQHRCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPR 266          
BLAST of insulinoma-associated protein 1a vs. Ensembl Nematostella
Match: EDO35669 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SKS6])

HSP 1 Score: 76.6406 bits (187), Expect = 9.246e-17
Identity = 33/49 (67.35%), Postives = 39/49 (79.59%), Query Frame = 2
Query:  485 YTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKR 631
            + CQLC E Y+D F LAQH C  I+H E+RC ECDKVF+CPANLASH+R
Sbjct:    4 FICQLCSEVYSDPFSLAQHKCSGIQHTEHRCPECDKVFSCPANLASHRR 52          
BLAST of insulinoma-associated protein 1a vs. Ensembl Medaka
Match: insm1a (INSM transcriptional repressor 1 [Source:NCBI gene;Acc:101163626])

HSP 1 Score: 103.219 bits (256), Expect = 7.597e-24
Identity = 45/65 (69.23%), Postives = 49/65 (75.38%), Query Frame = 2
Query:  467 QNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWG 661
            Q+ LG + CQLC E YAD F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKPK    G
Sbjct:  215 QHPLGEFVCQLCREAYADPFSLAQHKCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPKPQSGG 279          
BLAST of insulinoma-associated protein 1a vs. Ensembl Medaka
Match: insm1b (insulinoma-associated protein 1b [Source:NCBI gene;Acc:101161355])

HSP 1 Score: 100.523 bits (249), Expect = 3.685e-23
Identity = 43/73 (58.90%), Postives = 52/73 (71.23%), Query Frame = 2
Query:  431 ITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKS 649
            +  K R + +     LG + CQLC E YAD F LAQH C RI  VEYRC ECDK+F+CPANLASH+RWHKP++
Sbjct:  161 VEVKPRAQSSGGNKPLGEFVCQLCKEAYADPFSLAQHKCSRIVRVEYRCPECDKMFSCPANLASHRRWHKPRT 233          
BLAST of insulinoma-associated protein 1a vs. Ensembl Medaka
Match: INSM2 (INSM transcriptional repressor 2 [Source:NCBI gene;Acc:101159149])

HSP 1 Score: 98.2117 bits (243), Expect = 6.163e-22
Identity = 41/57 (71.93%), Postives = 45/57 (78.95%), Query Frame = 2
Query:  476 LGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            LG + CQLC E Y D F LAQH C RI  VEYRC ECDKVF+CPANLASH+RWHKP+
Sbjct:  282 LGEFICQLCKEEYPDPFSLAQHKCSRIVRVEYRCPECDKVFSCPANLASHRRWHKPR 338          
BLAST of insulinoma-associated protein 1a vs. Planmine SMEST
Match: SMESG000041297.1 (SMESG000041297.1)

HSP 1 Score: 592.038 bits (1525), Expect = 0.000e+0
Identity = 301/302 (99.67%), Postives = 301/302 (99.67%), Query Frame = 2
Query:    5 MPSSIMEYNNSTNLPVHPSMFQYQYINMHKMYHKVASALGAHNIAFRKHLWLQQWNPGGFSSSWNGLPSFNGRHNCHGAIENRFSNAPLWLHKCWRPQSMKPNNKEICSPVTNIKSTKSATGRIYQGSIKNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFXXXXXXXXXXXXXXASDLLLSCHICEDVLPSQELLESHMIDHSFAGL 910
            MPSSIMEYNNSTNLPVHPSMFQYQYINMHKMYHKVASALGAHNIAFRKHLWLQQWNPGGFSSSWNGLPSFNGRHNCHGAIENRFSNAPLWLHKCWRPQSMKPNNKEICSPVTNIKSTKSATGRIYQGSIKNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFSTIPQITTSSTTVSASDLLLSCHIC DVLPSQELLESHMIDHSFAGL
Sbjct:    1 MPSSIMEYNNSTNLPVHPSMFQYQYINMHKMYHKVASALGAHNIAFRKHLWLQQWNPGGFSSSWNGLPSFNGRHNCHGAIENRFSNAPLWLHKCWRPQSMKPNNKEICSPVTNIKSTKSATGRIYQGSIKNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKTSNAKKFSTIPQITTSSTTVSASDLLLSCHICGDVLPSQELLESHMIDHSFAGL 302          
BLAST of insulinoma-associated protein 1a vs. Planmine SMEST
Match: SMESG000047651.1 (SMESG000047651.1)

