General transcription factor II-I repeat domain-containing protein 2A

Overview
NameGeneral transcription factor II-I repeat domain-containing protein 2A
Smed IDSMED30016234
Length (bp)1075
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of General transcription factor II-I repeat domain-containing protein 2A (SMED30016234) t-SNE clustered cells

Violin plots show distribution of expression levels for General transcription factor II-I repeat domain-containing protein 2A (SMED30016234) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016234

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016234SMESG000039749.1 SmedASXL_013856SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016234SMESG000039749.1 dd_15962dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
head regionSMED30016234SMESG000039749.1 dd_Smed_v6_15962_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30016234SMESG000039749.1 dd_Smed_v4_15962_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 49.2914 bits (116), Expect = 2.874e-12
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  911 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLASRNESDGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSS 1014          

HSP 2 Score: 41.9726 bits (97), Expect = 2.874e-12
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct: 1027 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 1107          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Human
Match: GTF2IRD2 (GTF2I repeat domain containing 2 [Source:HGNC Symbol;Acc:HGNC:30775])

HSP 1 Score: 49.2914 bits (116), Expect = 3.030e-12
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  749 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLASRNESDGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSS 852          

HSP 2 Score: 41.9726 bits (97), Expect = 3.030e-12
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct:  865 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 945          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 48.9062 bits (115), Expect = 4.461e-12
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  916 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLVSRNESDGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSS 1019          

HSP 2 Score: 41.9726 bits (97), Expect = 4.461e-12
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct: 1032 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 1112          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Human
Match: GTF2IRD2B (GTF2I repeat domain containing 2B [Source:HGNC Symbol;Acc:HGNC:33125])

HSP 1 Score: 48.521 bits (114), Expect = 4.591e-12
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  749 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLVSRNESDGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSS 852          

HSP 2 Score: 41.9726 bits (97), Expect = 4.591e-12
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct:  865 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 945          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Zebrafish
Match: AL928808.1 (pep chromosome:GRCz11:20:17257101:17259573:-1 gene:ENSDARG00000101333.2 transcript:ENSDART00000166397.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:AL928808.1)

HSP 1 Score: 72.0182 bits (175), Expect = 3.824e-22
Identity = 40/102 (39.22%), Postives = 61/102 (59.80%), Query Frame = 1
Query:  421 EIIILQNDLILQA--RKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            E+I L  D  L++  R+   +FWK V   +YPN+ + +  +   FGSTY+CE  FS LKL KSK RSVLTD+H ++ L ++ + Y  +   +V+  + Q  H
Sbjct:  515 EMIELSEDDRLKSVLREGTVEFWKIVPVERYPNVKQAALKLLSMFGSTYVCELLFSTLKLVKSKHRSVLTDTHVKELLRVATTEYEPDLKKIVETKECQVSH 616          

HSP 2 Score: 52.373 bits (124), Expect = 3.824e-22
Identity = 30/111 (27.03%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSN-MADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFI 332
            +D  W+SDL FL D    L  LN++LQGK K + D++  + A   K  L    +Q+ +  HF   +  +  K + +     +Y   +  + + FE RF + ++ ++   F+
Sbjct:  380 HDPQWISDLAFLVDVLHYLNGLNVDLQGKLKMLPDLVQSVFAFVNKLKLFKTHLQKRDYTHFPTLLKASGQKAEVVKGSTARYATLLENLEQSFEERFSNLQQKRQQITFL 490          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Xenopus
Match: ENSXETT00000016563.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:4:37379994:37381838:-1 gene:ENSXETG00000009412.1 transcript:ENSXETT00000016563.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 60.4622 bits (145), Expect = 3.594e-17
Identity = 35/106 (33.02%), Postives = 61/106 (57.55%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLK--NINYKIDKYVAEI*KVVEDFEVRFQDFEKIK 314
             D ++L+ L FLTD T  L +LNL LQG+++ V  + S I A + K  LL   + +N+L HF +  +   ++K   +     ++V ++  ++ +F  RFQDFE ++
Sbjct:  384 TDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFEGME 489          

HSP 2 Score: 47.7506 bits (112), Expect = 3.594e-17
Identity = 32/102 (31.37%), Postives = 54/102 (52.94%), Query Frame = 1
Query:  421 EIIILQNDLILQARKFED-DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLV-KDMQTQSYH 720
            E+  LQ D  L +   +   F+K +++ +YP +      +   FGSTY+CE AFS +   KSK R+ + DS  Q  + +S +  + + D LV + +  Q+ H
Sbjct:  513 ELCELQGDQFLHSCSEKGVAFFKLLSQEQYPILRDFGMRMASMFGSTYICEKAFSDMGFIKSKYRNSICDSTLQQIIRISTTSISADIDELVAQQLHPQTSH 614          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Xenopus
Match: ENSXETT00000028445.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:101734469])

HSP 1 Score: 52.7582 bits (125), Expect = 2.431e-13
Identity = 34/99 (34.34%), Postives = 53/99 (53.54%), Query Frame = 1
Query:  400 EQGPIENEIIILQNDLILQARK-FEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLV 693
            E+     E+  LQ DL    R+     F++ + + KY N+   +  +   FGSTY+CE AFS L   KS  R+ +++   Q+ L LS++   LN+D LV
Sbjct:  498 ERMEYHMELCDLQADLFFATREELGVPFFRLLPKEKYRNLRDLALKMTSMFGSTYICERAFSELNHLKSNYRNSISNRTLQEILHLSITNINLNFDELV 596          

HSP 2 Score: 42.3578 bits (98), Expect = 2.431e-13
Identity = 32/104 (30.77%), Postives = 60/104 (57.69%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID--KYVAEI*KVVEDFEVRFQDFEKI 311
            +E +LS L FLTD T  L +L   ++ K++ +  + + ++    K +LL  ++  N+L +F +  +   + +  N  +D  K+V +I  ++E+F +RFQDF KI
Sbjct:  377 NEDFLSSLAFLTDLTHYLHSLKKNIEAKDQLITQLYTHVSVFSNKLMLLKLNLISNDLTYFESCNELYREYEECNIFLDFSKFVEKIEVLIENFNLRFQDFSKI 480          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Xenopus
Match: spag1 (sperm associated antigen 1 [Source:Xenbase;Acc:XB-GENE-853609])

