PB1 domain-containing protein

Overview
NamePB1 domain-containing protein
Smed IDSMED30016246
Length (bp)5077
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PB1 domain-containing protein (SMED30016246) t-SNE clustered cells

Violin plots show distribution of expression levels for PB1 domain-containing protein (SMED30016246) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of PB1 domain-containing protein (SMED30016246) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for PB1 domain-containing protein (SMED30016246) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016246

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymaSMED30016246h1SMcG0021131 dd_Smed_v4_2069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30016246h1SMcG0021131 dd_Smed_v4_2069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016246h1SMcG0021131 dd_Smed_v4_2069_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016246h1SMcG0021131 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016246h1SMcG0021131 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016246h1SMcG0021131 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30016246h1SMcG0021131 dd_Smed_v4_3842_3_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016246h1SMcG0012966 OX_Smed_1.0.11088ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016246h1SMcG0021131 OX_Smed_1.0.11088ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30016246h1SMcG0021131 Contig37979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016246h1SMcG0021131 Contig37979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016246h1SMcG0022045 Contig37979uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016246h1SMcG0022045 Contig37979newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PB1 domain-containing protein vs. Ensembl Human
Match: TFG (trafficking from ER to golgi regulator [Source:HGNC Symbol;Acc:HGNC:11758])

HSP 1 Score: 91.2781 bits (225), Expect = 3.954e-20
Identity = 81/178 (45.51%), Postives = 110/178 (61.80%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL-----AHSNGDAIQNAIASGRTSAIEGKDLQETSGKE-----------FDPL 543
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V    N    P   L S ++  +R+EL  +R+  NRLLD L        + +  +N    GR    E K   ++SGK+           FDPL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFV----NGQPRP---LESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGR----EEKSASDSSGKQSTQVMAASMSAFDPL 171          
BLAST of PB1 domain-containing protein vs. Ensembl Human
Match: TFG (trafficking from ER to golgi regulator [Source:HGNC Symbol;Acc:HGNC:11758])

HSP 1 Score: 89.7373 bits (221), Expect = 7.393e-20
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNRLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Human
Match: TFG (trafficking from ER to golgi regulator [Source:HGNC Symbol;Acc:HGNC:11758])

HSP 1 Score: 88.1965 bits (217), Expect = 1.239e-19
Identity = 69/126 (54.76%), Postives = 92/126 (73.02%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V    N    P   L S ++  +R+EL  +R+  NRLLD L
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFV----NGQPRP---LESSQVKYLRRELIELRNKVNRLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Human
Match: TFG (trafficking from ER to golgi regulator [Source:HGNC Symbol;Acc:HGNC:11758])

HSP 1 Score: 91.2781 bits (225), Expect = 3.680e-19
Identity = 78/174 (44.83%), Postives = 104/174 (59.77%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRT-SAIEGKDLQETSGKE-----------FDPL 543
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L           I    T    E K   ++SGK+           FDPL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPL 171          
BLAST of PB1 domain-containing protein vs. Ensembl Human
Match: TFG (trafficking from ER to golgi regulator [Source:HGNC Symbol;Acc:HGNC:11758])

HSP 1 Score: 91.2781 bits (225), Expect = 3.680e-19
Identity = 78/174 (44.83%), Postives = 104/174 (59.77%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRT-SAIEGKDLQETSGKE-----------FDPL 543
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L           I    T    E K   ++SGK+           FDPL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPL 171          
BLAST of PB1 domain-containing protein vs. Ensembl Zebrafish
Match: tfg (trafficking from ER to golgi regulator [Source:ZFIN;Acc:ZDB-GENE-030131-8410])

HSP 1 Score: 90.1225 bits (222), Expect = 3.082e-18
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ +L + DE+ IKYKDEDDDLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  N LLD L
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKHLRRELIHLRNKVNSLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Zebrafish
Match: tfg (trafficking from ER to golgi regulator [Source:ZFIN;Acc:ZDB-GENE-030131-8410])

