Protocadherin 11

Overview
NameProtocadherin 11
Smed IDSMED30016231
Length (bp)3374
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protocadherin 11 (SMED30016231) t-SNE clustered cells

Violin plots show distribution of expression levels for Protocadherin 11 (SMED30016231) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protocadherin 11 (SMED30016231) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protocadherin 11 (SMED30016231) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016231

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016231SMESG000051413.1 SmedASXL_015939SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016231SMESG000051413.1 dd_Smed_v4_16397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30016231SMESG000051413.1 dd_Smed_v4_16397_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016231SMESG000051413.1 dd_Smed_v6_16397_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30016231SMESG000051413.1 dd_Smed_v4_16397_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protocadherin 11 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 235.728 bits (600), Expect = 3.183e-63
Identity = 238/807 (29.49%), Postives = 385/807 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   DAD  E N ++   +L+  +N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NKAVTLSILNDNDNF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KSLHTLVL 769          

HSP 2 Score: 104.76 bits (260), Expect = 4.429e-22
Identity = 143/587 (24.36%), Postives = 245/587 (41.74%), Query Frame = 3
Query:  837 VRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++  IIV+  D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + DRE+   +  T+ A+D G PP  +   + +TV+D NDNSP +        +    +F +S+     S V  +   D D  +   ++  I++   ++       L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  126 IKIKIIVK--DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF------VLDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          
BLAST of Protocadherin 11 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 236.498 bits (602), Expect = 4.685e-63
Identity = 238/807 (29.49%), Postives = 385/807 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   DAD  E N ++   +L+  +N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NKAVTLSILNDNDNF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KSLHTLVL 769          

HSP 2 Score: 105.531 bits (262), Expect = 2.978e-22
Identity = 142/583 (24.36%), Postives = 242/583 (41.51%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + DRE+   +  T+ A+D G PP  +   + +TV+D NDNSP +        +    +F +S+     S V  +   D D  +   ++  I++   ++       L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF------VLDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 99.7525 bits (247), Expect = 2.042e-20
Identity = 141/577 (24.44%), Postives = 239/577 (41.42%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +        R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 236.498 bits (602), Expect = 4.848e-63
Identity = 238/807 (29.49%), Postives = 385/807 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   DAD  E N ++   +L+  +N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NKAVTLSILNDNDNF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KSLHTLVL 769          

HSP 2 Score: 105.916 bits (263), Expect = 2.307e-22
Identity = 142/583 (24.36%), Postives = 242/583 (41.51%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + DRE+   +  T+ A+D G PP  +   + +TV+D NDNSP +        +    +F +S+     S V  +   D D  +   ++  I++   ++       L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF------VLDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 99.7525 bits (247), Expect = 1.749e-20
Identity = 141/577 (24.44%), Postives = 239/577 (41.42%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +        R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Human
Match: PCDH9 (protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661])

HSP 1 Score: 236.113 bits (601), Expect = 5.109e-63
Identity = 238/807 (29.49%), Postives = 385/807 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   DAD  E N ++   +L+  +N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NKAVTLSILNDNDNF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KSLHTLVL 769          

HSP 2 Score: 105.916 bits (263), Expect = 2.747e-22
Identity = 143/583 (24.53%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+     G +     + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + DRE+   +  T+ A+D G PP  +   + +TV+D NDNSP +        +    +F +S+     S V  +   D D  +   ++  I++   ++       L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPVFK--EGQV----EVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF------VLDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 100.138 bits (248), Expect = 1.673e-20
Identity = 141/577 (24.44%), Postives = 239/577 (41.42%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +        R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Human
Match: PCDH1 (protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655])