HSP 1 Score: 60.077 bits (144), Expect = 2.898e-9
Identity = 35/103 (33.98%), Postives = 59/103 (57.28%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLK--NINYKIDKYVAEI*KVVEDFEVRFQDFE 305
             D ++L+ L FLTD T  L +LNL LQG+++ V  + S I A + K  LL   + +N+L HF +  +   ++K   +     ++V ++  ++ +F  RFQDFE
Sbjct:  384 TDVSFLTALAFLTDITQFLNSLNLNLQGRDQNVSQLYSHIAAFRNKLHLLKSFLAKNDLTHFESCCELFQEMKGNGVILNFSQFVPKMDILIHEFNTRFQDFE 486          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Mouse
Match: Gtf2ird2 (GTF2I repeat domain containing 2 [Source:MGI Symbol;Acc:MGI:2149780])

HSP 1 Score: 47.7506 bits (112), Expect = 5.914e-9
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVE---DFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  L+  LQG ++ V  +   I A   K  L    + +NNL HF         LK+++      +  I K+VE   +F+ R  DF+  + E+T F S
Sbjct:  743 WILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPT-------LKSVSRSESDGLNYIPKIVELKAEFQRRLSDFKSCESELTLFSS 846          

HSP 2 Score: 31.5722 bits (70), Expect = 5.914e-9
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNI-TKCSEYIYLCFGSTYLCESAFSYLKLTKSKQR 612
            ++ E+I LQ + +L+ +  +    DF+K +  + YP   + C+  + + F ST++CE  FS LKL+K + +
Sbjct:  859 LQMEVIDLQCNTVLRTKYDKVGVPDFYKHL-WSSYPKYRSHCARMLSM-FSSTHICEQLFSILKLSKKEAQ 927          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. UniProt/SwissProt
Match: sp|Q86UP8|GTD2A_HUMAN (General transcription factor II-I repeat domain-containing protein 2A OS=Homo sapiens OX=9606 GN=GTF2IRD2 PE=1 SV=3)

HSP 1 Score: 49.2914 bits (116), Expect = 1.313e-11
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  749 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLASRNESDGLNYIPKIAELQTEFQKRLSDFKLYESELTLFSS 852          

HSP 2 Score: 41.9726 bits (97), Expect = 1.313e-11
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct:  865 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 945          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. UniProt/SwissProt
Match: sp|Q6EKJ0|GTD2B_HUMAN (General transcription factor II-I repeat domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GTF2IRD2B PE=1 SV=1)

HSP 1 Score: 48.521 bits (114), Expect = 1.990e-11
Identity = 36/109 (33.03%), Postives = 54/109 (49.54%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID-KYVAEI*KVVEDFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF  +     KL + N      Y+ +I ++  +F+ R  DF+  + E+T F S
Sbjct:  749 WIRDLAFLVDMTMHLNALNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLTRNNLAHFPTL-----KLVSRNESDGLNYIPKIAELKTEFQKRLSDFKLYESELTLFSS 852          

HSP 2 Score: 41.9726 bits (97), Expect = 1.990e-11
Identity = 30/83 (36.14%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLL 651
            ++ E+I LQ + +L+ +  +    +F+K++    YP        I   FGSTY+CE  FS +KL+K+K  S L DS   DS+L
Sbjct:  865 LQMEVIDLQCNTVLKTKYDKVGIPEFYKYL-WGSYPKYKHHCAKILSMFGSTYICEQLFSIMKLSKTKYCSQLKDSQ-WDSVL 945          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. UniProt/SwissProt
Match: sp|A4IFA3|GT2D2_BOVIN (General transcription factor II-I repeat domain-containing protein 2 OS=Bos taurus OX=9913 GN=GTF2IRD2 PE=2 SV=1)

HSP 1 Score: 50.0618 bits (118), Expect = 6.375e-11
Identity = 37/115 (32.17%), Postives = 56/115 (48.70%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVE---DFEVRFQDFEKIK-EITGFIS 335
            + + W+ DL FL D T  L  LN+ LQG ++ V  +   I A   K  L    + +NNL HF         LK+++      +  I K+VE   +F+ R  DF+  + E+T F S
Sbjct:  746 SSQDWIKDLAFLVDMTMHLNTLNISLQGHSQIVTQMYDLIRAFLAKLCLWETHLARNNLAHFPT-------LKSVSRNESDGLNYIPKIVELKTEFQKRLSDFKLYESELTLFSS 853          

HSP 2 Score: 38.891 bits (89), Expect = 6.375e-11
Identity = 29/92 (31.52%), Postives = 43/92 (46.74%), Query Frame = 1
Query:  403 QGPIENEIIILQNDLILQAR-------KFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLS 657
            Q  ++ E+I LQ + +L+ +       +F    W       YP        I   FGSTY+CE  FS +KL+K++  S L DS     L +S
Sbjct:  863 QEALQMEVIDLQCNTVLKTKYDKVGIPEFYKHLW-----GSYPKYKIHCAKILSMFGSTYICEQLFSIMKLSKTEYCSQLKDSQWDSVLHIS 949          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. UniProt/SwissProt
Match: sp|Q99NI3|GT2D2_MOUSE (General transcription factor II-I repeat domain-containing protein 2 OS=Mus musculus OX=10090 GN=Gtf2ird2 PE=2 SV=1)

HSP 1 Score: 47.7506 bits (112), Expect = 3.510e-8
Identity = 36/111 (32.43%), Postives = 53/111 (47.75%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVE---DFEVRFQDFEKIK-EITGFIS 335
            W+ DL FL D T  L  L+  LQG ++ V  +   I A   K  L    + +NNL HF         LK+++      +  I K+VE   +F+ R  DF+  + E+T F S
Sbjct:  743 WILDLAFLVDMTTHLNTLDASLQGHSQIVTQMYDFIRAFLAKLCLWETHLARNNLAHFPT-------LKSVSRSESDGLNYIPKIVELKAEFQRRLSDFKSCESELTLFSS 846          

