E3 ubiquitin-protein ligase TRAF7

Overview
NameE3 ubiquitin-protein ligase TRAF7
Smed IDSMED30016251
Length (bp)2154
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase TRAF7 (SMED30016251) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRAF7 (SMED30016251) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase TRAF7 (SMED30016251) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase TRAF7 (SMED30016251) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016251

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30016251SMESG000069927.1 dd_Smed_v4_14318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016251SMESG000069927.1 dd_Smed_v4_14318_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: TRAF7 (TNF receptor associated factor 7 [Source:HGNC Symbol;Acc:HGNC:20456])

HSP 1 Score: 80.1073 bits (196), Expect = 6.136e-15
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G  V  S      E+D  GC    +L  ++ HE  C YR V+CP     C   +R+ ++E H + C+
Sbjct:  119 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNVKL--TVVVNNIAVAEQIGELFIHCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP-NNPSCPPLLRM-NLEAHLKECE 255          

HSP 2 Score: 60.077 bits (144), Expect = 1.259e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  386 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 577          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 58.9214 bits (141), Expect = 2.685e-9
Identity = 38/142 (26.76%), Postives = 63/142 (44.37%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P     C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L +Q+  + + C++              + GC+    L+H + H   C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRLLCPL--CGKPMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIH-------------SEEGCRWSGPLRHLQGHLNTCSFNVIPCP---NRCPMKLSRRDLPAHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 61.6178 bits (148), Expect = 3.156e-9
Identity = 36/128 (28.12%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   + +I+++S D+TI++W+ S     EF         V  L GH   I+CL   + +R V+S   ++ +++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  395 VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNTIRLWDIECGACLRVLEG-HEELVRCIRFDNKRIVSGAYDGKIKVWDL 507          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 61.6178 bits (148), Expect = 3.641e-9
Identity = 36/128 (28.12%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   + +I+++S D+TI++W+ S     EF         V  L GH   I+CL   + +R V+S   ++ +++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  421 VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNTIRLWDIECGACLRVLEG-HEELVRCIRFDNKRIVSGAYDGKIKVWDL 533          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 61.6178 bits (148), Expect = 3.768e-9
Identity = 36/128 (28.12%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   + +I+++S D+TI++W+ S     EF         V  L GH   I+CL   + +R V+S   ++ +++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  385 VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNTIRLWDIECGACLRVLEG-HEELVRCIRFDNKRIVSGAYDGKIKVWDL 497          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 62.003 bits (149), Expect = 9.621e-10
Identity = 45/186 (24.19%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  916 ICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHI------NHFIRCLVINHPLENYLYSSGHNQVLVWQ 1452
            + P       +L GHR  +  +   + +I+++S D+TI++W +  L   EF         V  L GH   I+CL   +  R V+S   ++ +++WD  SG  +R  E  HE++   +   +  I +G+ + +IK+W+L + +    ++  I       H  R   +       + SS  + +L+W 
Sbjct:  275 VSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTL---EF---------VRTLAGHRRGIACL--QYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEG-HEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWD 445          

HSP 2 Score: 51.6026 bits (122), Expect = 1.648e-6
Identity = 41/169 (24.26%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  964 KMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLK 1467
            K +  L + ++ I++   D TI+IWD              +  C  IL+GH  S+ C  L + NR +IS   ++ ++VWD  +G  ++   H H +    +  +  I+ T S +  I +W++ S   I      + H     V++      + +SG   + VW +  L+
Sbjct:  168 KGVYCLQYDDDKIVSGLRDNTIKIWD------------RKDYSCSRILSGHTGSVLC--LQYDNRVIISGSSDATVRVWDVETGECIKTLIH-HCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLE 321          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 60.8474 bits (146), Expect = 9.888e-10
Identity = 37/136 (27.21%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  943 GILKGHRKMITSLSHF----ENFIITSSHDQTIRIWDI---SPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTGS-NSEIKIWN 1323
            G L+GH   +T ++ +    +  +++SS D+TI +WD+   +P+ +G  G+P+ +      LTGHN+ +S + +S   +  +S   +  L++WD + G   R+   H  + ++ + +     I +GS +  IK+WN
Sbjct:   10 GTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRPVRS------LTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWN 139          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 60.8474 bits (146), Expect = 9.888e-10
Identity = 37/136 (27.21%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  943 GILKGHRKMITSLSHF----ENFIITSSHDQTIRIWDI---SPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTGS-NSEIKIWN 1323
            G L+GH   +T ++ +    +  +++SS D+TI +WD+   +P+ +G  G+P+ +      LTGHN+ +S + +S   +  +S   +  L++WD + G   R+   H  + ++ + +     I +GS +  IK+WN
Sbjct:   10 GTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRPVRS------LTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWN 139          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: rack-1 (Guanine nucleotide-binding protein subunit beta-2-like 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21215])

HSP 1 Score: 60.8474 bits (146), Expect = 9.888e-10
Identity = 37/136 (27.21%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  943 GILKGHRKMITSLSHF----ENFIITSSHDQTIRIWDI---SPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTGS-NSEIKIWN 1323
            G L+GH   +T ++ +    +  +++SS D+TI +WD+   +P+ +G  G+P+ +      LTGHN+ +S + +S   +  +S   +  L++WD + G   R+   H  + ++ + +     I +GS +  IK+WN
Sbjct:   10 GTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRPVRS------LTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWN 139          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Match: lin-23 (F-box/WD repeat-containing protein lin-23 [Source:UniProtKB/Swiss-Prot;Acc:Q09990])

HSP 1 Score: 62.003 bits (149), Expect = 1.007e-9
Identity = 45/186 (24.19%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  916 ICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHI------NHFIRCLVINHPLENYLYSSGHNQVLVWQ 1452
            + P       +L GHR  +  +   + +I+++S D+TI++W +  L   EF         V  L GH   I+CL   +  R V+S   ++ +++WD  SG  +R  E  HE++   +   +  I +G+ + +IK+W+L + +    ++  I       H  R   +       + SS  + +L+W 
Sbjct:  275 VSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTL---EF---------VRTLAGHRRGIACL--QYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEG-HEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWD 445          

HSP 2 Score: 51.6026 bits (122), Expect = 1.680e-6
Identity = 41/169 (24.26%), Postives = 76/169 (44.97%), Query Frame = 1
Query:  964 KMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLK 1467
            K +  L + ++ I++   D TI+IWD              +  C  IL+GH  S+ C  L + NR +IS   ++ ++VWD  +G  ++   H H +    +  +  I+ T S +  I +W++ S   I      + H     V++      + +SG   + VW +  L+
Sbjct:  168 KGVYCLQYDDDKIVSGLRDNTIKIWD------------RKDYSCSRILSGHTGSVLC--LQYDNRVIISGSSDATVRVWDVETGECIKTLIH-HCEAVLHLRFANGIMVTCSKDRSIAVWDMVSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTLE 321          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0084032)

HSP 1 Score: 61.6178 bits (148), Expect = 1.679e-9
Identity = 37/128 (28.91%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   E +I+++S D+TI++W  S     EF         V  L GH   I+CL   + +R V+S   ++++++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  328 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNSIRLWDIECGACLRVLEG-HEELVRCIRFDTKRIVSGAYDGKIKVWDL 440          

HSP 2 Score: 50.447 bits (119), Expect = 4.902e-6
Identity = 38/162 (23.46%), Postives = 71/162 (43.83%), Query Frame = 1
Query:  964 KMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVW 1449
            K +  L + +  I++   D TI+IWD + L             CV  L GH  S+ CL     ++ +IS   +S ++VWD ++G +V    H  E +      +  ++    +  I +W++ S  +I      + H     V++   +  + +SG   + VW
Sbjct:  211 KGVYCLQYDDGKIVSGLRDNTIKIWDRTDL------------QCVKTLMGHTGSVLCLQYD--DKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 358          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0333931)

HSP 1 Score: 61.6178 bits (148), Expect = 1.679e-9
Identity = 37/128 (28.91%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   E +I+++S D+TI++W  S     EF         V  L GH   I+CL   + +R V+S   ++++++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  328 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNSIRLWDIECGACLRVLEG-HEELVRCIRFDTKRIVSGAYDGKIKVWDL 440          

HSP 2 Score: 50.447 bits (119), Expect = 4.902e-6
Identity = 38/162 (23.46%), Postives = 71/162 (43.83%), Query Frame = 1
Query:  964 KMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVW 1449
            K +  L + +  I++   D TI+IWD + L             CV  L GH  S+ CL     ++ +IS   +S ++VWD ++G +V    H  E +      +  ++    +  I +W++ S  +I      + H     V++   +  + +SG   + VW
Sbjct:  211 KGVYCLQYDDGKIVSGLRDNTIKIWDRTDL------------QCVKTLMGHTGSVLCLQYD--DKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 358          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: slmb (gene:FBgn0283468 transcript:FBtr0330049)

HSP 1 Score: 61.2326 bits (147), Expect = 2.072e-9
Identity = 37/128 (28.91%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   E +I+++S D+TI++W  S     EF         V  L GH   I+CL   + +R V+S   ++++++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  328 VLVGHRAAVNVVDFDEKYIVSASGDRTIKVWSTSSC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNSIRLWDIECGACLRVLEG-HEELVRCIRFDTKRIVSGAYDGKIKVWDL 440          

HSP 2 Score: 50.0618 bits (118), Expect = 6.168e-6
Identity = 38/162 (23.46%), Postives = 72/162 (44.44%), Query Frame = 1
Query:  964 KMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVW 1449
            K +  L + +  I++   D TI+IWD + L             CV  L GH  S+ C  L + ++ +IS   +S ++VWD ++G +V    H  E +      +  ++    +  I +W++ S  +I      + H     V++   +  + +SG   + VW
Sbjct:  211 KGVYCLQYDDGKIVSGLRDNTIKIWDRTDL------------QCVKTLMGHTGSVLC--LQYDDKVIISGSSDSTVRVWDVNTGEMVNTLIHHCEAVLHLRFNNGMMVTCSKDRSIAVWDMTSPSEITLRRVLVGHRAAVNVVDFDEKYIVSASGDRTIKVW 358          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: Taf5 (gene:FBgn0010356 transcript:FBtr0088240)