HSP 1 Score: 90.1225 bits (222), Expect = 3.082e-18
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ +L + DE+ IKYKDEDDDLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  N LLD L
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKHLRRELIHLRNKVNSLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Zebrafish
Match: tfg (trafficking from ER to golgi regulator [Source:ZFIN;Acc:ZDB-GENE-030131-8410])

HSP 1 Score: 90.1225 bits (222), Expect = 3.082e-18
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ +L + DE+ IKYKDEDDDLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  N LLD L
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKHLRRELIHLRNKVNSLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Xenopus
Match: chrd.1 (chordin, gene 1 [Source:Xenbase;Acc:XB-GENE-480638])

HSP 1 Score: 91.2781 bits (225), Expect = 1.820e-18
Identity = 70/150 (46.67%), Postives = 99/150 (66.00%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKD 507
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL   DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L       I +++      A++G++
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLTNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNRLLDCLEPPAEPGIPSSLPD--NEAVDGRE 145          
BLAST of PB1 domain-containing protein vs. Ensembl Mouse
Match: Tfg (Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041])

HSP 1 Score: 88.9669 bits (219), Expect = 4.434e-20
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELVELRNKVNRLLDSL 123          
BLAST of PB1 domain-containing protein vs. Ensembl Mouse
Match: Tfg (Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041])

HSP 1 Score: 92.8189 bits (229), Expect = 3.692e-19
Identity = 77/177 (43.50%), Postives = 108/177 (61.02%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKD----LQETSGKE-----------FDPL 543
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L          +I    T  ++G++      ++SGK+           FDPL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELVELRNKVNRLLDSLEPPGEPGPSTSIPENDT--VDGREEKPAASDSSGKQSTQVMAASMSAFDPL 172          
BLAST of PB1 domain-containing protein vs. Ensembl Mouse
Match: Tfg (Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041])

HSP 1 Score: 76.2554 bits (186), Expect = 5.188e-16
Identity = 55/86 (63.95%), Postives = 72/86 (83.72%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTV 315
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFV 90          
BLAST of PB1 domain-containing protein vs. Ensembl Mouse
Match: Tfg (Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041])

HSP 1 Score: 74.3294 bits (181), Expect = 1.588e-15
Identity = 54/84 (64.29%), Postives = 71/84 (84.52%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTL 309
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTL 88          
BLAST of PB1 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92734|TFG_HUMAN (Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV=2)

HSP 1 Score: 92.0485 bits (227), Expect = 4.954e-18
Identity = 79/178 (44.38%), Postives = 108/178 (60.67%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL-----AHSNGDAIQNAIASGRTSAIEGKDLQETSGKE-----------FDPL 543
            +DL+ KLIIK Q  ++IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  NRLLD L        + +  +N    GR    E K   ++SGK+           FDPL
Sbjct:    5 LDLSGKLIIKAQLGEDIRRIPIHNEDITYDELVLMMQRVFRGKLLSNDEVTIKYKDEDGDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGR----EEKSASDSSGKQSTQVMAASMSAFDPL 171          
BLAST of PB1 domain-containing protein vs. TrEMBL
Match: A0A2T7P5K5 (PB1 domain-containing protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_11280 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 3.642e-22
Identity = 88/181 (48.62%), Postives = 114/181 (62.98%), Query Frame = 1
Query:   46 Y*IFMDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL---AHSNGDAIQNAIASGRTSA-------IEGKDLQETSG---KEFDPLSV 549
            Y   +DL+ KLIIKVQ  ++IR++PIHNEDITYDEL++MM+R+++ KLS  D+I+IKYKDED DLITI D SDLAFA++ S +LK+TL V      D         G+I S+R+ELQ IRD    +LDR+   A S   A  ++I  GR  A       + G  L   S    KEFDPLS 
Sbjct:    5 YGAALDLSGKLIIKVQLGEDIRRIPIHNEDITYDELVLMMQRVYRGKLSTNDDIVIKYKDEDGDLITIFDSSDLAFAIQCSRILKITLFVNGQRLSD--------VGDIRSLRRELQAIRDRVTAILDRMDSPATSVISAADSSITDGRPDAASSTKVSVRGSGLTHASAAESKEFDPLST 177          
BLAST of PB1 domain-containing protein vs. TrEMBL
Match: A0A023FGV2 (PB1 domain-containing protein (Fragment) OS=Amblyomma cajennense OX=34607 PE=2 SV=1)