HSP 2 Score: 31.5722 bits (70), Expect = 3.510e-8
Identity = 22/71 (30.99%), Postives = 42/71 (59.15%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNI-TKCSEYIYLCFGSTYLCESAFSYLKLTKSKQR 612
            ++ E+I LQ + +L+ +  +    DF+K +  + YP   + C+  + + F ST++CE  FS LKL+K + +
Sbjct:  859 LQMEVIDLQCNTVLRTKYDKVGVPDFYKHL-WSSYPKYRSHCARMLSM-FSSTHICEQLFSILKLSKKEAQ 927          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Match: A0A2H8TSF6 (General transcription factor II-I repeat domain-containing protein 2A OS=Melanaphis sacchari OX=742174 GN=GTF2IRD2 PE=4 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.099e-38
Identity = 49/117 (41.88%), Postives = 76/117 (64.96%), Query Frame = 1
Query:  355 GVKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQ 705
             ++ I   IS+ F M+    E+EII +++D+ L+AR  E  FW  ++  KYP +   +  I+  FGSTYLCE+AFS++K+ K++ RS L+D H +  L L++S Y+ +YD LV DMQ
Sbjct:  273 NIENISTQISNFFDMDSTKFESEIIKIKSDIFLKARGSETKFWNLLSEEKYPGLRNVALQIHSYFGSTYLCETAFSHMKMIKTEFRSTLSDDHLEQCLRLAVSNYSPDYDQLVNDMQ 389          

HSP 2 Score: 87.8113 bits (216), Expect = 1.099e-38
Identity = 46/108 (42.59%), Postives = 70/108 (64.81%), Query Frame = 3
Query:   12 TWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            TWL +L FLTD TA L  LN+ELQGK+ T+I+++S IN  K+K +L    + ++ LN+F N+ D   K K     ++ Y +E+ KV  +FE RF+D +K++ I  F+S
Sbjct:  159 TWLQNLAFLTDITAHLNTLNVELQGKDGTIIELLSSINGFKSKLILFKSQLNESKLNNFPNLKDFFEKQK-CTVAVEIYCSEVEKVYNEFERRFKDIQKLEPIITFMS 265          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Match: A0A3B3HZV5 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=4 SV=1)

HSP 1 Score: 110.923 bits (276), Expect = 1.639e-38
Identity = 53/121 (43.80%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  358 VKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            V    + +S LF +  G +E EI+ LQNDL+L+A +   +FW  V++ KY  +   +  I   FGSTYLCESAFS +   K+K R+ LTD+H QDSL +++S Y+ +Y+ LV  MQ Q+ H
Sbjct:  495 VTSTAEQLSALFTLNAGDVEMEILTLQNDLLLKAHQSAPNFWCLVDQEKYSGVCTAAMKIACFFGSTYLCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTSH 615          

HSP 2 Score: 78.9518 bits (193), Expect = 1.639e-38
Identity = 42/114 (36.84%), Postives = 65/114 (57.02%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMA----DNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            D  W+ DL FLTD T  L +LN ELQGK+KTV   IS +NA + K  +    +Q+  + HF ++     DN+     +N  + KY   I ++ ++FE RF DFE+++    F++
Sbjct:  374 DPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVT 487          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Match: A0A096MF30 (Dimer_Tnp_hAT domain-containing protein OS=Poecilia formosa OX=48698 PE=4 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 4.159e-37
Identity = 51/121 (42.15%), Postives = 74/121 (61.16%), Query Frame = 1
Query:  358 VKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            V  +  NI+ +F +    +ENEI+ LQ D+ L++R     FW  +   KYPN+ KC+  +   FGSTYLCESAFS++K+ KSK RS +TD+H +  L L++S Y+ +Y  L      QS H
Sbjct:  443 VDSLASNIAMMFHLNSSGVENEILTLQADIELKSRA-HGQFWNLLTEGKYPNMRKCATSLTALFGSTYLCESAFSHMKIIKSKHRSSMTDAHLEACLKLAISSYSPDYAALQCRSSDQSNH 562          

HSP 2 Score: 82.0333 bits (201), Expect = 4.159e-37
Identity = 44/112 (39.29%), Postives = 70/112 (62.50%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKID--KYVAEI*KVVEDFEVRFQDFEKIKEITGFI 332
            ND+ WL DL FLTD T +L +LN+ELQGK+KTVI++IS +NA K K       +Q+++L +F N+A  L      + ++D  +Y  +I   + +F+  FQDF  ++ +  F+
Sbjct:  322 NDDQWLLDLAFLTDLTNMLNDLNIELQGKDKTVINMISSVNAFKRKMQHQPSKLQRHDLTNFQNVASELEMKGKTSEQLDSARYTEQIENCLSEFDSHFQDFALLEPVATFM 433          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Match: A0A1A8SK74 (Uncharacterized protein OS=Nothobranchius rachovii OX=451742 GN=Nfu_g_1_023929 PE=4 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 5.450e-36
Identity = 51/118 (43.22%), Postives = 71/118 (60.17%), Query Frame = 1
Query:  367 IRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            I + +S  F +  G +E EII LQNDL L++ + E +FW   +  KY  +   +  +   FGSTYLCESAFS +   KSK R+ LTD+H  DS+ +++S YT +Y  LV  MQ Q  H
Sbjct:  362 IAEQLSATFSLNAGEVEIEIITLQNDLHLKSHQSEPNFWCLEDTEKYKGVCTAAMKVACMFGSTYLCESAFSDMNFIKSKHRTRLTDAHLHDSVRVAVSSYTPDYSKLVNSMQCQVSH 479          