HSP 1 Score: 93.9745 bits (232), Expect = 6.959e-22
Identity = 40/85 (47.06%), Postives = 55/85 (64.71%), Query Frame = 2
Query:  392 KNVQSGASVPVINITEKARKELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFNCPANLASHKRWHKPK 646
            KN      +    +T +   +L+KI N++G + C+LC   Y  A  LA H CP+I  +E+RC +C K+FNCPANLASH+RWHKPK
Sbjct:  109 KNHHGNKFLTTFKVTSECHNQLSKIPNRIGPFECKLCATLYTGAIQLANHRCPQILRIEHRCPDCHKIFNCPANLASHRRWHKPK 193          
The following BLAST results are available for this feature:
BLAST of insulinoma-associated protein 1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
INSM21.370e-2365.15INSM transcriptional repressor 2 [Source:HGNC Symb... [more]
INSM11.189e-2055.00INSM transcriptional repressor 1 [Source:HGNC Symb... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
egl-465.390e-2656.76C2H2 zinc finger protein EGL-46 [Source:UniProtKB... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
nerfin-24.175e-3443.75gene:FBgn0041105 transcript:FBtr0082177[more]
nerfin-24.992e-3443.75gene:FBgn0041105 transcript:FBtr0330083[more]
nerfin-11.774e-2357.33gene:FBgn0028999 transcript:FBtr0072592[more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
insm1a2.577e-2461.11insulinoma-associated 1a [Source:NCBI gene;Acc:402... [more]
insm1a2.804e-2461.11insulinoma-associated 1a [Source:NCBI gene;Acc:402... [more]
insm1b9.365e-2438.82insulinoma-associated 1b [Source:NCBI gene;Acc:323... [more]
INSM23.114e-2265.15INSM transcriptional repressor 2 [Source:NCBI gene... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pfkfb32.266e-2263.776-phosphofructo-2-kinase/fructose-2,6-biphosphatas... [more]
hoxa104.072e-2237.06homeobox A10 [Source:Xenbase;Acc:XB-GENE-478888][more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Insm23.256e-2455.42insulinoma-associated 2 [Source:MGI Symbol;Acc:MGI... [more]
Insm15.392e-2155.00insulinoma-associated 1 [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6P0F9|INS1A_DANRE2.117e-2361.11Insulinoma-associated protein 1a OS=Danio rerio OX... [more]
sp|Q9JMC2|INSM2_MOUSE2.277e-2355.42Insulinoma-associated protein 2 OS=Mus musculus OX... [more]
sp|Q96T92|INSM2_HUMAN6.577e-2365.15Insulinoma-associated protein 2 OS=Homo sapiens OX... [more]
sp|Q7T3H2|INS1B_DANRE7.070e-2338.82Insulinoma-associated protein 1b OS=Danio rerio OX... [more]
sp|A7UKY7|INSM1_XENLA1.362e-2138.57Insulinoma-associated protein 1 OS=Xenopus laevis ... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A443SD914.131e-3271.26Insulinoma-associated protein 1a-like protein OS=L... [more]
A0A1Y3BJP51.000e-3169.62C2H2-type domain-containing protein OS=Euroglyphus... [more]
A0A1W7RAC94.042e-3153.39Insulinoma-associated protein 1a OS=Hadrurus spadi... [more]
V4B5U21.172e-3058.59Uncharacterized protein (Fragment) OS=Lottia gigan... [more]
Q9VH291.240e-3043.75Nervous fingers 2, isoform A OS=Drosophila melanog... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
insm1a2.415e-2459.26insulinoma-associated 1a [Source:NCBI gene;Acc:402... [more]
insm1b7.886e-2372.41insulinoma-associated 1b [Source:NCBI gene;Acc:323... [more]
ENSAMXT00000025908.21.433e-2068.42insulinoma-associated protein 1a-like [Source:NCBI... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
insm1b1.353e-2358.23insulinoma-associated 1b [Source:NCBI gene;Acc:323... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO356699.246e-1767.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
insm1a7.597e-2469.23INSM transcriptional repressor 1 [Source:NCBI gene... [more]
insm1b3.685e-2358.90insulinoma-associated protein 1b [Source:NCBI gene... [more]
INSM26.163e-2271.93INSM transcriptional repressor 2 [Source:NCBI gene... [more]
back to top
BLAST of insulinoma-associated protein 1a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000041297.10.000e+099.67SMESG000041297.1[more]
SMESG000047651.16.959e-2247.06SMESG000047651.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016266 ID=SMED30016266|Name=insulinoma-associated protein 1a|organism=Schmidtea mediterranea sexual|type=transcript|length=1206bp
AAACATGCCATCATCAATTATGGAATACAATAACTCTACTAATTTGCCAG
TTCATCCATCAATGTTTCAATATCAATATATAAATATGCATAAAATGTAT
CATAAAGTAGCTTCAGCTTTAGGAGCTCATAATATTGCATTTCGTAAACA
TTTATGGTTACAACAGTGGAATCCCGGTGGATTTAGTAGTTCCTGGAATG
GTCTCCCATCATTCAATGGTAGACACAATTGTCATGGAGCAATTGAAAAT
CGGTTCAGTAACGCACCATTATGGTTGCATAAATGTTGGAGACCACAATC
AATGAAACCCAACAATAAGGAAATTTGTTCACCAGTAACGAATATCAAAT
CAACGAAATCAGCAACCGGAAGAATTTATCAAGGGTCAATAAAAAATGTT
CAATCAGGAGCCAGTGTTCCAGTGATCAATATAACGGAAAAGGCTCGAAA
AGAGTTGGCGAAAATTCAAAATAAACTTGGTAATTATACTTGCCAACTGT
GTCATGAAACATACGCTGACGCATTTTTACTAGCCCAACATCACTGTCCG
AGGATTAGACATGTTGAATATCGATGCTCAGAATGCGACAAGGTATTCAA
TTGTCCAGCAAATTTAGCGTCACACAAACGATGGCACAAACCGAAAAGTC
CTGATTGGGGAGTTCAGAAAAAACCAATTCAAAAAATTTCCCCATATAGC
ATCGACGCACTGATTGATCACGAATCGAAAACACCGCCATTCTTTAAGAC
CTCGAATGCTAAGAAATTCTCCACAATTCCACAAATCACCACCTCATCAA
CAACAGTATCAGCGTCAGATTTATTATTATCATGCCATATTTGCGAAGAT
GTTCTTCCATCTCAAGAACTTCTCGAAAGCCACATGATCGACCATTCATT
TGCTGGGTTGTAATGTATATAAATATTAGATCGAATCGTCTCCGCTGTAT
CGATTGCTGAGGCTGTAGCAACCCGGAGTTTCATCCACACAGTCTAACTC
TCACTAGGCCTCAATTGAGGGGGTCGCATCCTCAATCTCATAATAATAAC
GATGCTTAGAAGTGTATTTCCGTTTTTGGTGTGAATTGATTTCCAGTTGA
CTCTGTAGGCCATCGATTGAGAATGGATATTGTCTCGGCTATGCTCGTAT
TCGTGATAATTTTATTTTATTTTCATTTTCAATATAATTTATGAGTTAAA
AAAAAA
back to top