HSP 1 Score: 54.299 bits (129), Expect = 3.905e-7
Identity = 34/127 (26.77%), Postives = 62/127 (48.82%), Query Frame = 1
Query:  994 NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKS---IIFTGSNSEIKIWNLDSLVQIGHVTEHI 1365
            N++ T S D+T+R+WD               G  V ++TGH  S+S L  S   R + S  ++ N+ +WD S+GSLV      H    T++  S+    +   G ++ + +W+   + +  +++ HI
Sbjct:  547 NYVATGSSDRTVRLWDN------------MTGQSVRLMTGHKGSVSSLAFSACGRYLASGSVDHNIIIWDLSNGSLVTTLLR-HTSTVTTITFSRDGTVLAAAGLDNNLTLWDFHKVTE-DYISNHI 659          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Match: ago (gene:FBgn0041171 transcript:FBtr0073246)

HSP 1 Score: 50.8322 bits (120), Expect = 5.423e-6
Identity = 38/139 (27.34%), Postives = 64/139 (46.04%), Query Frame = 1
Query:  925 FSFLNAGILK---GHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHI---HEKITTSVAVSKSIIFTGS-NSEIKIW 1320
            +S +N   L+   GH   + S     N II+ S D+T+++WD            + +G CV  L GH  ++ C+ L     +V+S   ++ L+VWD   GS +    H+   H      V     +I +G+ +  +KIW
Sbjct: 1020 WSAVNGKCLRTLVGHTGGVWSSQMSGNIIISGSTDRTLKVWD------------MDSGACVHTLQGHTSTVRCMHL--HGSKVVSGSRDATLRVWDIEQGSCL----HVLVGHLAAVRCVQYDGKLIVSGAYDYMVKIW 1140          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: traf7 (TNF receptor-associated factor 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2212])

HSP 1 Score: 76.6406 bits (187), Expect = 4.933e-14
Identity = 43/119 (36.13%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G     S  +   E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:  115 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFIHCKYGCRPAASGKSGAYEVDPLGCPFTIKLSTRKDHEVSCDYRPVRCP 229          

HSP 2 Score: 58.5362 bits (140), Expect = 2.126e-8
Identity = 49/222 (22.07%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D++I++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  381 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKSIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 572          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: traf7 (TNF receptor-associated factor 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2212])

HSP 1 Score: 76.6406 bits (187), Expect = 5.187e-14
Identity = 43/119 (36.13%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G     S  +   E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   89 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFIHCKYGCRPAASGKSGAYEVDPLGCPFTIKLSTRKDHEVSCDYRPVRCP 203          

HSP 2 Score: 58.151 bits (139), Expect = 2.835e-8
Identity = 49/222 (22.07%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D++I++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  355 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKSIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 546          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: traf7 (TNF receptor-associated factor 7 [Source:ZFIN;Acc:ZDB-GENE-070112-2212])

HSP 1 Score: 76.6406 bits (187), Expect = 5.187e-14
Identity = 43/119 (36.13%), Postives = 63/119 (52.94%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G     S  +   E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   89 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFIHCKYGCRPAASGKSGAYEVDPLGCPFTIKLSTRKDHEVSCDYRPVRCP 203          

HSP 2 Score: 58.151 bits (139), Expect = 2.835e-8
Identity = 49/222 (22.07%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D++I++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  355 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKSIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 546          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 62.7734 bits (151), Expect = 8.371e-10
Identity = 40/142 (28.17%), Postives = 66/142 (46.48%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P   F+C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L  QI  + + C++              + GC+   Q+K  ++H + C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRFQCPL--CSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIH-------------SEEGCRWTGQMKQLQSHFSTCAFNVIPCP---NRCSVKLTRRDLPEHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 62.7734 bits (151), Expect = 8.371e-10
Identity = 40/142 (28.17%), Postives = 66/142 (46.48%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P   F+C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L  QI  + + C++              + GC+   Q+K  ++H + C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRFQCPL--CSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIH-------------SEEGCRWTGQMKQLQSHFSTCAFNVIPCP---NRCSVKLTRRDLPEHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:100216042])

HSP 1 Score: 78.1814 bits (191), Expect = 2.806e-14
Identity = 48/145 (33.10%), Postives = 76/145 (52.41%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQL--EIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            D ++F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G   S     +  E+D  GC    +L  ++ HE  C YR V+CP     C   +++ ++E H + C+
Sbjct:  125 DPLVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCKYGCHPSSNGKPVTFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP-NNPNCPPLLKM-NLEAHLKECE 263          

HSP 2 Score: 60.077 bits (144), Expect = 1.219e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +  L       H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +NYLYS  +  + +W I               L+    +Q S  +V S+ ++  +I+ G +
Sbjct:  393 FKCKGTFVGHQGPVWCLCVYSIGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGSKLYSGSADCTIIVWDIQT-LLKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTDLKLKKELTGLNHWVRALVAS---QNYLYSGSYQTIKIWDIR-------------TLECAHVLQTSGGSVYSIAVTNHHIVCGTY 584          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:100216042])

HSP 1 Score: 77.7962 bits (190), Expect = 3.125e-14
Identity = 48/145 (33.10%), Postives = 76/145 (52.41%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQL--EIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            D ++F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G   S     +  E+D  GC    +L  ++ HE  C YR V+CP     C   +++ ++E H + C+
Sbjct:  128 DPLVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNAKLTV--VVNNIAVAEQIGELFIHCKYGCHPSSNGKPVTFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP-NNPNCPPLLKM-NLEAHLKECE 266          

HSP 2 Score: 60.077 bits (144), Expect = 1.232e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +  L       H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +NYLYS  +  + +W I               L+    +Q S  +V S+ ++  +I+ G +
Sbjct:  396 FKCKGTFVGHQGPVWCLCVYSIGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGSKLYSGSADCTIIVWDIQT-LLKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTDLKLKKELTGLNHWVRALVAS---QNYLYSGSYQTIKIWDIR-------------TLECAHVLQTSGGSVYSIAVTNHHIVCGTY 587          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:100216042])

HSP 1 Score: 77.411 bits (189), Expect = 3.554e-14
Identity = 44/122 (36.07%), Postives = 65/122 (53.28%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQL--EIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            D ++F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G   S     +  E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   15 DPLVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCKYGCHPSSNGKPVTFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP 132          

HSP 2 Score: 59.6918 bits (143), Expect = 1.308e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +  L       H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +NYLYS  +  + +W I               L+    +Q S  +V S+ ++  +I+ G +
Sbjct:  281 FKCKGTFVGHQGPVWCLCVYSIGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGSKLYSGSADCTIIVWDIQT-LLKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTDLKLKKELTGLNHWVRALVAS---QNYLYSGSYQTIKIWDIR-------------TLECAHVLQTSGGSVYSIAVTNHHIVCGTY 472          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:100216042])

HSP 1 Score: 77.411 bits (189), Expect = 3.657e-14
Identity = 44/122 (36.07%), Postives = 65/122 (53.28%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQL--EIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            D ++F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G   S     +  E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   49 DPLVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCKYGCHPSSNGKPVTFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP 166          

HSP 2 Score: 59.6918 bits (143), Expect = 1.448e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +  L       H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +NYLYS  +  + +W I               L+    +Q S  +V S+ ++  +I+ G +
Sbjct:  317 FKCKGTFVGHQGPVWCLCVYSIGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGSKLYSGSADCTIIVWDIQT-LLKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTDLKLKKELTGLNHWVRALVAS---QNYLYSGSYQTIKIWDIR-------------TLECAHVLQTSGGSVYSIAVTNHHIVCGTY 508          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:100216042])

HSP 1 Score: 77.411 bits (189), Expect = 3.800e-14
Identity = 48/145 (33.10%), Postives = 76/145 (52.41%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQL--EIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            D ++F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ +HC  G   S     +  E+D  GC    +L  ++ HE  C YR V+CP     C   +++ ++E H + C+
Sbjct:   61 DPLVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCKYGCHPSSNGKPVTFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP-NNPNCPPLLKM-NLEAHLKECE 199          

HSP 2 Score: 59.6918 bits (143), Expect = 1.333e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +  L       H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +NYLYS  +  + +W I               L+    +Q S  +V S+ ++  +I+ G +
Sbjct:  329 FKCKGTFVGHQGPVWCLCVYSIGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGSKLYSGSADCTIIVWDIQT-LLKVNTIRAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTDLKLKKELTGLNHWVRALVAS---QNYLYSGSYQTIKIWDIR-------------TLECAHVLQTSGGSVYSIAVTNHHIVCGTY 520          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Traf7 (TNF receptor-associated factor 7 [Source:MGI Symbol;Acc:MGI:3042141])

HSP 1 Score: 76.6406 bits (187), Expect = 7.518e-15
Identity = 46/143 (32.17%), Postives = 75/143 (52.45%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP     C   +++ ++E H + C+
Sbjct:   79 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP-NNPSCPPLLKM-NLEAHLKECE 215          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Traf7 (TNF receptor-associated factor 7 [Source:MGI Symbol;Acc:MGI:3042141])

HSP 1 Score: 77.411 bits (189), Expect = 3.195e-14
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   80 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP 195          

HSP 2 Score: 59.3066 bits (142), Expect = 1.498e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  345 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 536          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Traf7 (TNF receptor-associated factor 7 [Source:MGI Symbol;Acc:MGI:3042141])

HSP 1 Score: 77.411 bits (189), Expect = 3.195e-14
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   80 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP 195          

HSP 2 Score: 59.3066 bits (142), Expect = 1.498e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  345 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 536          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Traf7 (TNF receptor-associated factor 7 [Source:MGI Symbol;Acc:MGI:3042141])

HSP 1 Score: 77.411 bits (189), Expect = 3.564e-14
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:  118 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP 233          

HSP 2 Score: 59.3066 bits (142), Expect = 1.577e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  385 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 576          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Match: Traf7 (TNF receptor-associated factor 7 [Source:MGI Symbol;Acc:MGI:3042141])

HSP 1 Score: 77.411 bits (189), Expect = 3.564e-14
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:  118 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP 233          