HSP 1 Score: 205.297 bits (521), Expect = 2.142e-53
Identity = 202/753 (26.83%), Postives = 346/753 (45.95%), Query Frame = 3
Query:  342 EFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCDK---EKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDI----LSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEK----IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINV 2510
            +  V + Y  +D +T ++    T ID + +     EC ++   + C++E +V + +  Q  S   L+ +++  D N         +I L+  E  +I +   I  A D+D    N   +Y+        +LF  Q   D       ++VM +L+ E    Y   +KV D         +++ V V+D NDN P F    Y  ++ E+ PIG  +++V A D+D     +  Y F Q+   V+ +  +++ +G+I+++  +     S   F+V A D      K   A V + ++D+NDN P I +   G +     +  I E+   +T  + + VSD+D G NA V C     +  + +   E      + Y ++T    DYE ++    EI+ +DSG+P L S  ++K+ +VDVN+  P    +  E++F EN    + I  I ASD D G  A L YSL  +   +  FTI+  TGEI +   +LD+E  +S + KV   D        T  V V +LD NDN P+F +    F++ E +   S +   +   D DK E             N +++L  E+        +  G I + ++ DRE+ S YT  + A D G PP+S    +TI V+D NDN+P +++ PS  S +      ++ +  +G  V+Q+ A D D     ++ Y I     +        +   SG +++ +      +G   L +   D G PP   Y T ++++
Sbjct:   91 KLEVGAPYLRVDGKTGDIFTTETSIDREGL----RECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGP-NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQV-KTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM-VTVIDGDKGE-------------NAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-YITAPSNTSHK-----LLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP--RYGTALVHL 810          

HSP 2 Score: 141.354 bits (355), Expect = 2.896e-33
Identity = 135/498 (27.11%), Postives = 229/498 (45.98%), Query Frame = 3
Query: 1173 EIEIEDVNDNYP-----IISLLHGYMPDPYAIRIDENTPPKTLFSIHV-SDKDTGINAVVNCSLRV--RRKDLLEM-IKADMEIYQIRTI--RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILR-----YSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPF-TIQEGLSFYSK------LSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN----LFSGLNMAIIIGM 2567
            +IE++D+NDN P     +I+L            I ENT   +LF I + SD+D G N V +  L+     ++L  + +  D E  Q + I   + D E     +  I   D GSP   S   +++ ++D N+  P       E    EN P    ++ + A+D D+GA        +   E+ R    ++  TG +I     +D+E   +++F V   D   NP +A   V VT+ D NDNAP   +  +   T Q+G++  S+          ++  D D+ E N ++   +      ++    E   D   K  ++T   +D EK  +YT+ I+A D GNPP S++ ++ + V+DVNDN+PV+        S  E  F  + +   G ++A++ A      D G  + ++ S E     +   T++  +G + +      +   SY    LK+ A D G P L+  AT+++NV   NDN    + SG N +++  M
Sbjct:  155 QIEVQDINDNTPNFASPVITLA-----------IPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTG-LITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ------SVTEVAFPENNKP--GEVIAEITA---SDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY---ELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM 625          

HSP 3 Score: 117.472 bits (293), Expect = 7.177e-26
Identity = 138/588 (23.47%), Postives = 240/588 (40.82%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEEL--------SFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++V D NDN P F      + IPE+  IG       A D D+       Y  Q+    + +F +       EK+  +I +  +L   +   Y  T+   D  S   +   A + + + D NDN P            Y   + EN+P   ++  +  +D D G NA +  +     + +  +++ D     I      D E L  +   +L  D G+    +R  + + + D+N+  P+I      L        +  E++ E   +  +  SD+D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V ++D NDNAP F  ++        +   ++   I A DAD    N  +++ L      + E   + +F +S + GEI+   ++DRE+  +Y L ++A D+G+P    +  + + V+D NDN P ++    L+        N+   + +G +            D G+ + V +S E       F+  N T  ILS     LS+ R        ++ A D G PP   Y  + INV   NDN
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMG-NLDRERWDSYDLTIKVQDGGSPP-RASSALLRVTVLDTNDNAPKFERPS------YEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGS-NAELVYSL------EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM----LSGYNFSVMENMPALSPVGMVTV-------IDGDKGENAQVQLSVEQ--DNGDFVIQNGTGTILSS----LSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDN 711          
BLAST of Protocadherin 11 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 135.961 bits (341), Expect = 8.432e-32
Identity = 157/568 (27.64%), Postives = 251/568 (44.19%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRK-DLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLK--ISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++V V+D  DN PIF +  Y  +I E  PIG  +L V A+D DS    +  Y      N K++  I  +SGVI     L     S     V A D      ++  A VEI + DVNDN P+      +  D Y + I EN T P  + ++  +D+D G N  V+ S+        L +  +  E+     I + +  I  +I A+    D   PAL S   + I ++D+N+  P++    + ++ +EN+   + +  + A D+D G   I++YS++  G   F I+  +G +I +   LD+E       KV   D        +  + V + D NDNAP F       TI E +   S++ T ++A D D+D+    I +R+         +L     D+  +G I +V    + +D    + I A D+G        N+ I   DVN       S P  N      +  I + + IG  V  LKA D D+ D  +I Y I S+       QF  ++ +SG +S+        R      ++A DH  PPL     + + +   NDN
Sbjct:  255 TVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEG-NGKNLLAINAKSGVIQTAAPLDRETLSLIRLDVIASDK-GTPKRESTAMVEITVVDVNDNAPV------FASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAK----DGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSG-LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT-LKAVDNDEDQ---KITYRIEEADREVFSIL-----DIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVN-------SAPYFNDHPFSVK--IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDN 780          