HSP 2 Score: 79.7221 bits (195), Expect = 5.450e-36
Identity = 45/114 (39.47%), Postives = 67/114 (58.77%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMA----DNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            D  W+ DL FLTD T  L +LN ELQGK KTV D+IS +NA K K  +    +Q+  + HF ++     DN    +  +  +DKY   I ++ ++FE RF+DF++++    FIS
Sbjct:  238 DIEWILDLAFLTDITGKLNHLNCELQGKGKTVADMISAVNAFKAKMNIFSVHLQKKRVLHFPSVQSVLNDNASASETFDKVVDKYSEVINRLGQEFENRFRDFDQLEPCVSFIS 351          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Match: A0A484CY62 (Uncharacterized protein OS=Perca flavescens OX=8167 GN=EPR50_G00110450 PE=4 SV=1)

HSP 1 Score: 104.76 bits (260), Expect = 3.516e-35
Identity = 52/116 (44.83%), Postives = 74/116 (63.79%), Query Frame = 1
Query:  373 QNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            + +S  F ++ G +E EII LQNDL L+A +   +FW  V+  KY  +   +  +   FGSTYLCESAFS +   K+K R+ LTD+H +DSL +++S YT +Y+ LV  MQ QS H
Sbjct:  500 EQLSATFNLDAGQVEIEIITLQNDLHLKAYQAAPNFWCLVDTEKYSGVCTAAMKVASLFGSTYLCESAFSDMNFIKNKHRTRLTDAHLKDSLTVAVSSYTPDYNTLVNSMQCQSSH 615          

HSP 2 Score: 73.9442 bits (180), Expect = 3.516e-35
Identity = 43/114 (37.72%), Postives = 64/114 (56.14%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSN----MADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            D  W  DL FLTD T  L +LN +LQGK KTV+D+IS +NA K K  +   D+Q+  + HF +    + DN    +  +   +KY   I ++ ++FE RF D  +++    FIS
Sbjct:  374 DTEWTLDLAFLTDITGKLNDLNCKLQGKCKTVVDMISALNAFKAKMNIFSVDLQRKKVLHFPSVQSVLKDNASASETFDKVAEKYCEVINRLGQEFENRFCDLHQLEPCVSFIS 487          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Match: ENSAMXT00000039226.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000099.1:564912:568121:1 gene:ENSAMXG00000042173.1 transcript:ENSAMXT00000039226.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 9.414e-33
Identity = 43/120 (35.83%), Postives = 74/120 (61.67%), Query Frame = 1
Query:  358 VKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSY 717
            ++ +      +F +  G ++ EII L+ND+ ++AR  + DFW  V+R +YP+++ C+  +   FGSTY CE +F  +K+ KSK R+ LTD+H  D + L++S YT +Y      +Q Q++
Sbjct:  476 IEELSAKFQQVFELPNG-VDMEIIDLENDIEMKARSRDKDFWGLVSRERYPSLSACALKVKAFFGSTYFCEMSFPQMKIIKSKYRTCLTDAHLTDCVRLAVSNYTPDYKAPADSVQPQNF 594          

HSP 2 Score: 64.6994 bits (156), Expect = 9.414e-33
Identity = 39/110 (35.45%), Postives = 63/110 (57.27%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNI-NYKIDKYVAEI*KVVEDFEVRFQDFEK--IKEITG 326
            D+TWL DL FLTD T+ L  LN ELQGK+  V  ++S +NA K K  L    ++   L HF N+   L+ + N  ++  + +   + ++ E+F  RF++  K  I+E++ 
Sbjct:  372 DDTWLLDLAFLTDLTSKLNELNCELQGKDCDVPHMVSAVNAFKVKLALWTSQLKCKKLTHFQNVDKMLNNISNKDSFHPENFCIHLNRLEEEFSKRFEELNKDIIEELSA 481          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Match: ENSAMXT00000050151.1 (pep primary_assembly:Astyanax_mexicanus-2.0:17:23214084:23215952:-1 gene:ENSAMXG00000029603.1 transcript:ENSAMXT00000050151.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 70.0922 bits (170), Expect = 1.077e-21
Identity = 36/109 (33.03%), Postives = 62/109 (56.88%), Query Frame = 1
Query:  406 GPIENEIIILQNDLILQ---ARKFEDDFW-KFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            GP++ ++I LQ D+ L+   AR     FW + V+   +P++ K + +I   FGSTY CE+AFS + + K+K RS LT+ H    + ++L+ +   + +L    + Q  H
Sbjct:  514 GPLQMQMIDLQADVALKEQFARTESTTFWLQMVSETAFPDLKKVALFILTMFGSTYSCEAAFSTMNIIKTKYRSKLTNEHLHMCMRMALTSFKPRFKMLAGQAKAQFSH 622          

HSP 2 Score: 52.373 bits (124), Expect = 1.077e-21
Identity = 34/112 (30.36%), Postives = 60/112 (53.57%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNI--NYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFI 332
            NDE  +  + FL D  + L  LNL+LQGKN ++ D+++ + + + K  +  ED+ Q +  HF        K+K +  +  +  +V  + K++E+F  RF  F   +E+  FI
Sbjct:  385 NDEKNMGIIAFLADIMSHLNGLNLQLQGKNNSICDLMTAVRSFQRKLQVFKEDL-QGDYTHFP-------KVKQVQGHRDVSSFVEFVDKLIENFSKRFDSFSIGEELKLFI 488          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Match: ENSAMXT00000037725.1 (pep primary_assembly:Astyanax_mexicanus-2.0:14:29162452:29166863:1 gene:ENSAMXG00000037303.1 transcript:ENSAMXT00000037725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 56.225 bits (134), Expect = 3.908e-18
Identity = 33/97 (34.02%), Postives = 49/97 (50.52%), Query Frame = 3
Query:   15 WLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFE 305
            W++DL FLTD T +L  LNL+LQGK++ +  +   + A + K  L    +++ NL HF    +     KN N+     V E  K+   F  RF  F 
Sbjct:  565 WIADLAFLTDLTGLLNELNLKLQGKDRLICHLFEAVCAFEMKLNLFATQLKKGNLTHFPTCQEAFAH-KNYNWSRHSCVLEDLKLA--FSARFGQFR 658          