HSP 2 Score: 59.3066 bits (142), Expect = 1.577e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  385 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 576          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q6Q0C0|TRAF7_HUMAN (E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens OX=9606 GN=TRAF7 PE=1 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 2.946e-14
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK 500
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G  V  S      E+D  GC    +L  ++ HE  C YR V+CP     C   +R+ ++E H + C+
Sbjct:  119 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNVKL--TVVVNNIAVAEQIGELFIHCRHGCRVAGSGKPPIFEVDPRGCPFTIKLSARKDHEGSCDYRPVRCP-NNPSCPPLLRM-NLEAHLKECE 255          

HSP 2 Score: 60.077 bits (144), Expect = 6.047e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  386 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNVLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVA---AQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 577          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q922B6|TRAF7_MOUSE (E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus OX=10090 GN=Traf7 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.104e-13
Identity = 42/120 (35.00%), Postives = 64/120 (53.33%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            ++F E P     CQ   C     D +   CGH+FC++CA   +KCP+DN K+    V  N+A++ QI E+ +HC +G     +      E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   43 LVFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALKSEKCPVDNAKL--TVVVNNIAVAEQIGELFIHCRHGCHAAGTGKPGVFEVDPRGCPFTIKLSARKDHESSCDYRPVRCP 158          

HSP 2 Score: 59.3066 bits (142), Expect = 8.966e-8
Identity = 50/222 (22.52%), Postives = 97/222 (43.69%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  310 FKCKGTFVGHQGPVWCLCVYSMGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGCKLYSGSADCTIIVWDIQNLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALV---AAQSYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHIVCGTY 501          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|P42527|MHCKA_DICDI (Myosin heavy chain kinase A OS=Dictyostelium discoideum OX=44689 GN=mhkA PE=1 SV=2)

HSP 1 Score: 73.1738 bits (178), Expect = 6.104e-12
Identity = 54/226 (23.89%), Postives = 108/226 (47.79%), Query Frame = 1
Query:  910 HWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSE-IKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVL-VWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIG 1581
            +W C ++      + GHRK I S++   N+I TSS D TI++  I             N  C+  L GH   ++C+  +   + + S   +  +KVWD S+   ++  E +H K   ++A+S   +F+G N + I +W+ ++L  + ++  H +  +      H   +YL+S+  + V+ +W ++             N   + +++  + +V+S V+  RY+  G
Sbjct:  901 NWKCLYT------VNGHRKSIESIACNSNYIFTSSPDNTIKVHIIRS----------GNTKCIETLVGHTGEVNCVVAN--EKYLFSCSYDKTIKVWDLSTFKEIKSFEGVHTKYIKTLALSGRYLFSGGNDQIIYVWDTETLSMLFNMQGHEDWVLSL----HCTASYLFSTSKDNVIKIWDLS-------------NFSCIDTLKGHWNSVSSCVVKDRYLYSG 1091          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q21215|GBLP_CAEEL (Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans OX=6239 GN=rack-1 PE=1 SV=3)

HSP 1 Score: 60.8474 bits (146), Expect = 1.258e-8
Identity = 37/136 (27.21%), Postives = 74/136 (54.41%), Query Frame = 1
Query:  943 GILKGHRKMITSLSHF----ENFIITSSHDQTIRIWDI---SPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTGS-NSEIKIWN 1323
            G L+GH   +T ++ +    +  +++SS D+TI +WD+   +P+ +G  G+P+ +      LTGHN+ +S + +S   +  +S   +  L++WD + G   R+   H  + ++ + +     I +GS +  IK+WN
Sbjct:   10 GTLEGHTGWVTQIATYTRNDKTTVLSSSRDKTILVWDVDSVAPVDEGPIGRPVRS------LTGHNHFVSDVVISSDGQFALSGSWDKTLRLWDLNQGVSTRQFISHTKDVLSVAFSADNRQIVSGSRDKSIKLWN 139          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Match: sp|Q09990|LIN23_CAEEL (F-box/WD repeat-containing protein lin-23 OS=Caenorhabditis elegans OX=6239 GN=lin-23 PE=1 SV=2)

HSP 1 Score: 62.003 bits (149), Expect = 1.616e-8
Identity = 45/186 (24.19%), Postives = 86/186 (46.24%), Query Frame = 1
Query:  916 ICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHI------NHFIRCLVINHPLENYLYSSGHNQVLVWQ 1452
            + P       +L GHR  +  +   + +I+++S D+TI++W +  L   EF         V  L GH   I+CL   +  R V+S   ++ +++WD  SG  +R  E  HE++   +   +  I +G+ + +IK+W+L + +    ++  I       H  R   +       + SS  + +L+W 
Sbjct:  330 VSPRDITIRRVLVGHRAAVNVVDFDDRYIVSASGDRTIKVWSMDTL---EF---------VRTLAGHRRGIACL--QYRGRLVVSGSSDNTIRLWDIHSGVCLRVLEG-HEELVRCIRFDEKRIVSGAYDGKIKVWDLQAALDPRALSSEICLCSLVQHTGRVFRLQFDDFQIVSSSHDDTILIWD 500          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A3S0ZCN4 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_017579 PE=4 SV=1)

HSP 1 Score: 105.916 bits (263), Expect = 7.801e-36
Identity = 93/373 (24.93%), Postives = 173/373 (46.38%), Query Frame = 1
Query:  484 TNRRVNPHVKQTMYLFMPNQIILMSISKPQLKISETKPNMQQIADS---LTLRIKRLE---TQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRS-SHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIG 1581
            T+++V  H+K  +Y     Q    + S   +K ++ +  +Q + +    L++R+K LE   +Q+   L+R  +M  EI       L+ L+   DQ + +  + K        RP S  +  SL+   + +    +      +   RS   W  PF F   G L+GH+ ++ +++  +  + ++  D  I+IW +  L K          GCVG +T HN  + CL+ +W N  ++S   + ++  WD  +          HE I  ++AV   ++FT S + +K+W+L ++ Q+       NH++R + +    ++ LY+  HN + VW+      ED         + + +IQH   +V S+ +S  YII G
Sbjct:  164 THKKVEEHIKVCIYY----QCEAFNGSNFAVKFAKQEIVIQSLQEENVQLSMRVKDLEESKSQLKTQLDRQGSMIQEIQQK----LDSLHSRLDQTQMSSSVSK--------RPLST-SQISLADSGLSSSRYSMVTSQRSASPGRSYEKWEMPFQFKCIGTLRGHKDVVWAMTTRKGHLYSAGADGIIKIWSLEHLAK----------GCVGNITAHNGVVHCLS-TWGN-SLLSAGADKSVHFWDLDTYQKKSTIVDAHENIICAMAVCDDLLFTSSFAIVKVWDLKTM-QLKSSLPSENHWVRAIALGRG-KDKLYTGSHNAIHVWEA----KED--------FEKLNTIQHECGSVYSLAVSKTYIIAG 493          

HSP 2 Score: 75.8702 bits (185), Expect = 7.801e-36
Identity = 39/115 (33.91%), Postives = 65/115 (56.52%), Query Frame = 3
Query:  153 MTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTC 497
            + +KCGH+FC+ C  +  +CP+DN   D   V  N  +  QI ++ ++C +G+V S  +   ++    CQE   +  +  HE  C + +V+CP Y ++C   MR KD+E HK+ C
Sbjct:   36 INIKCGHTFCRSCVFNTTRCPVDNSHCDSSQVVVNRLVVGQIDDLLIYCRHGLVKSK-DGGWDLSSDSCQEKICIGKRNEHEEMCMFALVRCP-YSEKC-SSMRKKDLEQHKKFC 147          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: H2ZEN6 (Uncharacterized protein OS=Ciona savignyi OX=51511 PE=4 SV=1)

HSP 1 Score: 78.1814 bits (191), Expect = 4.972e-26
Identity = 46/142 (32.39%), Postives = 78/142 (54.93%), Query Frame = 3
Query:   78 ILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG--VVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTC 497
            ++FV+ PP    C+   C       + + CGHS+CK+C+ S++ CP+DN K+   +V  NLA+  Q+  + +HC  G  ++   + N+ E++Q+GC    +L  + THE  C Y  + CP     C   +R+  +E H +TC
Sbjct:    2 LVFVDTPPAQLYCKI--CHHVYKHPVIMSCGHSYCKRCSLSIESCPVDNKKM--TSVLSNLAVCEQVGALYIHCRYGCKLINDRV-NEYEVNQSGCPFTVKLAERRTHEDSCLYAPISCP-NNPMCPTMLRMH-LEEHLKTC 136          

HSP 2 Score: 70.8626 bits (172), Expect = 4.972e-26
Identity = 78/365 (21.37%), Postives = 158/365 (43.29%), Query Frame = 1
Query:  505 HVKQTMYLFMPN--QIILMSISKPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKE-HIHEKITTSVAVSKSIIFTGSNSEIKIWNLDS-LVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            H+K   Y F+ +  QI    I+K QL       +++Q  +  T     L + ++ ++N+ME    E+    ++ L  L  +  ++E++ +  + D  N  +    Q  N  L +  +              Q+++     C  +F+      GH   +  L    +++ + S D+ I++WD +           TN  C   L GH   +  L L+    ++ S   +  +K+W  S  +LV       H+    ++  + +++F+GS   IK+W+++S ++      E +NH++R LV     ++YLYS  +  + +W I               LD +  +Q S  +V S+ ++  +I+ G +
Sbjct:  160 HIKSCKYEFVKDFLQITEEKINKMQL-------SLKQADEENTF----LRSMLSNTVNKME----ELEKSFEIKLEVLGTNQAKLEDDLREFRQD--NALINNQLQDLNTRLHMGGVGVFDP--------QQIFK-----CKGTFV------GHTGPVWCLCVHGDYLFSGSSDKQIKVWDTA-----------TNYKCQKTLEGHEGIV--LALTAHGNKLFSGSADCTIKIW--SIANLVELNSIAAHDNPVCTLVCTDNMLFSGSLKSIKVWSVESEIITFKQELEGLNHWVRALVAQ---QDYLYSGSYQTIKIWDIR-------------TLDCIHVLQTSGGSVYSIAVTNHHILCGTY 457          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A2G8L0U4 (Putative E3 ubiquitin-protein ligase OS=Stichopus japonicus OX=307972 GN=BSL78_09211 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 2.654e-22
Identity = 75/339 (22.12%), Postives = 152/339 (44.84%), Query Frame = 1
Query:  589 TKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSS-GSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNL-------DLVQSIQHSFYTVNSMVISARYIIIG 1581
            T+ N  +   +L  +I  LE     S   ME    E    I+ +  +L +   ++++N K L + A+ N  R  +  TN    L           +    S ++    W  PF F   G L+GH+  + SL+   + + +   D  I++W++  L K          GCV  L GH   +  L        + S  +++ ++ W++ +  + V+  ++ H++   ++ ++ S +F+ S SE+KIW  D+L  +  ++  ++H++R L ++ P E + Y     ++   Q+T +    + A   V +        + + + H F +V S+ +S  Y+ +G
Sbjct:  190 TQTNSDETITTLFKKIGDLEQ----SRAVMEQSLTEQRNLIQTLERKLTLLEGEVQSNQKRL-DVASVNRQRSRTSSTNRGQKLS---------LSASFESHLWSREAWHLPFEFKCIGTLRGHQGAVHSLAIHRDKLYSGGSDCVIKVWNLLGLSK----------GCVQELRGHTKQVVALVAGQI--YLYSAALDNTIRCWNYETPDTDVKIIKNAHDEDICALIMAGSNLFSSSKSEVKIWKADTLEFLKAISG-LHHWVRALALD-PHERFGYFGIGCKIRDTQVTQVGRTYTVAPITVTVWDATSQFSMKKKMDHLFGSVFSLAVSNTYLFVG 500          