HSP 2 Score: 134.806 bits (338), Expect = 1.621e-31
Identity = 148/532 (27.82%), Postives = 249/532 (46.80%), Query Frame = 3
Query:  891 FVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIY-FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPF-TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIH-QHPLSYGRTLLKISAHDHG 2468
            F ++KY+ ++PE  PI   I  V A  A S     +    Q + + +++F ++  SG I L +S+      +++  V A + +  T       V + + DV DN PI      +  D Y   I E+ P   T+ S+   D D+G N  +  SL       L  I A   +  I+T    D E L LI  +++  D G+P   S   ++I +VDVN+  P   ++   ++  ENI     I ++ A+D+D G    + YS+     I   TI+  TGE+ +    +D + N  +   +   D      ++T+ +T+ ++D ND+AP  +      T++E ++   ++  R+ A   D+D   + II          ME   + I D  S G I+T   +DRE  + Y+L + A+D G P  +TST I + + D+NDN+P +         + E    IS+E   GS +  LKA+D D+D   KI+Y I   E+  +    L + +   ILS+  +      +  ++ISA D G
Sbjct:  165 FQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRS-QNLFTLDTMSGEIRLAKSMDREVLDKHILKVTAYERVDPTISASTT-VVVHVLDVQDNSPI------FEKDSYFGEIREDAPIGTTVLSVFARDLDSGENGEIEYSLGEGNGKNLLAINAKSGV--IQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRE-RIDAK-NSPITAVIRAKDGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVG-RVYA--IDEDSGPNGII-------KYSMEGSEDFIIDEDS-GLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTF--------DKKEYNVTISEEMPRGSQIITLKAVDNDEDQ--KITYRI--EEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG 661          

HSP 3 Score: 122.094 bits (305), Expect = 1.488e-27
Identity = 140/570 (24.56%), Postives = 254/570 (44.56%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID----ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLS---TRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + V+D NDN P+F    Y V I E+  I   I  V A D D     K  Y   S+  +  +  I+  +G ++L++ +   K S     + A D    ALS T       + I + D+ND+ P +      +     I ++EN    + +  ++  D+D+G N ++  S+      ++     D +   I+T +  D E       ++   D G+P+L +   I +++ D+N+  P+       ++  E +P    I+++ A D D+   + Y ++E  R  F+I      G I+  +  L K  +  V+ ++  TD           V V I D N +AP F +  PF+++  +  +S +      ++A+D D+ + N  I++ +  +   +++          S G+I     +DRE  + +++ + A D  +PP +TST I + + D+NDNS      P   SS   A   IS++  +G+   Q+ A+D D    G + Y  ++  S     Q   L+ TSG L +        +   +L I A D G P L   + + + +   NDN
Sbjct:  363 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-TIDYSTGEVTLRERIDA-KNSPITAVIRAKDGAQPALSSTVP-----LTINVIDINDHAPTL------IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-----DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL-KRQDHKVRVEISATDQ--GGLQGRCVVNVFIDDVN-SAPYF-NDHPFSVK--IPEHSPIGYPVITLKAEDHDRGD-NARIVYSIDSSQFFRID---------PSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNS------PQFTSSSYAA--TISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDN 888          