HSP 2 Score: 54.299 bits (129), Expect = 3.908e-18
Identity = 33/108 (30.56%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  406 GPIENEIIILQNDLILQARKFED---DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            G ++ EII L+    ++ +  E    +F++ ++R ++PN+   ++     FGSTY+CE  FS +KL KS  R+ LTD + Q  L L+ +    + + LV + +    H
Sbjct:  680 GELQPEIIELKCSTAMRTKHREMPLLEFYQSLDREQFPNLFANAQKWISMFGSTYICEQMFSLMKLNKSPLRTRLTDENLQAVLRLATTSLEPDINQLVSERRCNISH 787          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Match: ENSAMXT00000035253.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111191579])

HSP 1 Score: 53.5286 bits (127), Expect = 2.293e-16
Identity = 35/96 (36.46%), Postives = 53/96 (55.21%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFED----DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDV 687
            ++ E+I LQ+D  L+A KF+D    DF++ +     P +   +  +   FGSTYLCE  FS + L K+K RS LTD +    L ++ S   L  D+
Sbjct:  491 LQMELIELQSDSGLRA-KFQDAAIQDFYRLLPPGLMPQLRLHAARVLSMFGSTYLCEQMFSIMNLNKNKHRSCLTDDNLHAVLRIA-SAQDLKPDI 584          

HSP 2 Score: 50.8322 bits (120), Expect = 2.293e-16
Identity = 31/109 (28.44%), Postives = 53/109 (48.62%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGF 329
            +D  WL D   L D T  L  LN +LQG+ + +  +   I A + K  L M   +Q+NL HF  +  ++  L    +   +   ++ ++  +F+ RF DF    + +GF
Sbjct:  368 SDPKWLCDFAVLCDITEHLAQLNQKLQGRKQVITQMSDMITAFQRKLDLWMCQAKQDNLAHFP-VCQSMSALFPGTFSCAQLTTKLSRLKTEFDRRFSDFR--GQQSGF 473          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Match: ENSAMXT00000054244.1 (SCAN domain-containing protein 3-like [Source:NCBI gene;Acc:111191664])

HSP 1 Score: 55.8398 bits (133), Expect = 4.443e-15
Identity = 37/110 (33.64%), Postives = 57/110 (51.82%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVED-FEVRFQDFEKIKEITGFI 332
            DE ++S++ FL D    L  LNL+LQGK+KT++D++  + +      +   DI  N L HFS        LK    K+ + + +  K + D F  RF D+   K+I  FI
Sbjct:  388 DENFMSNVAFLCDIFGHLNKLNLQLQGKDKTIVDMVEKLESFTRMLEMFEADISTNRLLHFST-------LKRTAGKVTELMVDFIKRLRDNFTSRFDDYSIPKDIIDFI 490          

HSP 2 Score: 44.2838 bits (103), Expect = 4.443e-15
Identity = 28/113 (24.78%), Postives = 56/113 (49.56%), Query Frame = 1
Query:  397 MEQGPIENEIIILQNDLILQ-ARKFEDDFWKF----VNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            ++Q  +E EII  Q   +++ A +  +  W F        +Y N+   + Y    F STY+CES+FS +   K+ +R+ LT  + ++ L + ++  + ++  +V   +    H
Sbjct:  512 LDQAALEMEIIHFQTTSVVRDALRSAESVWGFWVGLPCSEEYSNLKTIALYTLTMFPSTYVCESSFSAMNAIKTHERNRLTHKNLENCLRIKVTSISPDFKKIVTSGRCHFSH 624          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Match: ENSORLT00000033470.1 (pep primary_assembly:ASM223467v1:22:24335229:24337076:1 gene:ENSORLG00000028972.1 transcript:ENSORLT00000033470.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.196e-41
Identity = 53/121 (43.80%), Postives = 77/121 (63.64%), Query Frame = 1
Query:  358 VKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            V    + +S LF +  G +E EI+ LQNDL+L+A +   +FW  V++ KY  +   +  I   FGSTYLCESAFS +   K+K R+ LTD+H QDSL +++S Y+ +Y+ LV  MQ Q+ H
Sbjct:  495 VTSTAEQLSALFTLNAGDVEMEILTLQNDLLLKAHQSAPNFWCLVDQEKYSGVCTAAMKIACFFGSTYLCESAFSNMNFIKNKHRTCLTDAHLQDSLRIAVSNYSPDYNALVSSMQCQTSH 615          

HSP 2 Score: 78.9518 bits (193), Expect = 1.196e-41
Identity = 42/114 (36.84%), Postives = 65/114 (57.02%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMA----DNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            D  W+ DL FLTD T  L +LN ELQGK+KTV   IS +NA + K  +    +Q+  + HF ++     DN+     +N  + KY   I ++ ++FE RF DFE+++    F++
Sbjct:  374 DPEWVLDLAFLTDLTGNLNHLNRELQGKDKTVAHTISAVNAFRAKLSIFSTQLQKKKMLHFPSVQAALNDNVSASAALNEAVKKYSQVINRLGQEFEDRFCDFEQLEPCVSFVT 487          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Match: ENSORLT00000046355.1 (pep primary_assembly:ASM223467v1:21:4582475:4584322:1 gene:ENSORLG00000025904.1 transcript:ENSORLT00000046355.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 106.686 bits (265), Expect = 3.482e-38
Identity = 52/116 (44.83%), Postives = 75/116 (64.66%), Query Frame = 1
Query:  373 QNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            + +S  F ++ G +E EII LQNDL L+A +   +FW+ V+  KY  +   +  +   FGSTYLCESAFS +   K+K R+ LTD+H +DSL +++S YT +Y+ LV  MQ QS H
Sbjct:  500 EQLSATFNLDAGQVEIEIITLQNDLHLKAYQAAPNFWRLVDTEKYSGVCTAAMKVASLFGSTYLCESAFSDMNFIKNKHRTRLTDAHLRDSLTVAVSSYTPDYNTLVNSMQCQSSH 615          