HSP 2 Score: 63.1586 bits (152), Expect = 2.654e-22
Identity = 50/177 (28.25%), Postives = 71/177 (40.11%), Query Frame = 3
Query:   63 FMSDFILFVEDPPTVFKCQNINCLKNMID-AMTVKCGHSFCKKCAQSLD------KCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETH-----EAQCPYR--------------------IVKCPFYGDRCKEKMRLKDIELHKQTC 497
             MS   LFVE P +   C    C   + D  ++V CGH+FC+ C  + D       CP+D   I       N A+  QIQ++ ++C NG+   +  N   + Q GC E+  +    TH     + +CP                       V CP  G  C     L DI  H+ TC
Sbjct:    5 LMSQKPLFVEAPSSHLYCPT--CSDILSDPVISVACGHTFCRACLCNSDGTVKVTNCPVDQTFIQNGTTVDNRAILSQIQDLRIYCRNGMKRLNSRNDTVVVQNGCPEVLSIASAATHVCQFDDIECPNSPICGKFKKGELADHLSYTCCFVSCPNKG--CSHHGTLADIRQHQTTC 177          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A2T7NIZ1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19307 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 9.464e-21
Identity = 61/226 (26.99%), Postives = 112/226 (49.56%), Query Frame = 1
Query:  904 SSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIG 1581
            S  W  PF F   G L+GH+  +  L  F   + ++  D  I++W++  L KG          CVG   GH   I C+  + +  ++ +   +  ++ WD  +G  +  +E  H+ I  ++A++   IFT S S IK+W +++L  I H    +NH++R LV++ P ++ LYS  HN + +W+             + + + + +I H   +V S+ ++  Y+I G
Sbjct:  282 SERWEMPFQFKCIGTLRGHQDAVWCLCAFRGRLFSAGGDCVIKVWNLDQLAKG----------CVGSFHGHTDRILCM--AKYGSKLFTAGADYTIRCWDTETGDQIETREGGHDNIICAMAITGDFIFTSSLSVIKVWKIENLSLI-HTMGDLNHWVRALVLS-PSKDRLYSGSHNAINIWE------------ASGSFESLGTISHDAGSVYSLAVTRLYVIAG 481          

HSP 2 Score: 93.5893 bits (231), Expect = 4.389e-16
Identity = 57/166 (34.34%), Postives = 87/166 (52.41%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCK----SSRKTNNVFIYAKPDNLNEHL*T 569
            FVE+     +C    C K   D +  KCGH+FC++C  S+  CP+D  + D   +  N  +  QI+ + ++C +GV+    N +L  D TGC EI  L  +  HE  CPY  V CP  G  C  ++R KD++LH   C     + +K    F+ A+ + ++EHL T
Sbjct:   10 FVEEVSPYLRCPV--CQKVYRDPVISKCGHTFCRQCVSSITHCPVDTVQCDNTQLVVNRLVVGQIESLQIYCKHGVIKK--NGELIADSTGCPEITTLGDRAVHEGSCPYAYVSCP-NGANCG-RIRHKDLDLHLTQCTFIACAHKKKGCEFVGAQ-NEVDEHLLT 168          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Match: A0A1S3I6K3 (E3 ubiquitin-protein ligase TRAF7-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106161152 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.051e-16
Identity = 74/329 (22.49%), Postives = 147/329 (44.68%), Query Frame = 1
Query:  601 MQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            ++Q  + LT R+K LE Q     +++EN           +L  L    D +   +   KNDA  N      +Q+  S  +    + S + S         +   W+ PF+F   G L+GH+  +  ++ + N + +S  D+ +++W++  L K          GC+  +  H  ++   T++     + S   +  +K W+  +    +  +  HE +  ++      +FT S + IK+W+  SL  + H  + + H++R L ++   ++ +YS  HN + +W        DS+       +L   I H F ++ S+V++ +YII G +
Sbjct:  206 LKQSVNELTSRVKTLEDQKLTMSSQIENCMS--------VLASLQQKYDSLSATNNT-KNDAQTNMSNVEKRQSRGSYGMARTTSTSSLGSPVSSPLGSPKYEKWVMPFTFKCMGTLRGHQGAVHCMARYGNKLFSSGADKLLKVWNLHALAK----------GCIQSVKAHIDTVH--TIAVGEGCLYSAGADFTIKRWNIETLEEQQVAQSAHENVICAMVCCGEYLFTSSYATIKVWDATSLSPL-HSIDGLYHWVRALALSQS-KDKVYSGSHNTIEIW--------DSTG----KFNLKGKIDHQFGSIYSLVVTQQYIIAGTY 499          

HSP 2 Score: 73.1738 bits (178), Expect = 1.193e-9
Identity = 47/150 (31.33%), Postives = 75/150 (50.00%), Query Frame = 3
Query:   90 EDPPTVFKCQNIN-------CLKNMID-AMTVKCGHSFCKKCAQSLD------KCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTC 497
            E  PT F  Q IN       C K   D  ++V CGH+FC+ C   L       KCP+D        + PN A+  QI+++ ++C +G+ +S   ++  ++ +GC E   L ++  HE +C Y  + CP    +   KMR K++E H  +C
Sbjct:    4 ERTPTRFT-QPINSHLLCPLCKKLFTDPVISVVCGHTFCRACISGLQRGETGAKCPIDERTFTE--LVPNRAVLGQIEDLEIYCRHGLTWSEDEHEFVLEPSGCPEKINLGNRLHHEERCQYAWITCPNSEGKFCGKMRRKELEHHLLSC 150          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:103038327])

HSP 1 Score: 77.0258 bits (188), Expect = 3.343e-14
Identity = 44/119 (36.97%), Postives = 62/119 (52.10%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHIN--NQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ VHC  G   S        E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   44 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFVHCKYGCRPSASGKPGAFEVDPLGCPFTIKLSTRKDHEGSCDYRPVRCP 158          

HSP 2 Score: 60.077 bits (144), Expect = 6.429e-9
Identity = 50/222 (22.52%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  310 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 501          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:103038327])

HSP 1 Score: 77.0258 bits (188), Expect = 3.474e-14
Identity = 44/119 (36.97%), Postives = 62/119 (52.10%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHIN--NQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ VHC  G   S        E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   88 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKLTV--VVNNIAVAEQIGELFVHCKYGCRPSASGKPGAFEVDPLGCPFTIKLSTRKDHEGSCDYRPVRCP 202          

HSP 2 Score: 59.6918 bits (143), Expect = 8.926e-9
Identity = 50/222 (22.52%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  354 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 545          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:103038327])

HSP 1 Score: 76.6406 bits (187), Expect = 3.693e-14
Identity = 44/119 (36.97%), Postives = 62/119 (52.10%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHIN--NQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ VHC  G   S        E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:   56 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFVHCKYGCRPSASGKPGAFEVDPLGCPFTIKLSTRKDHEGSCDYRPVRCP 170          

HSP 2 Score: 60.077 bits (144), Expect = 5.577e-9
Identity = 50/222 (22.52%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  322 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 513          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:103038327])

HSP 1 Score: 76.6406 bits (187), Expect = 4.340e-14
Identity = 44/119 (36.97%), Postives = 62/119 (52.10%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHIN--NQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + +KCP+DN K+    V  N+A++ QI E+ VHC  G   S        E+D  GC    +L  ++ HE  C YR V+CP
Sbjct:  138 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSEKCPVDNSKL--TVVVNNIAVAEQIGELFVHCKYGCRPSASGKPGAFEVDPLGCPFTIKLSTRKDHEGSCDYRPVRCP 252          

HSP 2 Score: 59.3066 bits (142), Expect = 1.005e-8
Identity = 50/222 (22.52%), Postives = 99/222 (44.59%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L     ++ S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  404 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNKLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 595          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 62.003 bits (149), Expect = 1.317e-9
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P   F+C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L  QI  + + C++              + GC+   Q+K  + H + C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRFQCPL--CSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIH-------------SEEGCRWTGQMKQLQGHFSTCAFNVIPCP---NRCAVKLTRRDLPEHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: BTRC (beta-transducin repeat containing E3 ubiquitin protein ligase [Source:HGNC Symbol;Acc:HGNC:1144])

HSP 1 Score: 60.8474 bits (146), Expect = 6.998e-10
Identity = 36/128 (28.12%), Postives = 68/128 (53.12%), Query Frame = 1
Query:  946 ILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            +L GHR  +  +   + +I+++S D+TI++W+ S     EF         V  L GH   I+CL   + +R V+S   ++ +++WD   G+ +R  E  HE++   +      I +G+ + +IK+W+L
Sbjct:  387 VLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTC---EF---------VRTLNGHKRGIACL--QYRDRLVVSGSSDNTIRLWDIECGACLRVLEG-HEELVRCIRFDNKRIVSGAYDGKIKVWDL 499          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: taf5l (TAF5-like RNA polymerase II, p300/CBP-associated factor (PCAF)-associated factor [Source:ZFIN;Acc:ZDB-GENE-030131-5987])