HSP 4 Score: 108.227 bits (269), Expect = 2.186e-23
Identity = 124/473 (26.22%), Postives = 213/473 (45.03%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQI------RTIRSFDYEILQL---IEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI----MSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFIT--DSLINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            + + VID ND+ P  +  + ++ + E+  IG+++ +V A D DS       Y  + + +    F I+++SG+I   + L     +RY   V A D  + +       + + ++D+NDN P       +    Y + I E  P  + + ++   D D              +K    + +AD E++ I        I S   E+ +    +  EI   D G   L  R  + + I DVN         F +  F   IPEH  I    +++ A D D+G  A + YS+D     +F I+  +G+I +S+  LD+E  D   F V +T  D    P   +  + V + D NDN+PQF       T+   I  G SF      ++ A DAD     + I+   L+  ++   +   ++F +  + G +     +DRE+ +   L I A+D+G P  S ++ IT+T+ DVNDN+P +
Sbjct:  465 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPT------FDKKEYNVTISEEMPRGSQIITLKAVDNDED------------QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAP-----YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSS-DLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-----QVSAIDADIGP--NGIVDYFLNESSSSPSI---QLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 892          

HSP 5 Score: 98.5969 bits (244), Expect = 1.949e-20
Identity = 125/464 (26.94%), Postives = 201/464 (43.32%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPD-PYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI------DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPV 2192
            +I V + D NDN P F +K+Y V I E  P G +I+ + A D D      T+   +++  V SI +I  +  ++S+   L   K+  +   V  I A      +    V + I+DVN + P       Y  D P++++I E++P    + ++   D D G NA +  S+     D  +  + D     I      D E        +   D  SP L +   I++I+ D+N+  P   ++    +  E+IP     + + A D D G   I+ Y L+E         F ++  +G + +S+  LD+E    +   +F  D      +A   +T+T+ D NDNAP F   +    I E     S + T I A+DAD+ + N  I FR+    +        K+FD+    E   VV I      D E  +N     L    G    S++  + I V DVNDN P 
Sbjct:  566 TIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ-KITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRV-EISATDQGGLQGRCVVNVFIDDVN-SAP-------YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSI-----DSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSS-KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGD-NADISFRIFGGAD-------AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPA 999          

HSP 6 Score: 90.1225 bits (222), Expect = 9.017e-18
Identity = 88/330 (26.67%), Postives = 152/330 (46.06%), Query Frame = 3
Query:  693 DESMTFQLFVYQYDPDILSIM------VMRSLNYELK-QIYFCKLKVCDKTYQNCVRKSIIVQV-IDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAVVNCSL-RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF----KENIPEHKFIMSIDASDKDKG 1640
            D+ +T++  + + D ++ SI+       + S++ ELK Q +  ++++   T Q  ++   +V V ID+ ++ P F +  + VKIPE  PIG  ++ + A+D D     +  Y   S+      F I+  SG IS+   L    ++ +   V A D  S         +E+ ++D+NDN P       +    YA  I E+ P  T F  +   D D G N +V+  L        +++ + D     +R     D E   +I   I   D G+P+L +   I + + DVN+  P+    FE+LS+     EN P    + +I A D D+G
Sbjct:  611 DQKITYR--IEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEI-SATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTS-TQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT----FEQLSYDLYIAENSPVGSTVGTIVARDADEG 922          

HSP 7 Score: 87.0409 bits (214), Expect = 6.624e-17
Identity = 95/333 (28.53%), Postives = 162/333 (48.65%), Query Frame = 3
Query: 1557 NFEELSFKENIPEHKFIMSIDASDKDKGAI---LRYSL----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT-IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLK-ISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +F++  + + +PE   I +I AS K   A    L YS+    D   +  FT+++ +GEI ++  ++D+E+ D    KV   + +    +A+  V V +LD  DN+P F     F  I+E     + + + + A+D D  E N  I + L       +  ++ K       G I+T   +DRE  S   L ++A DKG P + ++  + ITV+DVNDN+PV+ S  S N         I +   I +++A +KA D+D    GK+ Y + S+     G   LT++ ++G +++ +   +    +   I A D   P L +   L INV   ND+
Sbjct:  164 HFQQEKYVKELPEDTPIETIIASVKASHASSQPLYYSMVAPQDSRSQNLFTLDTMSGEIRLAK-SMDREVLDKHILKVTAYERVDPTISASTTVVVHVLDVQDNSPIFEKDSYFGEIREDAPIGTTVLS-VFARDLDSGE-NGEIEYSLGEGNGKNLLAINAK------SGVIQTAAPLDRETLSLIRLDVIASDKGTPKRESTAMVEITVVDVNDNAPVFAS-DSYN-------VTILENITIPAVIATVKATDEDFGTNGKVHYSMASS----SGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAKDGAQPALSSTVPLTINVIDINDH 475          
BLAST of Protocadherin 11 vs. Ensembl Celegans
Match: cdh-1 (CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4W0])