HSP 2 Score: 71.2478 bits (173), Expect = 3.482e-38
Identity = 42/114 (36.84%), Postives = 61/114 (53.51%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSN----MADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            D  W  DL FL D T  L  LN +LQGK KTV+D+IS +NA K K      D+Q+  + HF +    + DN    +      +KY+  I ++ ++FE RF D  +++    FIS
Sbjct:  374 DTEWTLDLAFLVDITGKLNLLNCQLQGKGKTVVDMISALNAFKAKMNAFSADLQRKKVLHFPSVQSVLKDNASASETFEKVAEKYIEVINRLGQEFENRFCDLHQLEPCVFFIS 487          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Match: ENSORLT00000044825.1 (general transcription factor II-I repeat domain-containing protein 2-like [Source:NCBI gene;Acc:111949247])

HSP 1 Score: 68.5514 bits (166), Expect = 4.035e-22
Identity = 41/99 (41.41%), Postives = 57/99 (57.58%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFED----DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVK 696
            ++ E+I  Q D  L+ RKF      DF+  V++ +YP + K ++ +   FGSTY+CE  FS + L K K R  LTDSH QD L LS+S    N   L+K
Sbjct:  456 LQMELIEFQCDTELR-RKFVSLPLRDFYPHVSKQRYPQMRKNAQVMLSLFGSTYICEQTFSLMNLNKIKLRGTLTDSHLQDILTLSVSKLQPNIQSLIK 553          

HSP 2 Score: 55.4546 bits (132), Expect = 4.035e-22
Identity = 32/105 (30.48%), Postives = 58/105 (55.24%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDK---YVAEI*KVVEDFEVRFQDFEK 308
             D+ W+ D+ F+ D T +L NLN++LQGK + + ++   I A + K  LL   +   N  HF +       L+++N ++D+   Y   +  + ++F +RF DF+K
Sbjct:  336 TDKRWIFDVAFMVDITDLLNNLNVKLQGKEQIITELFDHIKAFQMKLQLLCRHLSAGNFAHFPS-------LRDVNVEVDRLPEYGELLSNLNKEFNLRFVDFKK 433          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Match: ENSORLT00000027093.1 (general transcription factor II-I repeat domain-containing protein 2B-like [Source:NCBI gene;Acc:111947639])

HSP 1 Score: 65.4698 bits (158), Expect = 6.993e-22
Identity = 36/107 (33.64%), Postives = 63/107 (58.88%), Query Frame = 1
Query:  394 LMEQGP--IENEIIILQNDLILQARKFED----DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVK 696
            +++  P  ++ E+I LQ+D++L A +F      DF+  + +  +P++ + ++ I + FGSTY CE AFS +K  KSK RS +TD H    L ++ S    ++  LV+
Sbjct:  469 IVDDAPSEVQMELIELQSDMLL-AERFRSVSLLDFYSSLKKENFPHLRRHAQKILVLFGSTYHCEQAFSVMKFNKSKHRSSVTDDHLSAVLRIATSDIQPDFCALVQ 574          

HSP 2 Score: 57.7658 bits (138), Expect = 6.993e-22
Identity = 34/111 (30.63%), Postives = 55/111 (49.55%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            +DE W++DL F  D TA++  LN++LQ K   V ++ S + A   K   L   ++ NNL H       L + K     + KY   +  +  +F  RFQDF+ ++     +S
Sbjct:  357 SDEDWVADLGFAVDVTALMNQLNVKLQSKGLFVHEMYSAVKAFMRKLQFLSSQVKDNNLTHLP----TLKEAKRPEGHLQKYSTMLEALHAEFSRRFQDFKTLESEMHVVS 463          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Match: ENSORLT00000033014.1 (general transcription factor II-I repeat domain-containing protein 2 [Source:NCBI gene;Acc:101164918])

HSP 1 Score: 72.0182 bits (175), Expect = 1.959e-19
Identity = 46/116 (39.66%), Postives = 64/116 (55.17%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLN--HFSNMADNLHKLK--NINYKIDKYVAEI*KVVEDFEVRFQDFEKI-KEITGFIS 335
            +D  WL+DL FL D T  L  LN  LQG+N  V  + S I A  TK  L  + + Q   N  HF  + + +  L   N++ ++ KY A++  + E+F+ RFQDF  I KEIT F S
Sbjct:  372 SDPVWLADLAFLVDITRHLNALNTSLQGENAAVSQLYSHIKAFGTKLQLFQKHLLQRPPNPAHFPLLQEIMTSLSQNNVSAQMRKYAADMASLAEEFQQRFQDFAAIEKEITLFSS 487          

HSP 2 Score: 43.1282 bits (100), Expect = 1.959e-19
Identity = 32/106 (30.19%), Postives = 57/106 (53.77%), Query Frame = 1
Query:  412 IENEIIILQNDLILQARKFE---DDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
            ++ E+I LQ D+   +R  +     F++ ++++++  I   +  +   FGSTYLCE  FS +   K+  R+ L DSH +D L +     T+    L   MQ++SY+
Sbjct:  500 LQMELIELQCDIECCSRHQQLPLVSFYRQLDKSRFRRIRTFAMKMLSLFGSTYLCEKTFSVMNFNKNCVRTRLNDSHLRDILRIKT---TVCEPDLAFVMQSRSYY 602          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Match: SMESG000060663.1 (SMESG000060663.1)

HSP 1 Score: 209.534 bits (532), Expect = 1.286e-77
Identity = 98/122 (80.33%), Postives = 109/122 (89.34%), Query Frame = 1
Query:  355 GVKRIRQNISDLFLMEQGPIENEIIILQNDLILQARKFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQSYH 720
             VKRI Q ISD+FL+ QGP++NEIIILQNDLILQARKFEDDFWK+V RAKYP++TKCSEYIY CFGSTYLCESAFSYLKL K KQRSVL+DSHTQDSL+LSLS Y  NYD L+KDMQTQ +H
Sbjct:   69 SVKRISQKISDVFLIWQGPLDNEIIILQNDLILQARKFEDDFWKYVKRAKYPDVTKCSEYIYSCFGSTYLCESAFSYLKLVKGKQRSVLSDSHTQDSLILSLSVYKPNYDFLIKDMQTQLFH 190          