HSP 1 Score: 108.612 bits (270), Expect = 4.064e-22
Identity = 87/187 (46.52%), Postives = 116/187 (62.03%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAH----SNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPL----SVGNQPQLSSVERSETG 594
            +DL+ KLIIK Q  D+IR++PIHNEDITYDELI+MM+R+F+ KLS+ DE+ +KYKDED DLITI D SDL+FA++ S +LKLT+ V    N    P   L   EI  +RKELQ IR+  NRLLDR       SN    +++  +    A         + KEFDPL    + G++P   +  + E G
Sbjct:   23 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELILMMQRVFRGKLSSSDEVTVKYKDEDGDLITIFDSSDLSFAIQCSRILKLTIFV----NHQPVP---LEPDEIKHLRKELQEIRNVVNRLLDRFEPRHFVSNSSEPEDSAGTAPQKAT-----NTVAPKEFDPLASKQAAGDEPSAQAKPKGENG 197          
BLAST of PB1 domain-containing protein vs. TrEMBL
Match: A0A131ZAJ0 (Protein TFG (Fragment) OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 1.398e-21
Identity = 88/187 (47.06%), Postives = 115/187 (61.50%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAH----SNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPL----SVGNQPQLSSVERSETG 594
            +DL+ KLIIK Q  D+IR++PIHNEDITYDELI+MM+R+F+ KLS  DE+ +KYKDED DLITI D SDL+FA++ S +LKLT+ V    N+   P   L   EI  +RKELQ IR+  NRLLDR       SN    +++  S        K     + KEFDPL    + G++P      + E G
Sbjct:   43 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELILMMQRVFRGKLSTNDEVTVKYKDEDGDLITIFDSSDLSFAIQCSRILKLTIFV----NQQPVP---LEPDEIKHLRKELQEIRNVVNRLLDRFEPRHFLSNNSEPEDSAGSAPL-----KTTNAVAPKEFDPLASKQAAGDEPNAQIKPKGENG 217          
BLAST of PB1 domain-containing protein vs. TrEMBL
Match: A0A023FRY7 (PB1 domain-containing protein (Fragment) OS=Amblyomma parvum OX=251391 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.456e-21
Identity = 88/185 (47.57%), Postives = 118/185 (63.78%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLA--HSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPL----SVGNQPQLSSVERSETG 594
            +DL+ KLIIK Q  D+IR++PIHNEDITYDELI+MM+R+F+ KLS+ DE+ +KYKDED DLITI D SDL+FA++ S +LKLT+ V    N    P   L   EI  +RKELQ IR+  NRLLDR    H   ++ +   ++G T     K     + KEFDPL    + G++P   +  + E G
Sbjct:   23 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELILMMQRVFRGKLSSSDEVTVKYKDEDGDLITIFDSSDLSFAIQCSRILKLTIFV----NHQPVP---LEPDEIKHLRKELQEIRNVVNRLLDRFEPRHFVSNSSEPEDSAGVTPL---KATNTVAPKEFDPLASKQAAGDEPSAQAKPKGENG 197          
BLAST of PB1 domain-containing protein vs. TrEMBL
Match: A0A224Z2N3 (Protein TFG (Fragment) OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 107.842 bits (268), Expect = 1.907e-21
Identity = 88/187 (47.06%), Postives = 115/187 (61.50%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAH----SNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPL----SVGNQPQLSSVERSETG 594
            +DL+ KLIIK Q  D+IR++PIHNEDITYDELI+MM+R+F+ KLS  DE+ +KYKDED DLITI D SDL+FA++ S +LKLT+ V    N+   P   L   EI  +RKELQ IR+  NRLLDR       SN    +++  S    A         + KEFDPL    + G++P      + E G
Sbjct:   18 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELILMMQRVFRGKLSTNDEVTVKYKDEDGDLITIFDSSDLSFAIQCSRILKLTIFV----NQQPVP---LEPDEIKHLRKELQEIRNVVNRLLDRFEPRHFLSNNSEPEDSAGSAPLKATNA-----VAPKEFDPLASKQAAGDEPNAQIKPKGENG 192          
BLAST of PB1 domain-containing protein vs. Ensembl Cavefish
Match: tfg (trafficking from ER to golgi regulator [Source:NCBI gene;Acc:103044118])