HSP 1 Score: 129.028 bits (323), Expect = 1.110e-29
Identity = 148/582 (25.43%), Postives = 268/582 (46.05%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP-KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY-NNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP----VWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL----SIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIII 2561
            ++  ++D     P F +  + V+IPE  PIG  ++KV A ++      +  Y  Q   N      ++  SG + ++++    K+  Y  TV A +A S T     + + I ++DVNDN+PI      + P+ Y + + E   P + L  +  SD D+G    V+  + +       +     E++  + +    + ++      +   D G  +  +   I I ++D +   P    +  E+   E+I     I S+ A  K K +I  YS D+     F+I+  TG+I ++   LD +++D+V   +  T  L +  +    V + I D NDN PQF  +L   +I+E L  +      ++A D DK + N  + + ++ ++  + +E+           G++ T   +D E   NY L + A D G PP+S++  + I V+DVNDN+P     W +   L +S P+            +IV ++ A D+D  + G+I Y I +      G ++  ++E  G +    SI +  +S+    + I A D G PP  + A+  I+V   NDN  S L++  I+
Sbjct:  526 VVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQ---NQDEHLTVDTMSGTVCIQKTFDFEKQKSYQTTVIATNANSET---STSLISIRLKDVNDNWPI------FYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHI-LSESSSFSINPVTGEVFAQKPLARGRFHLV------VSAKDGGGQSSENSANIHITVIDKDTKTPQFSRSKYEIRTTEDILPGIAIGSVGAMSKVKYSI--YSGDQDHN--FSIDEDTGKIYVTRY-LDADVHDTVLLNIQAT--LPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYV-VQASDKDKKK-NGEVRYSIISSHPGSSIEIDQ-------FTGQLSTGSLLDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSWYTMEVLENSPPK------------TIVGKVVARDKDSLENGQIVYRITN------GSEYFGIDEKLGNVYTKRSIDREVISH--VDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIV 1052          

HSP 2 Score: 117.857 bits (294), Expect = 3.248e-26
Identity = 133/519 (25.63%), Postives = 244/519 (47.01%), Query Frame = 3
Query:  747 SIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKA-IKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK--GAILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK-LSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP--VWVSPPSLNSSEPEARFNISKEAAIGSIVA 2279
            ++ + ++ ++E ++ Y   +   +   +      I +++ D NDN PIF   +Y + + E     + +L V+A D DS  F +  Y   S     S F+I   +G +  ++ L+   + R+   V A D    +  ++ A++ I + D +   P  S         Y IR  E+  P              + A+      +   D       D +  +I   R  D ++   +   +L I +  P+  S +  + I I D N+  P   ++  E+S +E++  H+    + ASDKDK     +RYS+     G     I+  TG++   ++ LD E   + K +V  TD  I P ++ M + + +LD NDNAP+F  +  +T++   +   K +  ++ A+D D  E N  I++R+  T  ++   + EK+      G + T  +IDRE  S+  ++I+A+DKG PP+S++ +  I+V+DVNDN P  + ++P  + +  P +        AIG+IVA
Sbjct:  594 TVCIQKTFDFEKQKSYQTTVIATNANSETST-SLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLVVSASDMDSGTFGEVSYHILSE---SSSFSINPVTGEVFAQKPLA---RGRFHLVVSAKDGGGQS-SENSANIHITVIDKDTKTPQFSR------SKYEIRTTEDILPGIAIG--------SVGAMSKVKYSIYSGDQDHNFSIDEDTGKIYVTRYLDADVHDTV---LLNIQATLPSGESNQTQVVIFIEDHNDNPPQFSSSLVEISIREDLKLHEPFYVVQASDKDKKKNGEVRYSIISSHPGS-SIEIDQFTGQLSTGSL-LDYEATRNYKLRVKATDLGIPPRSSNMTLFIHVLDVNDNAPEFEKSW-YTMEVLENSPPKTIVGKVVARDKDSLE-NGQIVYRI--TNGSEYFGIDEKL------GNVYTKRSIDREVISHVDISIVAEDKGVPPRSSTASARISVLDVNDNPPSCLSITPIVVPAGSPLS-------TAIGTIVA 1068          