HSP 1 Score: 50.447 bits (119), Expect = 1.318e-6
Identity = 26/113 (23.01%), Postives = 54/113 (47.79%), Query Frame = 1
Query:  994 NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTG-SNSEIKIWNL 1326
            +++ T S D+T+R+W                G    + TGH  ++  L  S   R + S   +  +++WD  SG++V+E + H  +    S +   S + +G S+  +++W++
Sbjct:  440 SYVATGSADRTVRLWSAQ------------QGSAARLFTGHRGAVLALAFSPGGRLLASGGEDQRVRLWDIGSGAIVKELRGHSDDITCLSFSPDGSALASGSSDGSVRVWDV 540          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002506.1 (pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 gene:ENSPMAG00000002224.1 transcript:ENSPMAT00000002506.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 49.2914 bits (116), Expect = 1.479e-6
Identity = 43/185 (23.24%), Postives = 90/185 (48.65%), Query Frame = 1
Query:  943 GILKGHRKMITSLS---HFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFTGSNSE-IKIWNLDSLVQIGHVTEHINHFIRCLVI----NHPLENYLYSSGHNQ-VLVWQITLLK 1467
            G LKGH   +T ++    F + I+++S D+T+ +W ++   +  +G P  +      L GH + +S + +S   +  +S   +  L++WD ++G+  R    H  + ++ + +     I +GS  + IK+WN   + +     +    ++ C+      N+P+   + S G ++ V VW +T  K
Sbjct:    9 GTLKGHNGWVTQIATTPQFPDMILSASRDKTLIMWKLT-RDETNYGIPQRS------LHGHGHFVSDVVISSDGQFALSGSWDGTLRLWDLTTGTTTRRFVGHTKDVLSVAFSADNRQIVSGSRDKTIKLWNTLGVCKYTIQEDGHTEWVSCVRFSPNNNNPI---IVSCGWDKLVKVWNLTNCK 183          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: tbl3 (transducin (beta)-like 3 [Source:ZFIN;Acc:ZDB-GENE-041114-104])

HSP 1 Score: 50.0618 bits (118), Expect = 1.864e-6
Identity = 37/143 (25.87%), Postives = 64/143 (44.76%), Query Frame = 1
Query:  946 ILKGHRKMITSL--SHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNRE-VISVDIESNLKVWDFSSG----------SLVREKEHIHEKITTSVAVSKSIIFTGSNSE---IKIWNL 1326
            +L GHR M+ +L  S     + +SS D+T+R+W +         +   +  CV + TGH +++  +  S      ++S   +  LK+WD   G             R  E  H+K   SVAVS +     S S+   +++W +
Sbjct:  273 LLHGHRDMVLALDVSRRGTMLASSSKDRTVRVWSME--------EASGHVRCVAVATGHAHAVGAVAWSRLKDGFLVSGSQDCTLKLWDLPKGLSPSGTATTALTCRFTEKAHDKDVNSVAVSPNDRLVASGSQDHTVRLWAV 407          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008862.1 (pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 gene:ENSPMAG00000008000.1 transcript:ENSPMAT00000008862.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 47.7506 bits (112), Expect = 7.829e-6
Identity = 32/129 (24.81%), Postives = 60/129 (46.51%), Query Frame = 1
Query:  949 LKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDS 1332
            L GH   +  +    N +++ S D T+R+WDI              G C+ +L GH  ++ C  + +  R V+S   +  +KVWD  S + +   +  H     S+      I +GS ++ I++W+ ++
Sbjct:  310 LYGHTSTVRCMHLHGNRVVSGSRDATLRVWDIE------------TGQCLHVLAGHVAAVRC--VQYDGRRVVSGAYDYTVKVWDPESETCLHTLQG-HTNRVYSLQFDGVHIVSGSLDTSIRVWDAET 423          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: RRT13 (Putative protein of unknown function; non-essential gene identified in a screen for mutants with decreased levels of rDNA transcription [Source:SGD;Acc:S000000868])

HSP 1 Score: 48.521 bits (114), Expect = 5.895e-7
Identity = 38/139 (27.34%), Postives = 65/139 (46.76%), Query Frame = 1
Query:  946 ILKGHRKMITSL--SHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNG--------GCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDS 1332
            IL GH   I S    H     I++S D TIRIWD+  +         TN         G +  L GH   +  L LS  ++ ++S  ++ +++ WD ++  L    +H      T++ VS  ++ +GS   + I++L+S
Sbjct:    6 ILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDLENIRNNGECSYATNSASPCAKILGAMYTLRGHRALVGLLGLS--DKFLVSASVDGSIRCWDANTYFLKHFFDHTQLNTITALHVSDEVLVSGSEGLLNIYDLNS 142          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: MDV1 (Peripheral protein of cytosolic face of mitochondrial outer membrane; required for mitochondrial fission; interacts with Fis1p and with the self-assembled oligomeric form of the dynamin-related GTPase Dnm1p; contains WD repeats; MDV1 has a paralog, CAF4, that arose from the whole genome duplication [Source:SGD;Acc:S000003648])

HSP 1 Score: 50.0618 bits (118), Expect = 1.027e-6
Identity = 37/137 (27.01%), Postives = 64/137 (46.72%), Query Frame = 1
Query:  949 LKGHRKMITSLSHFENFIITSSHDQTIRIWDISP-----LIKGEFGKPLTNGGCVG-----ILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
             + H   +T+LS   +F+++ S D+TIR WD+        I   F   LT    V      +LT  N   S   L  F+  + +   +  +++WD  SG ++R  +  H    TS+    + + TGS +  ++IW+L
Sbjct:  498 FEAHTDEVTALSLDPSFLVSGSQDRTIRQWDLRSGKCLQTIDLSFANVLTTSTNVDLSKSTLLTQRNERPSIGALQSFDAALATGTKDGVVRLWDLRSGKVIRTLKG-HTDAITSLKFDSACLVTGSYDRTVRIWDL 633          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: MET30 (F-box protein containing five copies of the WD40 motif; controls cell cycle function, sulfur metabolism, and methionine biosynthesis as part of the ubiquitin ligase complex; interacts with and regulates Met4p, localizes within the nucleus; dissociation of Met30p from SCF complex in response to cadmium stress is regulated by Cdc48p [Source:SGD;Acc:S000001308])

HSP 1 Score: 47.7506 bits (112), Expect = 5.909e-6
Identity = 41/173 (23.70%), Postives = 80/173 (46.24%), Query Frame = 1
Query:  949 LKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQI---GHVTEHINHFIRCLVINHPLENYLYS-SGHNQVLVWQI 1455
             KGH   + +L      + T S+D TI IWD            L  G  +  L+GH+  +   TL + +R++I+  ++  ++VW++ +G  +       + + +  +  K I+   ++  +K+W+++S       GH TE +N    C+ + HP     +S S    + +W I
Sbjct:  298 FKGHMDGVLTLQFNYRLLFTGSYDSTIGIWD------------LFTGKLIRRLSGHSDGVK--TLYFDDRKLITGSLDKTIRVWNYITGECISTYRGHSDSVLSVDSYQKVIVSGSADKTVKVWHVESRTCYTLRGH-TEWVN----CVKL-HPKSFSCFSCSDDTTIRMWDI 450          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Match: CDC4 (F-box protein required for both the G1/S and G2/M phase transitions; modular substrate specificity factor which associates with core SCF (Cdc53p, Skp1p and Hrt1p/Rbx1p) to form the SCFCdc4 complex; SCFCdc4 acts as a ubiquitin-protein ligase directing ubiquitination of cyclin-dependent kinase (CDK) phosphorylated substrates, such as: Sic1p, Far1p, Cdc6p, Clb6p, and Cln3p [Source:SGD;Acc:S000001885])

HSP 1 Score: 46.9802 bits (110), Expect = 9.121e-6
Identity = 21/88 (23.86%), Postives = 44/88 (50.00%), Query Frame = 1
Query:  943 GILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDF 1206
            G+L+GH   + ++S   N +++ S+D T+ +WD++ +             C+ IL+GH   I         +  IS  +++ +++WD 
Sbjct:  524 GVLRGHMASVRTVSGHGNIVVSGSYDNTLIVWDVAQM------------KCLYILSGHTDRIYSTIYDHERKRCISASMDTTIRIWDL 599          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO37089 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGX8])

HSP 1 Score: 85.5001 bits (210), Expect = 2.365e-17
Identity = 43/142 (30.28%), Postives = 71/142 (50.00%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSR 509
            FV  P    KC +   L N    ++ +CGH+FC+ C+   +KCP+D   +   +   NLA+  Q++++ + C +G+  +      EID  GC E   +  +  HE  C Y +V CP   ++C    R +D+E H + C   R
Sbjct:    6 FVIQPSESLKCSHCRDLIND-PVISTQCGHTFCRLCSAENNKCPIDKTALTSSDFVSNLAVKAQVEDLLIFCRHGLTRTDSEESFEIDDGGCPERITIGRRSEHEESCLYAVVPCPNSSNQCG-TFRRRDLEEHLKVCNRYR 145          

HSP 2 Score: 57.7658 bits (138), Expect = 1.200e-8
Identity = 47/212 (22.17%), Postives = 94/212 (44.34%), Query Frame = 1
Query:  952 KGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            +GHR  I SL    + + +   D  I++W++  +             C+  L GH+  I   T+      + S   +  +  W   +     + E  H+ I  ++  +   +FT S+S IK+W   +L ++ H    ++H++R L ++   E  L S  HN + +W             T+ +  L + I H+  +V S+ ++ ++II+G +
Sbjct:  226 RGHRGAIWSLVSKGHRLFSGGSD-GIKVWNMENVRMAR---------CISSLDGHSSDIH--TMCVGGGRLFSAGSDQTIIAWSLDTLKQHAKVEKAHDNIICAIVYNGRYVFTSSHSCIKVWEPSTL-ELVHTINGLHHWVRALALDEKREK-LISGSHNVIHIWD------------TSGSFALRRKIDHTHGSVYSITVTKQFIIVGTY 411          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO48004 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKK9])