HSP 1 Score: 92.8189 bits (229), Expect = 3.214e-19
Identity = 77/170 (45.29%), Postives = 108/170 (63.53%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKD--------LQETSGKEFDPL 543
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ +L + DE+ IKYKDEDDDLITI D SDL+FA++ S +LKLTL V             L S ++  +RKEL  +R+  N LLD L   +  A+++  ++ +T  +E  D        +   S   FDPL
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKHLRKELIQLRNKINSLLDSLEPPSEPALES--SNPQTECVEAVDAAVKQAPPVSAASMSAFDPL 165          
BLAST of PB1 domain-containing protein vs. Ensembl Cavefish
Match: tfg (trafficking from ER to golgi regulator [Source:NCBI gene;Acc:103044118])

HSP 1 Score: 92.8189 bits (229), Expect = 3.229e-19
Identity = 77/170 (45.29%), Postives = 108/170 (63.53%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKD--------LQETSGKEFDPL 543
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ +L + DE+ IKYKDEDDDLITI D SDL+FA++ S +LKLTL V             L S ++  +RKEL  +R+  N LLD L   +  A+++  ++ +T  +E  D        +   S   FDPL
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELLLMMQRVFRGQLQSSDEVTIKYKDEDDDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKHLRKELIQLRNKINSLLDSLEPPSEPALES--SNPQTECVEAVDAAVKQAPPVSAASMSAFDPL 165          
BLAST of PB1 domain-containing protein vs. Ensembl Nematostella
Match: EDO42033 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2N3])

HSP 1 Score: 71.2478 bits (173), Expect = 6.016e-15
Identity = 51/84 (60.71%), Postives = 71/84 (84.52%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTL 309
            +DL+ KLIIK Q  D+IR++PIHNED+TYDEL++MM+R+F+ KL++ D+++IKYKDED DL+TI D SDL+FA   S +L+LTL
Sbjct:    1 VDLSGKLIIKAQLGDDIRRIPIHNEDLTYDELLLMMQRVFRGKLNSSDDVLIKYKDEDGDLVTIFDSSDLSFAKSMSRILRLTL 84          
BLAST of PB1 domain-containing protein vs. Ensembl Medaka
Match: tfg (trafficking from ER to golgi regulator [Source:NCBI gene;Acc:101164600])

HSP 1 Score: 92.8189 bits (229), Expect = 3.380e-19
Identity = 67/126 (53.17%), Postives = 90/126 (71.43%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRL 435
            +DL+ KLIIK Q  D+IR++PIHNEDITYDEL++MM+R+F+ KL + DE+ IKYKDED+DLITI D SDL+FA++ S +LKLTL V             L S ++  +R+EL  +R+  N LLD L
Sbjct:    5 LDLSGKLIIKAQLGDDIRRIPIHNEDITYDELVLMMQRVFRGKLQSSDEVTIKYKDEDEDLITIFDSSDLSFAIQCSRILKLTLFVNGQPRP-------LESSQVKYLRRELIELRNKVNYLLDSL 123          
BLAST of PB1 domain-containing protein vs. Planmine SMEST
Match: SMESG000024267.1 (SMESG000024267.1)

HSP 1 Score: 403.675 bits (1036), Expect = 1.425e-125
Identity = 229/244 (93.85%), Postives = 235/244 (96.31%), Query Frame = 1
Query:   58 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQVKIEINLLINVFITI*IENI 789
            MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAEDEIIIKYKDEDDDLITISDDSDLAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQ  I  N +  V +++ I+N+
Sbjct:    1 MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAEDEIIIKYKDEDDDLITISDDSDLAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQTPIGYNNVSQVPVSMGIQNV 244          
BLAST of PB1 domain-containing protein vs. Planmine SMEST
Match: SMESG000024267.1 (SMESG000024267.1)