HSP 3 Score: 73.1738 bits (178), Expect = 1.211e-12
Identity = 118/570 (20.70%), Postives = 241/570 (42.28%), Query Frame = 3
Query:  768 LNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIIS-LLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI------MSIDASD------KDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPF-TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIE----TVVTIDREKDSNYTLTILAQDKGNPPKST--STNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH 2417
            L+ E+ + Y   LKV        +   + V+V + NDN P F   K   ++PE+  +G  +  V AKD D+    + F    S+    + FNI++ +G I L   L       +  T+ A D    TF     ++ I + D+NDN P  S  L+     P        +P +    I   D D      +  SL      +  +      ++ ++ +       L  + A     D+G P+  +   + +II    E EP+ +  FE+  F+  + E+  I      +S + S       +D  A   +S+D+ GR++       G I       D+E   + +F+V I + ++          V +LD+NDN P F     + ++++ ++   K+  +I A D D  E N  + +R+L   +  +  L+         G I+        +D   ++ + + + A+D G+P ++      +++ +   + ++P +V         P    ++ ++ ++G+++ +++A     +  G  +  ++ +   +QG+  L ++  +G L++  H
Sbjct: 1888 LDREILERY--SLKVIGTGSGQQIGTRVDVRVNNLNDNVPSFPMSKPR-RVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLTAPLDFEVLPEHTLTIKATDGSFDTF----TNLTIFVSDINDNAPTFSKPLYQTTVSPATF-----SPGQPFAKIEAHDLDA--RGALTYSLGQGSSSIFRVAPESGALF-MKVLPPAGERYLVTVTA----TDNGVPSFSTSVPVSVII---GEAEPTDKPGFEKAEFRFEVMENSKIGLQIGNLSGEESREFHYRIQDPEASKIFSIDKFGRLFV-----AGPI-------DREQRATHEFQVEIDNEMMTSQKVQCKCHVIVLDENDNLPVFTSVAYYLSLKDSMAHGQKIG-QIMASDQDSGE-NGRVSYRILSGNDLNIVTLN------PDTGSIQLNEWNDAQLDEFPNATWQILVEARDHGHPARAAVGKVQVSLKMSSWSGSAPFFVL--------PVYEVHVLEDTSVGTVLQKIRA----SNRLGMRNDGLLYSLKEHQGK--LGIDVKTGELTLKTH 2401          

HSP 4 Score: 67.0106 bits (162), Expect = 8.302e-11
Identity = 81/294 (27.55%), Postives = 131/294 (44.56%), Query Frame = 3
Query: 1662 DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTR-----IEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVT--IDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTE----SHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINV 2510
            DE    +  ++ R+GEI  +   LD E     KF +      +     T+ + V + D+NDNAP F   +   ++  +S +++L T      +   D  K +++  +I  L    NN  +L   K   V+ + + + VV   +DRE    Y L I AQD G P K      +I +ID NDN+PV+        S      ++S   +IGS +  ++A D D  +  +ISY I  T     S++   Q   +  T+ +L    H        + + A DHG P L + A + I V
Sbjct:   62 DEQTSKFLKVDERSGEI-STIAHLDYEKRS--KFDIVAVK--VEESGETIDILVEVDDENDNAPSFADQV---VKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVI--LQGNVNNVFKLASRK---VNEQLQADLVVNGQLDREFRDKYELLIEAQDGGKPAKIGQLRCSIEIIDANDNAPVF--------SRSRYTASVSANISIGSHLITVQATDADIGENSRISYDIKKTSAPSNSNFAISQSGVITTTASLLPASTHD-------VIVVASDHGSPSLSSSAVVTITV 327          