HSP 1 Score: 83.1889 bits (204), Expect = 1.484e-16
Identity = 58/219 (26.48%), Postives = 104/219 (47.49%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH   + +L      + + S D+TI++WD            LT   CV  L GH   +  L L   ++++ S   +  + +W   +  L+ +  H HE    ++   ++I+F+GS  +IK+WNLD+L  +  +T  +NH++R LV     ++YLYS  +  + +W +               L+ V+ +Q S  +V S+ ++  YII G +
Sbjct:  389 FKCKGTFVGHTGPVWALCVHGELLFSGSSDKTIKVWDT-----------LTTYKCVKTLEGHTGIV--LALCTHDKKLFSGSADCVINIWSIETLELL-DSIHGHENPVCTLVTKRNILFSGSLKKIKVWNLDTLELVREMT-GLNHWVRALV---ACDSYLYSGSYQTIKLWDLD-------------TLECVRVLQTSGGSVYSLAVTKEYIICGTY 576          

HSP 2 Score: 71.2478 bits (173), Expect = 8.001e-13
Identity = 50/156 (32.05%), Postives = 79/156 (50.64%), Query Frame = 3
Query:   72 DFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKC--AQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCV--------NGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSR 509
            + ILFV+ P     C    C +   D +   CGH+FC+ C  A+ ++KCPLD+ K+    V  NLA++ QI E+ +HC          G V  H     E+D +GC    ++ ++  HE  C Y   +CP    +C   +++ D+  H +TC+ SR
Sbjct:  119 EIILFVDKPSPKLFCPL--CRRVFKDPVITSCGHTFCQACIMARGVEKCPLDDNKLSI--VVANLAVAEQIGELYIHCKYGCRIRANGGGVVEH-----EVDSSGCPMKTKIINRREHEKNCQYAPTQCP-NSLQCPALLKM-DLPEHLKTCEHSR 263          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO39072 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SB92])

HSP 1 Score: 69.3218 bits (168), Expect = 1.994e-12
Identity = 49/177 (27.68%), Postives = 86/177 (48.59%), Query Frame = 1
Query:  949 LKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSV-----AVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSG--HNQVLVWQIT 1458
            L+GH   +  +   E+ I++ S+D TI++W             L  G C+  L GH+ +++CL L+   R+VIS  ++ NLK WD ++G  +   + I  +  T V     + S  I+  G +  +K+W+L+S  ++  +  H +  + CL  N    +Y   SG     V VW  +
Sbjct:  278 LRGHNAAVLCVQFDESKIVSGSYDNTIKVW------------SLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSLDHNLKFWDLATGKCIGTLDWIRSEGHTGVIRCLQSDSWRIVSAGDDKTLKMWSLESGQRLLTLRCHTDG-VTCLQFN----DYRIVSGSYDKTVKVWDFS 437          

HSP 2 Score: 53.9138 bits (128), Expect = 1.302e-7
Identity = 35/127 (27.56%), Postives = 64/127 (50.39%), Query Frame = 1
Query:  949 LKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNL 1326
            L GH   +  L+   N +++ S D++I++WD+S      F    +   C   + GH +++ CL +   + +V+S   +  LKVWD  +G+  +     H      V   +S I +GS ++ IK+W+L
Sbjct:  192 LAGHSGTVRCLNLNGNRLVSGSVDRSIKVWDLS------FESYWSGASCKVTMVGHMHTVRCLQVD--DEKVVSGSYDKTLKVWDIKTGN-CKLTLRGHNAAVLCVQFDESKIVSGSYDNTIKVWSL 309          

HSP 3 Score: 50.8322 bits (120), Expect = 1.246e-6
Identity = 50/211 (23.70%), Postives = 94/211 (44.55%), Query Frame = 1
Query:  952 KGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFS-----SGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDS----LVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQI-------TLLKNEDSSAITNVNLDLVQSIQHSF 1533
            +GH + I+ +   +  I++ S D+TI++WD+S   + +    LT       L GH+ ++ CL L+     ++S  ++ ++KVWD S     SG+  +     H      + V    + +GS +  +K+W++ +    L   GH     N  + C+  +      +  S  N + VW +       TL  + D+    N+ LD  + I  S 
Sbjct:  151 EGHTQGISCVQFDDTRIVSGSSDKTIKVWDLS---REDTSAVLT-------LAGHSGTVRCLNLN--GNRLVSGSVDRSIKVWDLSFESYWSGASCKVTMVGHMHTVRCLQVDDEKVVSGSYDKTLKVWDIKTGNCKLTLRGH-----NAAVLCVQFDE--SKIVSGSYDNTIKVWSLVEGSCLMTLAGHHDAVTCLNLTLDRRKVISGSL 342          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO44093 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWV7])

HSP 1 Score: 65.855 bits (159), Expect = 2.292e-11
Identity = 50/178 (28.09%), Postives = 82/178 (46.07%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNRE-VISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHIN-HFIRCLVINHPLENYLYSSGHNQVLVWQI 1455
            F    +L GH+  ++ L   EN +++ SHD TIR+WD+                CV +L GH  ++SCL    F+   V+S   +  +K+W+  SG  +      H    TSV V   +I +GS +  I  W+LDS    GH    I  H      +++  +++  + G N +  W +
Sbjct:  219 FTRLHVLYGHKGCVSCLRFDENTLVSGSHDSTIRVWDMRTW------------ECVLVLQGHEGAVSCLE---FDAPFVLSGSADKTIKLWNVESGDCLNTLRG-HADAVTSVKVIGELILSGSADGMILFWDLDS----GHCEAAIQAHEGPVHSLSYANDHFFSAGGDNMIKEWDV 376          

HSP 2 Score: 48.9062 bits (115), Expect = 5.687e-6
Identity = 48/207 (23.19%), Postives = 83/207 (40.10%), Query Frame = 1
Query:  922 PFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISP-----LIKGEFG---------KPLTNGGC--------------VGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGS-NSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQI 1455
            P     A +LKGH  ++  L      ++T S D+TIR+WD+        +KG  G         + + +G                + +L GH   +SCL        ++S   +S ++VWD  +   V   +  HE   + +      + +GS +  IK+WN++S   +  +  H +      VI    E  L  S    +L W +
Sbjct:  136 PALVQAANVLKGHMDVVLCLQFDRRRVVTGSSDRTIRMWDVRSGRSIRKMKGHKGGVRCLQFDNERIISGSWDMTIMVWHIVKFTRLHVLYGHKGCVSCLRFD--ENTLVSGSHDSTIRVWDMRTWECVLVLQG-HEGAVSCLEFDAPFVLSGSADKTIKLWNVESGDCLNTLRGHADAVTSVKVIG---ELILSGSADGMILFWDL 336          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Match: EDO33060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST98])

HSP 1 Score: 60.8474 bits (146), Expect = 1.269e-9
Identity = 36/112 (32.14%), Postives = 57/112 (50.89%), Query Frame = 1
Query:  994 NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVRE-KEHIHEKITTSVAVSKSIIFT-GSNSEIKIWN 1323
            N+I T S D+T+R+WDI              G  V + TGH  ++  L  S   R +IS  +++ L VWD + G+LV E K H     +   +   +I+ + G ++ IK+WN
Sbjct:  444 NYIATGSSDRTVRLWDIQ------------TGSSVRLFTGHKAAVQSLAFSRNGRHLISSGVDTRLLVWDLAEGTLVAELKGHTDTVYSLCFSRDGTILASAGLDNCIKLWN 543          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:101168715])

HSP 1 Score: 70.8626 bits (172), Expect = 2.613e-12
Identity = 44/132 (33.33%), Postives = 65/132 (49.24%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNG------------VVYSHINNQ---LEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + DKCP+D  K+    V  N+A++ QI E+ VHC  G               S++  +    E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   91 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSDKCPVDAAKL--TVVVNNIAVAEQIGELFVHCKYGCRATTPGGGGAPAPTSNVAGKPGAFEVDPLGCPFTIKLSTRKEHESSCDYRPVRCP 218          

HSP 2 Score: 59.6918 bits (143), Expect = 8.919e-9
Identity = 50/222 (22.52%), Postives = 98/222 (44.14%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L      + S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  370 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNRLYSGSADCTIIVWDIQTLQKVNTI-RAHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 561          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:101168715])

HSP 1 Score: 70.4774 bits (171), Expect = 3.267e-12
Identity = 44/132 (33.33%), Postives = 64/132 (48.48%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHC---------VNGVVYSHINN------QLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + DKCP+D  K+    V  N+A++ QI E+ VHC           G   +  +N        E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   89 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSDKCPVDAAKL--TVVVNNIAVAEQIGELFVHCKYGCRATTPGGGGAPAPTSNVAGKPGAFEVDPLGCPFTIKLSTRKYHESSCDYRPVRCP 216          

HSP 2 Score: 60.077 bits (144), Expect = 6.384e-9
Identity = 50/222 (22.52%), Postives = 98/222 (44.14%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L      + S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  364 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNRLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 555          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: traf7 (TNF receptor associated factor 7 [Source:NCBI gene;Acc:101168715])

HSP 1 Score: 70.4774 bits (171), Expect = 3.415e-12
Identity = 44/132 (33.33%), Postives = 64/132 (48.48%), Query Frame = 3
Query:   81 LFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHC---------VNGVVYSHINN------QLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCP 431
            +F E P     CQ   C     D +   CGH+FC++CA + DKCP+D  K+    V  N+A++ QI E+ VHC           G   +  +N        E+D  GC    +L  ++ HE+ C YR V+CP
Sbjct:   91 VFAEQPSVKLCCQL--CCSVFKDPVITTCGHTFCRRCALTSDKCPVDAAKL--TVVVNNIAVAEQIGELFVHCKYGCRATTPGGGGAPAPTSNVAGKPGAFEVDPLGCPFTIKLSTRKEHESSCDYRPVRCP 218          