HSP 1 Score: 365.155 bits (936), Expect = 4.533e-112
Identity = 210/225 (93.33%), Postives = 216/225 (96.00%), Query Frame = 1
Query:  115 MPIHNEDITYDELIIMMERIFKHKLSAXXXXXXXXXXXXXXXXXXXXXXXXAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQVKIEINLLINVFITI*IENI 789
            MPIHNEDITYDELIIMMERIFKHKLSAEDEIIIKYKDEDDDLITISDDSDLAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQ  I  N +  V +++ I+N+
Sbjct:    1 MPIHNEDITYDELIIMMERIFKHKLSAEDEIIIKYKDEDDDLITISDDSDLAFALESSNVLKLTLTVENNSNEDDTPKCNLSSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKDLQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRLNNQDMKSESNEIHRPSPVNFVGNQTPIGYNNVSQVPVSMGIQNV 225          
BLAST of PB1 domain-containing protein vs. Planmine SMEST
Match: SMESG000028627.1 (SMESG000028627.1)

HSP 1 Score: 51.9878 bits (123), Expect = 1.220e-7
Identity = 23/25 (92.00%), Postives = 24/25 (96.00%), Query Frame = 2
Query: 3896 MHLLKLRPGNFSKPKPKSSETAFLI 3970
            MHLLKLRPGNFSKPKPKSSETA L+
Sbjct:    1 MHLLKLRPGNFSKPKPKSSETALLV 25          
The following BLAST results are available for this feature:
BLAST of PB1 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TFG3.954e-2045.51trafficking from ER to golgi regulator [Source:HGN... [more]
TFG7.393e-2053.17trafficking from ER to golgi regulator [Source:HGN... [more]
TFG1.239e-1954.76trafficking from ER to golgi regulator [Source:HGN... [more]
TFG3.680e-1944.83trafficking from ER to golgi regulator [Source:HGN... [more]
TFG3.680e-1944.83trafficking from ER to golgi regulator [Source:HGN... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tfg3.082e-1853.17trafficking from ER to golgi regulator [Source:ZFI... [more]
tfg3.082e-1853.17trafficking from ER to golgi regulator [Source:ZFI... [more]
tfg3.082e-1853.17trafficking from ER to golgi regulator [Source:ZFI... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chrd.11.820e-1846.67chordin, gene 1 [Source:Xenbase;Acc:XB-GENE-480638... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Tfg4.434e-2053.17Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041][more]
Tfg3.692e-1943.50Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041][more]
Tfg5.188e-1663.95Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041][more]
Tfg1.588e-1564.29Trk-fused gene [Source:MGI Symbol;Acc:MGI:1338041][more]
back to top
BLAST of PB1 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q92734|TFG_HUMAN4.954e-1844.38Protein TFG OS=Homo sapiens OX=9606 GN=TFG PE=1 SV... [more]