HSP 2 Score: 99.7525 bits (247), Expect = 1.286e-77
Identity = 50/61 (81.97%), Postives = 54/61 (88.52%), Query Frame = 3
Query:  153 MEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFIS 335
            M+D+QQNNLNHFSNMA+NLHK KNINY I+KYVAE  KVVED EVRFQDFEKIKEI  FIS
Sbjct:    1 MKDLQQNNLNHFSNMANNLHKHKNINYNINKYVAETQKVVEDLEVRFQDFEKIKEIVEFIS 61          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Match: SMESG000079713.1 (SMESG000079713.1)

HSP 1 Score: 63.5438 bits (153), Expect = 8.338e-23
Identity = 38/116 (32.76%), Postives = 61/116 (52.59%), Query Frame = 1
Query:  379 ISDLFLMEQGPIENEIIILQNDLILQAR----KFEDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNYDVLVKDMQTQS 714
            I    + E    + E+I +Q ++IL+ +    +   +FWKFV  +KY  +   S  +   FG+TY CES +S +K  KSK RS LT+ H    +  +L+ Y  ++   V  MQT +
Sbjct:  530 IPKYLIPETSAGQKELIEIQENIILKMQHKTSQSPIEFWKFVAESKYSRLKNASCKLISIFGTTYCCESLYSTMKFIKSKYRSELTNEHLTGLIRTALTSYEPDFQKFVVRMQTHT 645          

HSP 2 Score: 62.003 bits (149), Expect = 8.338e-23
Identity = 39/109 (35.78%), Postives = 62/109 (56.88%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFEKIKEITGFI 332
            D+ WL DL FLTD   I+ +LNL+LQGK  T+ D    I + K K +L   D+   NLNHF  +       +N + K+++Y  ++ +++  FE+R++D E  K    F+
Sbjct:  413 DDNWLHDLMFLTD---IMQSLNLQLQGKQNTIADFTQTIFSFK-KLMLFKNDLTTRNLNHFPWLKSK--SSQNKDPKLEEYQEKLQELINYFELRYEDLEIFKTFINFL 515          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Match: SMESG000020950.1 (SMESG000020950.1)

HSP 1 Score: 80.1073 bits (196), Expect = 3.709e-18
Identity = 40/80 (50.00%), Postives = 55/80 (68.75%), Query Frame = 3
Query:    6 DETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDK 245
            DE WL DL FLTDF + L +LNLELQGK+KT+  ++S + A K K  LL+  +++NNLN+F N+   L+ L  INY  +K
Sbjct:   52 DEKWLVDLAFLTDFRSKLNDLNLELQGKDKTIFQMVSSVKAFKQKLSLLVGKLEKNNLNYFPNLMTQLNSLVAINYDTNK 131          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Match: SMESG000009055.1 (SMESG000009055.1)

HSP 1 Score: 78.1814 bits (191), Expect = 1.925e-15
Identity = 41/104 (39.42%), Postives = 63/104 (60.58%), Query Frame = 1
Query:  361 KRIRQNISDLFLMEQGPIENEIIILQNDLILQARKF-EDDFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGY 669
            + I   I++    +   +E+EII L++D+ L++R   ED+FW  ++  KYP +     Y+   FGSTYLCESAFS + + K+K RS LTD H    L +++S Y
Sbjct:  734 EEIATQINEFLDSDSTCLEDEIIALKSDIQLKSRATTEDNFWNLISEEKYPILRIVVGYMSAFFGSTYLCESAFSSMNVIKTKHRSCLTDGHLASCLRIAISSY 837          
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Match: SMESG000015269.1 (SMESG000015269.1)

HSP 1 Score: 58.5362 bits (140), Expect = 2.226e-14
Identity = 39/124 (31.45%), Postives = 67/124 (54.03%), Query Frame = 1
Query:  364 RIRQNISDLFLME-QGPIENEIIILQNDLILQARKFED---DFWKFVNRAKYPNITKCSEYIYLCFGSTYLCESAFSYLKLTKSKQRSVLTDSHTQDSLLLSLSGYTLNY-DVLVKDMQTQSYH 720
            R+ QN  D  + E    ++ EII LQ +  ++ +  E    DF+K+++  ++PN+ K +      F +TY+CE  F  +K  KSK R+ L+D H Q  L++ ++ +  NY D+L +  Q    H
Sbjct:  455 RLFQNPFDCNVAEISSQLQIEIIDLQANEQIKDKYKEGNLIDFYKYLDAKEFPNLKKFARKYISMFETTYVCEQTFPRMKYLKSKYRANLSDDHLQSLLMIGVTNFDPNYKDILQQKKQFHHSH 578          