HSP 2 Score: 59.3066 bits (142), Expect = 1.020e-8
Identity = 50/222 (22.52%), Postives = 98/222 (44.14%), Query Frame = 1
Query:  931 FLNAGILKGHRKMITSLSHFE--NFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNL-DSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            F   G   GH+  +  L  +   + + + S D+TI++WD     K           C   L GH+  +  L L      + S   +  + VWD  +   V      H+    ++  S +++F+GS   IK+W++  + +++      +NH++R LV +   +N+LYS  +  + +W I              +L+ V  +Q S  +V S+ ++  +I+ G +
Sbjct:  370 FKCKGTFVGHQGPVWCLCVYSTGDLLFSGSSDKTIKVWDTCTTYK-----------CQKTLEGHDGIV--LALCIQGNRLYSGSADCTIIVWDIQTLQKVNTIR-AHDNPVCTLVSSHNMLFSGSLKAIKVWDIVGTELKLKKELTGLNHWVRALVAS---QNHLYSGSYQTIKIWDIR-------------SLECVHVLQTSGGSVYSIAVTNHHIVCGTY 561          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 61.6178 bits (148), Expect = 1.492e-9
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P   F+C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L  QI  + + C++              + GC+   Q+K  + H + C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRFQCPL--CSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIH-------------SEEGCRWTGQMKQLQGHFSTCAFNVIPCP---NRCSVKLTRRDLPDHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 61.6178 bits (148), Expect = 1.588e-9
Identity = 40/142 (28.17%), Postives = 65/142 (45.77%), Query Frame = 3
Query:   84 FVEDPPTVFKCQNINCLKNMIDAMTVK-CGHSFCKKCAQ-----SLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQ 491
            F+E P   F+C    C K M + + V  CGH FC  C Q      + KCP D   +D   ++P+  L  QI  + + C++              + GC+   Q+K  + H + C + ++ CP   +RC  K+  +D+  H Q
Sbjct:    8 FLEKPKRRFQCPL--CSKAMREPVQVSTCGHRFCDTCLQEFLSEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIH-------------SEEGCRWTGQMKQLQGHFSTCAFNVIPCP---NRCSVKLTRRDLPDHLQ 131          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 746.888 bits (1927), Expect = 0.000e+0
Identity = 472/472 (100.00%), Postives = 472/472 (100.00%), Query Frame = 1
Query:  565 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCEXXXXXXXXXXXXMYASTCLYIHLYLPLFLYLFRXXXXXXXXXXXXXXXXXXXXXXXXYLCFSIYPSISFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPSLSIHSLYKAQKFTLIQFSMIFHLFMY 1980
            KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY
Sbjct:  169 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY 640          

HSP 2 Score: 353.599 bits (906), Expect = 0.000e+0
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 3
Query:   66 MSDFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 563
            MSDFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL
Sbjct:    1 MSDFILFVEDPPTVFKCQNINCLKNMIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 166          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 472/472 (100.00%), Postives = 472/472 (100.00%), Query Frame = 1
Query:  565 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCEXXXXXXXXXXXXMYASTCLYIHLYLPLFLYLFRXXXXXXXXXXXXXXXXXXXXXXXXYLCFSIYPSISFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPSLSIHSLYKAQKFTLIQFSMIFHLFMY 1980
            KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY
Sbjct:  144 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY 615          

HSP 2 Score: 301.982 bits (772), Expect = 0.000e+0
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 3
Query:  141 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 563
            MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL
Sbjct:    1 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 141          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 746.503 bits (1926), Expect = 0.000e+0
Identity = 472/472 (100.00%), Postives = 472/472 (100.00%), Query Frame = 1
Query:  565 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCEXXXXXXXXXXXXMYASTCLYIHLYLPLFLYLFRXXXXXXXXXXXXXXXXXXXXXXXXYLCFSIYPSISFXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNPSLSIHSLYKAQKFTLIQFSMIFHLFMY 1980
            KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY
Sbjct:  140 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIPSYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYLSLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMY 611          

HSP 2 Score: 293.508 bits (750), Expect = 0.000e+0
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 3
Query:  153 MTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 563
            MTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL
Sbjct:    1 MTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 137          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 671.389 bits (1731), Expect = 0.000e+0
Identity = 343/343 (100.00%), Postives = 343/343 (100.00%), Query Frame = 1
Query:  565 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCE 1593
            KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCE
Sbjct:  144 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKFCE 486          

HSP 2 Score: 301.982 bits (772), Expect = 0.000e+0
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 3
Query:  141 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 563
            MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL
Sbjct:    1 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 141          
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Match: SMESG000069927.1 (SMESG000069927.1)

HSP 1 Score: 663.3 bits (1710), Expect = 0.000e+0
Identity = 339/341 (99.41%), Postives = 340/341 (99.71%), Query Frame = 1
Query:  565 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMXXXXXXXXXXXXLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGKF 1587
            KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIG +
Sbjct:  144 KPQLKISETKPNMQQIADSLTLRIKRLETQMNGSLNRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQTNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKMITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHNYSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVAVSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLYSSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARYIIIGTY 484          