back to top
BLAST of PB1 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7P5K53.642e-2248.62PB1 domain-containing protein OS=Pomacea canalicul... [more]
A0A023FGV24.064e-2246.52PB1 domain-containing protein (Fragment) OS=Amblyo... [more]
A0A131ZAJ01.398e-2147.06Protein TFG (Fragment) OS=Rhipicephalus appendicul... [more]
A0A023FRY71.456e-2147.57PB1 domain-containing protein (Fragment) OS=Amblyo... [more]
A0A224Z2N31.907e-2147.06Protein TFG (Fragment) OS=Rhipicephalus zambeziens... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tfg3.214e-1945.29trafficking from ER to golgi regulator [Source:NCB... [more]
tfg3.229e-1945.29trafficking from ER to golgi regulator [Source:NCB... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO420336.016e-1560.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PB1 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tfg3.380e-1953.17trafficking from ER to golgi regulator [Source:NCB... [more]
back to top
BLAST of PB1 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000024267.11.425e-12593.85SMESG000024267.1[more]
SMESG000024267.14.533e-11293.33SMESG000024267.1[more]
SMESG000028627.11.220e-792.00SMESG000028627.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016246 ID=SMED30016246|Name=PB1 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=5077bp
GTACGTAATTAAACAATTTGCAACGTTTCAATTGTATAATTTGAATACTA
AATATTCATGGATTTAAATACAAAATTAATAATTAAAGTTCAATTCAATG
ATGAAATTAGAAAAATGCCTATTCACAACGAAGATATTACTTACGATGAG
TTAATTATCATGATGGAGCGTATTTTCAAGCATAAATTAAGTGCTGAAGA
TGAAATAATTATCAAATATAAAGATGAAGATGATGATCTTATAACAATAT
CTGATGATTCTGATTTGGCATTTGCTCTTGAAAGTAGCAATGTTTTGAAA
TTGACATTAACAGTTGAAAATAATTCTAATGAAGATGATACTCCAAAATG
TAATTTAAGTTCAGGCGAAATAATTTCAATAAGAAAGGAACTACAGTTAA
TTAGAGATCACACAAATAGACTTCTAGATAGACTTGCTCATTCTAACGGC
GATGCTATTCAAAATGCCATTGCTTCAGGTAGAACAAGTGCTATCGAAGG
AAAAGATTTACAGGAGACGAGTGGTAAAGAATTCGATCCACTCTCAGTTG
GAAACCAACCACAACTTTCATCTGTCGAACGAAGTGAAACCGGAAGTTCT
ATAATTTCTAATAGTCGCATCGATGAGAATATTATTAAATCCGACCAAAC
ACGATTAAACAATCAGGACATGAAATCAGAATCAAATGAAATTCATCGAC
CGTCACCGGTTAATTTTGTCGGCAATCAGGTAAAAATAGAAATAAATCTA
CTCATCAATGTATTTATTACGATTTGAATAGAAAATATTCGATTAAACAT
TGCAGAGTTATCAAATTTTTAAAAAAAGTATTTAACCCGTTTGAACAGTC
AGTTGCTTGAAATTCAATTGTGCGACTATTGACATCTATATTGTATATTT
GTGAGATTTGCTGATCATTTTAAGCATGAATTATTAGCTCCAAGTGAAAT
TCATTAGTAGACATGGAACAGTGATTAATAATAATGGAAATGTAAAATGA
ATACTGATAAAAATGCGGCTATTTTCAAGAAAAATTAAAAAGAATTACAA
AATTTAATATTAATTTCCTTACTTTATTTTGATTGGACGATAATTTCAAA
TTTCGGTAAATTATCGTTTTAGCATTCCAATTTTACTCTACAGGGTTCAT