HSP 2 Score: 38.891 bits (89), Expect = 2.226e-14
Identity = 30/101 (29.70%), Postives = 43/101 (42.57%), Query Frame = 3
Query:    3 NDETWLSDLEFLTDFTAILCNLNLELQGKNKTVIDIISCINACKTKFVLLMEDIQQNNLNHFSNMADNLHKLKNINYKIDKYVAEI*KVVEDFEVRFQDFE 305
            +D  WL    F  D    +  LNL+ Q KN    D+ S I A +TK  L    + +    HF    D  +K     + I   V  I  + E+F+ RF D +
Sbjct:  349 SDAAWLWKFAFFADAATHVNTLNLKFQEKNNLFCDLYSQIKAFQTKLQLFESQVTECIFTHFP-CCDEFNKKTEEQFPIAFAVKIIADLKENFQKRFSDLD 448          
The following BLAST results are available for this feature:
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
GTF2IRD22.874e-1233.03GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD23.030e-1233.03GTF2I repeat domain containing 2 [Source:HGNC Symb... [more]
GTF2IRD2B4.461e-1233.03GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
GTF2IRD2B4.591e-1233.03GTF2I repeat domain containing 2B [Source:HGNC Sym... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
AL928808.13.824e-2239.22pep chromosome:GRCz11:20:17257101:17259573:-1 gene... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSXETT00000016563.13.594e-1733.02pep primary_assembly:Xenopus_tropicalis_v9.1:4:373... [more]
ENSXETT00000028445.12.431e-1334.34general transcription factor II-I repeat domain-co... [more]
spag12.898e-933.98sperm associated antigen 1 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Gtf2ird25.914e-932.43GTF2I repeat domain containing 2 [Source:MGI Symbo... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q86UP8|GTD2A_HUMAN1.313e-1133.03General transcription factor II-I repeat domain-co... [more]
sp|Q6EKJ0|GTD2B_HUMAN1.990e-1133.03General transcription factor II-I repeat domain-co... [more]
sp|A4IFA3|GT2D2_BOVIN6.375e-1132.17General transcription factor II-I repeat domain-co... [more]
sp|Q99NI3|GT2D2_MOUSE3.510e-832.43General transcription factor II-I repeat domain-co... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2H8TSF61.099e-3841.88General transcription factor II-I repeat domain-co... [more]
A0A3B3HZV51.639e-3843.80Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A096MF304.159e-3742.15Dimer_Tnp_hAT domain-containing protein OS=Poecili... [more]
A0A1A8SK745.450e-3643.22Uncharacterized protein OS=Nothobranchius rachovii... [more]
A0A484CY623.516e-3544.83Uncharacterized protein OS=Perca flavescens OX=816... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039226.19.414e-3335.83pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050151.11.077e-2133.03pep primary_assembly:Astyanax_mexicanus-2.0:17:232... [more]
ENSAMXT00000037725.13.908e-1834.02pep primary_assembly:Astyanax_mexicanus-2.0:14:291... [more]
ENSAMXT00000035253.12.293e-1636.46general transcription factor II-I repeat domain-co... [more]
ENSAMXT00000054244.14.443e-1533.64SCAN domain-containing protein 3-like [Source:NCBI... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000033470.11.196e-4143.80pep primary_assembly:ASM223467v1:22:24335229:24337... [more]
ENSORLT00000046355.13.482e-3844.83pep primary_assembly:ASM223467v1:21:4582475:458432... [more]
ENSORLT00000044825.14.035e-2241.41general transcription factor II-I repeat domain-co... [more]
ENSORLT00000027093.16.993e-2233.64general transcription factor II-I repeat domain-co... [more]
ENSORLT00000033014.11.959e-1939.66general transcription factor II-I repeat domain-co... [more]
back to top
BLAST of General transcription factor II-I repeat domain-containing protein 2A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060663.11.286e-7780.33SMESG000060663.1[more]
SMESG000079713.18.338e-2332.76SMESG000079713.1[more]
SMESG000020950.13.709e-1850.00SMESG000020950.1[more]
SMESG000009055.11.925e-1539.42SMESG000009055.1[more]
SMESG000015269.12.226e-1431.45SMESG000015269.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016234 ID=SMED30016234|Name=General transcription factor II-I repeat domain-containing protein 2A|organism=Schmidtea mediterranea sexual|type=transcript|length=1075bp
TAAATGATGAAACTTGGCTTAGTGACTTAGAATTTCTTACCGATTTTACT
GCAATATTGTGTAATTTAAATTTAGAATTACAAGGTAAAAATAAAACAGT
AATTGATATCATCAGCTGCATAAATGCATGTAAAACAAAATTTGTTTTGC
TAATGGAAGATATACAACAAAATAATCTGAATCATTTTTCAAATATGGCG
GATAACTTACATAAACTCAAAAATATTAATTATAAAATCGACAAATACGT
CGCGGAGATCTAAAAAGTAGTTGAAGATTTTGAAGTAAGATTCCAAGATT
TTGAAAAAATTAAAGAAATTACGGGATTTATATCTTTTTTTAAAAAAAGA
TTTAGGCGTAAAACGCATTAGACAAAATATTTCTGACTTATTTCTAATGG
AGCAAGGGCCGATAGAAAATGAAATTATAATTCTACAAAATGATTTAATA
TTACAAGCCAGAAAATTTGAAGATGATTTTTGGAAATTCGTCAACCGAGC
AAAATACCCCAATATAACGAAATGTAGTGAATATATTTACTTGTGTTTCG
GATCTACATACCTGTGTGAATCAGCGTTTTCATATTTAAAGTTAACGAAG
AGCAAACAACGTTCTGTCCTGACTGATTCGCATACTCAAGACTCATTATT
ATTATCTTTGTCAGGATATACACTGAATTATGATGTCTTGGTTAAAGATA
TGCAAACACAGTCTTACCATTAAGGCTATAGTAATAAAATAAATTCTAAA
TCTCTGTTTATGTGTACCTAATTTGAATTAATAAATATTGTTAACAGTTA
TTCATGTTATTTTAATTCTCTTGAAAGTGAAGTTTAGACTTAGACTACTC
ATATGGCATAAGTCAATCGCGAAACATTTATGTACAAAAGTTCTGTGTCT
TCGAGGATTTCTACGTAATAAGTGTTATTTATTTGTCCTATAAAAAATTG
TATCAGAAATTGTGAAAATAATTGAGGAGAAAGTTCAATGTCAAATAAAA
ACGAAAGGAAATCGTCGAGCGAGAATGAATCAGCAAACCAGACAAATCCA
TGAAGTTAAAGCAAATGGTTCGACA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR026630EPM2A-int_1
IPR008906HATC_C_dom
Vocabulary: molecular function
TermDefinition
GO:0046983protein dimerization activity
GO:0003676nucleic acid binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008906HAT, C-terminal dimerisation domainPFAMPF05699Dimer_Tnp_hATcoord: 27..82
e-value: 2.1E-5
score: 24.2
NoneNo IPR availablePANTHERPTHR45913:SF7coord: 6..108
IPR026630EPM2A-interacting protein 1PANTHERPTHR45913FAMILY NOT NAMEDcoord: 6..108