HSP 2 Score: 301.597 bits (771), Expect = 0.000e+0
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 3
Query:  141 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 563
            MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL
Sbjct:    1 MIDAMTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCVNGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCKEKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL 141          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF76.136e-1534.27TNF receptor associated factor 7 [Source:HGNC Symb... [more]
TRAF42.685e-926.76TNF receptor associated factor 4 [Source:HGNC Symb... [more]
BTRC3.156e-928.13beta-transducin repeat containing E3 ubiquitin pro... [more]
BTRC3.641e-928.13beta-transducin repeat containing E3 ubiquitin pro... [more]
BTRC3.768e-928.13beta-transducin repeat containing E3 ubiquitin pro... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lin-239.621e-1024.19F-box/WD repeat-containing protein lin-23 [Source... [more]
rack-19.888e-1027.21Guanine nucleotide-binding protein subunit beta-2-... [more]
rack-19.888e-1027.21Guanine nucleotide-binding protein subunit beta-2-... [more]
rack-19.888e-1027.21Guanine nucleotide-binding protein subunit beta-2-... [more]
lin-231.007e-924.19F-box/WD repeat-containing protein lin-23 [Source... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slmb1.679e-928.91gene:FBgn0283468 transcript:FBtr0084032[more]
slmb1.679e-928.91gene:FBgn0283468 transcript:FBtr0333931[more]
slmb2.072e-928.91gene:FBgn0283468 transcript:FBtr0330049[more]
Taf53.905e-726.77gene:FBgn0010356 transcript:FBtr0088240[more]
ago5.423e-627.34gene:FBgn0041171 transcript:FBtr0073246[more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf74.933e-1436.13TNF receptor-associated factor 7 [Source:ZFIN;Acc:... [more]
traf75.187e-1436.13TNF receptor-associated factor 7 [Source:ZFIN;Acc:... [more]
traf75.187e-1436.13TNF receptor-associated factor 7 [Source:ZFIN;Acc:... [more]
traf4a8.371e-1028.17tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a8.371e-1028.17tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf72.806e-1433.10TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.125e-1433.10TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.554e-1436.07TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.657e-1436.07TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.800e-1433.10TNF receptor associated factor 7 [Source:NCBI gene... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf77.518e-1532.17TNF receptor-associated factor 7 [Source:MGI Symbo... [more]
Traf73.195e-1435.00TNF receptor-associated factor 7 [Source:MGI Symbo... [more]
Traf73.195e-1435.00TNF receptor-associated factor 7 [Source:MGI Symbo... [more]
Traf73.564e-1435.00TNF receptor-associated factor 7 [Source:MGI Symbo... [more]
Traf73.564e-1435.00TNF receptor-associated factor 7 [Source:MGI Symbo... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6Q0C0|TRAF7_HUMAN2.946e-1434.27E3 ubiquitin-protein ligase TRAF7 OS=Homo sapiens ... [more]
sp|Q922B6|TRAF7_MOUSE2.104e-1335.00E3 ubiquitin-protein ligase TRAF7 OS=Mus musculus ... [more]
sp|P42527|MHCKA_DICDI6.104e-1223.89Myosin heavy chain kinase A OS=Dictyostelium disco... [more]
sp|Q21215|GBLP_CAEEL1.258e-827.21Guanine nucleotide-binding protein subunit beta-2-... [more]
sp|Q09990|LIN23_CAEEL1.616e-824.19F-box/WD repeat-containing protein lin-23 OS=Caeno... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3S0ZCN47.801e-3624.93Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
H2ZEN64.972e-2632.39Uncharacterized protein OS=Ciona savignyi OX=51511... [more]
A0A2G8L0U42.654e-2222.12Putative E3 ubiquitin-protein ligase OS=Stichopus ... [more]
A0A2T7NIZ19.464e-2126.99Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3I6K31.051e-1622.49E3 ubiquitin-protein ligase TRAF7-like isoform X2 ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf73.343e-1436.97TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.474e-1436.97TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.693e-1436.97TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf74.340e-1436.97TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf4a1.317e-928.17TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
BTRC6.998e-1028.13beta-transducin repeat containing E3 ubiquitin pro... [more]
taf5l1.318e-623.01TAF5-like RNA polymerase II, p300/CBP-associated f... [more]
ENSPMAT00000002506.11.479e-623.24pep scaffold:Pmarinus_7.0:GL479076:26529:32136:-1 ... [more]
tbl31.864e-625.87transducin (beta)-like 3 [Source:ZFIN;Acc:ZDB-GENE... [more]
ENSPMAT00000008862.17.829e-624.81pep scaffold:Pmarinus_7.0:GL476579:86637:114999:1 ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 4
Match NameE-valueIdentityDescription
RRT135.895e-727.34Putative protein of unknown function; non-essentia... [more]
MDV11.027e-627.01Peripheral protein of cytosolic face of mitochondr... [more]
MET305.909e-623.70F-box protein containing five copies of the WD40 m... [more]
CDC49.121e-623.86F-box protein required for both the G1/S and G2/M ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO370892.365e-1730.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO480041.484e-1626.48Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO390721.994e-1227.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440932.292e-1128.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330601.269e-932.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf72.613e-1233.33TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.267e-1233.33TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf73.415e-1233.33TNF receptor associated factor 7 [Source:NCBI gene... [more]
traf4a1.492e-928.17TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.588e-928.17TNF receptor associated factor 4 [Source:NCBI gene... [more]
back to top
BLAST of E3 ubiquitin-protein ligase TRAF7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000069927.10.000e+0100.00SMESG000069927.1[more]
SMESG000069927.10.000e+0100.00SMESG000069927.1[more]
SMESG000069927.10.000e+0100.00SMESG000069927.1[more]
SMESG000069927.10.000e+0100.00SMESG000069927.1[more]
SMESG000069927.10.000e+099.41SMESG000069927.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016251 ID=SMED30016251|Name=E3 ubiquitin-protein ligase TRAF7|organism=Schmidtea mediterranea sexual|type=transcript|length=2154bp
GTTGCTTTATTGTCTACATAAAATTAATTATTTTGAACTTTGGTAATTTT
CATATTTACATTTTTATGTCTGATTTTATTTTATTTGTCGAAGATCCTCC
AACCGTTTTTAAATGCCAAAATATAAACTGTTTGAAAAATATGATAGATG
CAATGACAGTGAAATGCGGTCATTCATTTTGTAAGAAATGTGCCCAATCA
CTTGATAAGTGCCCACTCGATAACTTTAAAATTGACAGGAAAAATGTCTT
TCCAAATTTGGCATTGTCTATTCAAATTCAAGAAATGTCTGTACATTGTG
TGAATGGAGTCGTATACAGTCATATTAATAATCAATTAGAAATCGATCAA
ACCGGATGTCAGGAAATATTTCAACTCAAACATAAAGAAACCCACGAGGC
TCAATGTCCATATAGAATTGTAAAGTGTCCATTTTACGGAGATAGATGCA
AAGAGAAAATGAGGTTGAAGGATATTGAATTGCACAAACAGACGTGTAAA
TCCTCACGTAAAACAAACAATGTATTTATTTATGCCAAACCAGATAATCT
TAATGAGCATCTCTAAACCGCAACTTAAAATTTCAGAAACCAAGCCAAAT
ATGCAACAAATTGCCGATAGTTTAACCCTCAGGATCAAAAGATTAGAAAC
CCAAATGAATGGTTCATTGAATAGAATGGAAAATATGTTTTTTGAGATTC
ACACGGGAATCAAATTGATACTTAATCAACTGAATATCTCAACAGATCAA
ATGGAAAATAATGATAAAATATTAAAAAATGATGCAAATAATAATTTCCT
TCGCCCACATTCACAACAAACAAATTGTTCTCTCTCATTAAAAGACATGA
TTAATATCAGTGGAATCATTTCCAATCCCGGAGGTCTTTCACAAGTATAT
CGAAGTTCTCATTGGATATGTCCATTTTCATTTTTAAATGCCGGTATTCT
AAAAGGTCATCGAAAAATGATCACGAGTCTTTCTCATTTTGAAAATTTCA
TAATAACCAGTTCTCATGATCAAACAATTCGAATATGGGATATTTCTCCA
TTAATTAAAGGTGAATTCGGTAAACCGCTTACGAATGGAGGATGTGTCGG
TATTCTTACCGGTCACAATTATTCGATTTCGTGTCTCACTTTGAGTTGGT
TTAACAGAGAAGTTATTTCTGTTGATATAGAATCCAATTTGAAAGTTTGG
GACTTTTCCTCAGGATCTCTAGTCAGAGAAAAAGAACATATTCATGAAAA
AATTACGACCAGTGTTGCGGTGAGCAAATCGATTATTTTCACTGGATCCA
ATTCCGAGATCAAAATATGGAATTTAGACAGTCTAGTACAAATCGGTCAC
GTTACTGAGCATATAAACCATTTCATTCGTTGCTTAGTCATAAATCATCC
ACTAGAAAACTATCTCTATAGTTCAGGACATAATCAGGTTCTCGTTTGGC
AAATCACGCTTTTGAAAAATGAGGATTCCTCAGCAATAACCAATGTAAAT
TTAGATTTGGTCCAATCAATTCAACATTCGTTTTATACAGTCAATAGCAT
GGTTATCTCTGCTCGTTACATTATAATAGGCAAGTTTTGTGAATTACTTA
TCCTCGTCTCTCTATCACTATCCCTCTCAATGTATGCCTCTACTTGTTTA
TATATACATCTTTATCTACCTCTGTTTCTCTATCTATTCCGCTCTAGCTA
CCCCTCTATATCTATCCCTTCCTATCTTTCCTCTTCTATCTCTGTTTTTC
TATCTTTTCCTCTCTATCTTTGTTTCTCTATCTATCCTTCTATATCATTC
CCTCCCTATCTACCACCCTCTATCTCTGTTTCTCTACCTATTCCATCTCT
ATCTATCCTTATCTATTTATCTCTCTATCTCTGCCTTTATATTAATCCAT
CTCTATCGATTCATTCTCTATATAAAGCTCAAAAATTTACACTGATCCAA
TTTTCTATGATATTTCATTTATTCATGTATAATACAATTACTACCGAAAA
CGAAATCAGCGAATCAAGTGAACATTGAAACCACTTTAAATTTATTAAAA
TACGAATAATTTCAAAAAAACAAGGACTGAATTAAGTTATCAGTAACTAC
AACCAGGGGCGGATCGACCTATCGCGCGTTTGGGCCAATGCGACAGCAGC
TATT
back to top

protein sequence of SMED30016251-orf-1

>SMED30016251-orf-1 ID=SMED30016251-orf-1|Name=SMED30016251-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=188bp
CFIVYIKLIILNFGNFHIYIFMSDFILFVEDPPTVFKCQNINCLKNMIDA
MTVKCGHSFCKKCAQSLDKCPLDNFKIDRKNVFPNLALSIQIQEMSVHCV
NGVVYSHINNQLEIDQTGCQEIFQLKHKETHEAQCPYRIVKCPFYGDRCK
EKMRLKDIELHKQTCKSSRKTNNVFIYAKPDNLNEHL*
back to top

protein sequence of SMED30016251-orf-2

>SMED30016251-orf-2 ID=SMED30016251-orf-2|Name=SMED30016251-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=503bp
MYLFMPNQIILMSISKPQLKISETKPNMQQIADSLTLRIKRLETQMNGSL
NRMENMFFEIHTGIKLILNQLNISTDQMENNDKILKNDANNNFLRPHSQQ
TNCSLSLKDMINISGIISNPGGLSQVYRSSHWICPFSFLNAGILKGHRKM
ITSLSHFENFIITSSHDQTIRIWDISPLIKGEFGKPLTNGGCVGILTGHN
YSISCLTLSWFNREVISVDIESNLKVWDFSSGSLVREKEHIHEKITTSVA
VSKSIIFTGSNSEIKIWNLDSLVQIGHVTEHINHFIRCLVINHPLENYLY
SSGHNQVLVWQITLLKNEDSSAITNVNLDLVQSIQHSFYTVNSMVISARY
IIIGKFCELLILVSLSLSLSMYASTCLYIHLYLPLFLYLFRSSYPSISIP
SYLSSSISVFLSFPLYLCFSIYPSISFPPYLPPSISVSLPIPSLSILIYL
SLYLCLYINPSLSIHSLYKAQKFTLIQFSMIFHLFMYNTITTENEISESS
EH*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006364rRNA processing
GO:0006511ubiquitin-dependent protein catabolic process
GO:0007275multicellular organism development
GO:0016567protein ubiquitination
GO:0000185activation of MAPKKK activity
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
GO:0006915apoptotic process
GO:0043410positive regulation of MAPK cascade
GO:2001235positive regulation of apoptotic signaling pathway
Vocabulary: molecular function
TermDefinition
GO:0034511U3 snoRNA binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
GO:0016740transferase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0002056medial muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR039241Rrp9-like
IPR036322WD40_repeat_dom_sf
IPR001680WD40_repeat
IPR015943WD40/YVTN_repeat-like_dom_sf
IPR019775WD40_repeat_CS
IPR017986WD40_repeat_dom
IPR013083Znf_RING/FYVE/PHD
IPR0181217-in-absentia-prot_TRAF-dom
IPR013323SIAH-type
IPR018957Znf_C3HC4_RING-type
IPR017907Znf_RING_CS
IPR001841Znf_RING
IPR008974TRAF-like
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0000151ubiquitin ligase complex
GO:0005886plasma membrane
GO:0031410cytoplasmic vesicle
GO:0043231intracellular membrane-bounded organelle
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 32..52
NoneNo IPR availablePANTHERPTHR19865:SF2F-BOX AND WD REPEAT DOMAIN-CONTAINING 11Acoord: 30..355
NoneNo IPR availableTMHMMTMhelixcoord: 403..425
NoneNo IPR availableTMHMMTMhelixcoord: 440..462
NoneNo IPR availableTMHMMTMhelixcoord: 368..390
IPR001680WD40 repeatSMARTSM00320WD40_4coord: 189..228
e-value: 0.0022
score: 27.2
coord: 231..268
e-value: 4.8
score: 12.7
coord: 137..174
e-value: 0.0024
score: 27.1
coord: 271..311
e-value: 42.0
score: 6.8
IPR001680WD40 repeatPFAMPF00400WD40coord: 142..174
e-value: 3.0E-5
score: 24.7
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 196..237
score: 10.642
IPR001680WD40 repeatPROSITEPS50082WD_REPEATS_2coord: 144..176
score: 12.246
IPR015943WD40/YVTN repeat-like-containing domain superfamilyGENE3DG3DSA:2.130.10.10coord: 78..354
e-value: 2.1E-25
score: 91.3
IPR039241Ribosomal RNA-processing protein Rrp9-likePANTHERPTHR19865U3 SMALL NUCLEOLAR RNA INTERACTING PROTEIN 2coord: 30..355
IPR019775WD40 repeat, conserved sitePROSITEPS00678WD_REPEATS_1coord: 161..175
IPR017986WD40-repeat-containing domainPROSITEPS50294WD_REPEATS_REGIONcoord: 144..320
score: 18.273
IPR036322WD40-repeat-containing domain superfamilySUPERFAMILYSSF50978WD40 repeat-likecoord: 143..364