AATAAATAATTAATACCTTAAACGAAAATTTCCAATCATGCAACATCAAC
AACTAATGCTAGCACAATATAATCGATATTGATGCGAAATACACCTTATT
TTCCTCAAATTTGTGTAGTTCTGAAATCCGCAACCACTAGGGATATTATT
TATACGATCTAATAATGCCCTGCTAGTGTATGGACATAGATATTCATAAT
ATTATTTGTAATCCCAATAAATTGCACTTAACTATCCGTAAATTAGTTTG
AAGTTAGAAAAACTGTTTTAATAATTAGAAATTAAGCTCAATATTTAATG
GGAAACTAAACGATTTAAATTTATTGAAGTAAGTATTTTGATAAAATGAA
TTGGGACATTAAAGAAAAAAATTACTCAAACTTATTCATCTCATAACATA
ATCCTATCTCTATCTATATACTCTATTTGTTAATTCTTAAACTTTAAAAT
GTCTCTACATAAGGGACATACGAGGACAGTATTAGGCTTATGAAAATTTA
CATAATGGAACCGAGGGGGAGTCAAAAATTGCAAATGTTTCCCGACGTCC
TTAATGGATGCTCTCTTAGTAAAAAAAAATTATGTTGTTTTCATAATCAT
CCATTGTCGCGGATCTTTGCTAATTTACGGCAACTTATAATTGTTTCCCC
CATTTGCGAGCATCGTCTCCTTGCACTTCTGGAGTGTTAAAAATACATTA
TCATAGTTTTTCCTTTTTCGTCCACAATTTATCCTCATTGATGATGAATC
AATATCTATTTCATCTGTTCGAAGTTGTTCGAAGCATTTCTCTAAAGTTT
CGAAATTGAAGCTCATTTATGGTTCCATGCTTCAGCTTGGGAGGATTTCT
GCTGGACATATTCATTAAAAAATCTTGAAAAATTAAACTTCTTTCTTCAT
TAGATAAGTGATAAGTTGAATGTAAATTTTCTGTATTCATTTTTTATTTG
TATTTTAGGAGTATTTAAAGTTTAACAATAAAAAAACCTATAATCATGGA
AATTTTTGTCAATCCATCCATACTAGATCTATCTAATAAAGGTTAAAGTT
GACCAAAAACATTGATAATCGGAACAATTTATTTCAAATGTAAACATTAT
TTCGGAACAGAGGGAGTGGGAGTACAATTTAATAATAGTCTTTCATCGTC
ACTTTCACCAAATAACGTATGGAAATCTGCTCCTGTGACATCATCCGCAT
AGGCATCATTGGTAAATGTTATTTATTTATAAAAGTTTCCTGTCGTCTAA
GCATTAACCGATCCACTATTTTACGGTAAGCTTTCTAGGATGATTTTCTT
TAAAATGCATGATATCGTTTCGGGTGTTAAAATTTTCTTTTTATAGGATA
TGTCCTTATTAAATGCTCCCTTATTTTCATAATCCAACTTAATCAAATTA
CTTCATAACATGCAAATTTCTGTTATGATACTTGAATGTTTTACAGATTC
TGTCAACTTGGAGCACTTAGTTTTCAAGTTAGATAAGTTTAAAAATTCAG
TAGAATCCTTATCAAATTGTGAAGCTCGGTTCAGCTTTAAACTAGATTCC
TTCATGGAAGTTCAGCATCGTTAAGATTTTACAATAAATTGGACTCATTA
ACGCCAACATAATATTCTTTGTTAAAAAAAACAATTCAAAAAACTTTATA
TTAAATACCACACTGAATTGTTGAATACTAAATTGAAAAGTATAATTACG
CTATTTTATAATCTGCTGTGGGAACCAGTGAAAATACTAATTTTGAAATG
GATATATTTTTTATATTTACCATAAATTTTCGCACTGCCTTTGAAATAAG
CCAAACATTAAAGTAAGTTTTTTTTAATTGAAATTTTCAATTACATAATA
ATTTATTTTGTAAAATCTGTCTGTTCGTATTGAATCATTGTTTATTATTT
TGTAATTATTTTTGTCAGTTCAATTTTGAAAATAATTTTATTAATGGTTT
TAATAGCGTATTTTTCCAAATTAAGTTGTTAAGGATTTTTAAAATTTATC
AGTAAAGCCATGTATCATTTTGCTCACCTCTGATCTGCTTTTATTCATTG
AGTCTTCAGCTGTAGAAGAAATATAAAGGGTGTCCATAAAAGCCATGTGC
AATTGAAGTACTTGTAACTATATAGCCATATGTGATAGAAATAATCTGTA
AAAATGTTATTATTAATTTTCAAAATATATATCAGTATTCGTAATAGAAA
CTAGAATTTGATTCTGTAGTTCTCTGAAAGTATTTTCAGGCTGATTTTCA
GAAACACCGGCAATGACATCAGTTTTCCTGTCTTGAACACATACTAAATA
AAAAACTAAATACATCAAGCTTTTTAATCCTTTTGACGGATTTTTTGTAA
TAACGTGTGTTACAGGTATATTTATTGTACGTGGACTTTGTGGACAATAA
AATCTGCTCACTTCACTTTTAACCCTTTGAGTGCCAACATGATTTTAAGA