protein sequence of SMED30016266-orf-1

>SMED30016266-orf-1 ID=SMED30016266-orf-1|Name=SMED30016266-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=304bp
NMPSSIMEYNNSTNLPVHPSMFQYQYINMHKMYHKVASALGAHNIAFRKH
LWLQQWNPGGFSSSWNGLPSFNGRHNCHGAIENRFSNAPLWLHKCWRPQS
MKPNNKEICSPVTNIKSTKSATGRIYQGSIKNVQSGASVPVINITEKARK
ELAKIQNKLGNYTCQLCHETYADAFLLAQHHCPRIRHVEYRCSECDKVFN
CPANLASHKRWHKPKSPDWGVQKKPIQKISPYSIDALIDHESKTPPFFKT
SNAKKFSTIPQITTSSTTVSASDLLLSCHICEDVLPSQELLESHMIDHSF
AGL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0003676nucleic acid binding
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR042972INSM1/2
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 145..165
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 132..219
e-value: 1.1E-9
score: 40.1
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 190..212
e-value: 0.23
score: 20.6
coord: 276..298
e-value: 0.16
score: 21.0
coord: 162..187
e-value: 29.0
score: 9.2
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 190..212
e-value: 0.0014
score: 19.0
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 278..298
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 192..212
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 190..217
score: 12.965
IPR042972Insulinoma-associated protein 1/2PANTHERPTHR15065INSULINOMA-ASSOCIATED 1coord: 137..298
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 162..212