GGATTAGCTAAAAATGCCACTCTGCTAGAGGAAAATAGAAATTTAAAAAT
ATATTTCTCTGTAACTTTCTAAGCATTTTATTTACGAAAAGTATTTAAAA
AACAAAAAATGATTTGAAAAAATAGTATAATTTCTACAAAATAAATGAAA
AATAAAACGTTATTCGTTTACCACACAATCTATCCCTTATGTACATTAAT
GTTGCCCAATACATAATCCATGAAGCCCTTTTTTGCACTTACAACAAATT
AGGTTTGATCTCTTTATAGGTCCCCCATCTTTACTACTACAAACAATGCA
TCTTCTCAAATTGCGACCTGGTAATTTCTCTAAACCGAAACCGAAGTCTT
CGGAAACAGCGTTTTTAATATAATAAATAGAATAGGGTTGCATTTAACTA
ATGTGATTATTGTGCGTCTTTCACTTCGAAAACTGGACTATTCTCAACAT
AAAGATATAATATTTCTATTTCTTATAAATACACATTCGGAATAAAAAAC
CATAAATAAAAATCGACAAGTATGAAATAGAGATCGAATTTGTCCATGCT
GGAGCAGGAGCGCGATCGCGCTCCTGGCATTTTCGGCCAGTGTATTGAGG
AATGTTGATTGGCATATCAAAGTGGTTGATTTGAAACCAATGTTCTTAAA
ACTTTAACAAATTTACCTTTATTCATTTCGCAATTCTATTTTGTTAAAAT
TAAACTGTAACGGTTTTCTCATTAAGATCTGTCGAGGTTGTTTTGCTTAC
CACACACCAGACTTCAATCTTGAAGAAATCGAAAAACAGATTTCTTTCAT
TTGTTCAAAATTAAAATTTAAACATTGGGAACTTCTGCTGGCTGGGGGTT
ACCTTTACTAGTTAATACTTATGCCTGAAGATATTTAAAATAGCAATAAA
TATTTTATTGGAATTTTAATGTCGTACTTAAAATGTGGAATATTAAACGA
TGATGATTGGAAATGTGGAGAGCGAACAGAGGTACTTCGTTAGAGGAAAT
AAAGAATCATCACATATTTCACAGTAATTGTTGTTTTAAATGACTTTCGT
TTTCATTTATTTTTAATAAAACCTTCTTTGAAAGCTAAAAAGAAATATTT
ATTGGTTTTGAGAATGATCACATGTTTCACTTATTCTTCGTGGATATATA
TATCCCGGATTCTCCGATTTCAGAGAATTAAGTTACATATTTACTTGCCT
TATATGCATATTATATTCTTGAAAGTTGATTGTAAATTCTATAATTATAT
TTTTCAAAAATTAAGTTATTTATTTATTCATTGTAATAACAATTGATGTA
AATGCTTGATGGTTAGTGCAGCGGTGGCCAAAGTTGCGAGTCGCGATTTT
TTTGGGGGTCGTCAATTATAGTAATTTTGGAGATTATATTTATTTTTCGA
AAAACTTTAAATTTTGACACATATTTTCAGCTGATTTTTTCATAAATTTT
TTCAGCTGCTACAGCCAGATCGGAAGA
back to top

protein sequence of SMED30016246-orf-1

>SMED30016246-orf-1 ID=SMED30016246-orf-1|Name=SMED30016246-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=240bp
MDLNTKLIIKVQFNDEIRKMPIHNEDITYDELIIMMERIFKHKLSAEDEI
IIKYKDEDDDLITISDDSDLAFALESSNVLKLTLTVENNSNEDDTPKCNL
SSGEIISIRKELQLIRDHTNRLLDRLAHSNGDAIQNAIASGRTSAIEGKD
LQETSGKEFDPLSVGNQPQLSSVERSETGSSIISNSRIDENIIKSDQTRL
NNQDMKSESNEIHRPSPVNFVGNQVKIEINLLINVFITI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006888ER to Golgi vesicle-mediated transport
GO:0007165signal transduction
GO:0043123positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0048208COPII vesicle coating
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR000270PB1_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0004871signal transducer activity
GO:0042802identical protein binding
Vocabulary: cellular component
TermDefinition
GO:0000139Golgi membrane
GO:0005737cytoplasm
GO:0005829cytosol
GO:0070062extracellular exosome