HSP 5 Score: 59.3066 bits (142), Expect = 2.119e-8
Identity = 112/491 (22.81%), Postives = 199/491 (40.53%), Query Frame = 3
Query:  885 PIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSI-HVSDKDTG---------INAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN-----SRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFR--LLHTY-NNKMELLHEKIFDVSSKGEIETVV-----TIDREKDSNYTLTILAQDKGN----PPKSTSTNITITVIDVNDNSPVWVSPP---SLNSSEPEARFNISKEAAIG 2267
            P F +      +PES  IG +I  ++ K  +S+   K F  F      K    +++ SG IS    L   K+S++      I A+ V    +  D+ +E++D NDN P       +      + I E     T F++  V+D D           +   VN   ++  + + E ++AD+ +   +  R F  +   LIEA+    D G PA + +    I I+D N+  P    +    S   NI     ++++ A+D D G   R S D I +     N     S++G I  +   L    +D +   V  +D      +++  VT+T+L    ++P     + + ++   +   + ST              SI+ R  +   Y + K+ L+           +    +      +DRE  S + L  L +  G      P+       +T+ D+NDN+P W S     SLN ++  +R   +K+  +G
Sbjct:   20 PTFCQCLTKFTVPESAQIGTRIGWISGKREESAA-PKYFVVFPDEQTSK-FLKVDERSGEISTIAHLDYEKRSKF-----DIVAVKVEESGETIDILVEVDDENDNAP------SFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVNNVFKLASRKVNEQLQADL-VVNGQLDREFRDKYELLIEAQ----DGGKPAKIGQLRCSIEIIDANDNAPVFSRSRYTASVSANISIGSHLITVQATDADIGENSRISYD-IKKTSAPSNSNFAISQSGVITTTASLLPASTHDVI---VVASDHGSPSLSSSAVVTITVLGSTLSSPPL--DIIWLVESNSAHLMENSTL------------GSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGILDRETASEHHLKFLLEKDGQIIIEHPQ------LLTIGDINDNAPQWHSSQIHISLNRTQGGSRTLTAKDPDLG 468          

HSP 6 Score: 58.151 bits (139), Expect = 4.526e-8
Identity = 91/378 (24.07%), Postives = 154/378 (40.74%), Query Frame = 3
Query: 1176 IEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV-HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLK 2288
            + I D+NDN P     H        I I  N       ++   D D G N  +  S+        E++  D E  +I    + D  I   I+  +   D GSPAL +   +   ++D     P       ++   E+ P    ++ + A++   G    +RYSL   DE    + T+++ +G + +   T D E   S +  V  T++  N  T+T  +++ + D NDN P F  +    T++EG      L   + A D D       + + +L   ++         F ++   GE+     + R +   + L + A+D G      S NI ITVID +  +P +    S +  E     +I    AIGS+ A  K
Sbjct:  429 LTIGDINDNAP---QWHSSQ-----IHISLNRTQGGSRTLTAKDPDLGQNGWIRYSVLD-----TELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALWQVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDE----HLTVDTMSGTVCIQK-TFDFEKQKSYQTTVIATNA--NSETSTSLISIRLKDVNDNWPIFYPNEYHLTVREGPKPEEPLLV-VSASDMDSGTFGE-VSYHILSESSS---------FSINPVTGEVFAQKPLARGR---FHLVVSAKDGGGQSSENSANIHITVIDKDTKTPQF----SRSKYEIRTTEDILPGIAIGSVGAMSK 768          

HSP 7 Score: 54.299 bits (129), Expect = 7.132e-7
Identity = 122/543 (22.47%), Postives = 208/543 (38.31%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFN-KTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINK------KSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCI--DSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYF----TINSRTGEIIMSNVTLDKEMNDS--VKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP-----VWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ 2414
            I+V+V DENDN P F ++   ++I E   +G      T  D D   F+   F   Q N N  ++F +        L+  L +N       + +Y   + A D      K       IEI D NDN P+ S         Y   +  N    + L ++  +D D G N+ ++  +    K       ++  I Q   I +    +L     +++ +  D GSP+L S   + I ++      P +   +   S   ++ E+  + SI A            L  IG        T  +    +++  + LD+E      +KF +     +I  H   +    TI D NDNAPQ+  +    I   L+     S  + AKD D  + N  I + +L T         E +      G I    TID    S     + A+D G+P  ST   +   ++D     P     +W             +  I ++  IG+ + ++ A +    +  +I Y + + + H      LT++  SG + I +
Sbjct:  108 ILVEVDDENDNAPSFADQVVKLEISEFAQLGTSFALPTVTDGDGPKFDVHRFVILQGNVN--NVFKLASRKVNEQLQADLVVNGQLDREFRDKYELLIEAQDG-GKPAKIGQLRCSIEIIDANDNAPVFSRSR------YTASVSANISIGSHLITVQATDADIGENSRISYDI----KKTSAPSNSNFAISQSGVITT-TASLLPASTHDVIVVASDHGSPSLSSSAVVTITVLGSTLSSPPLDIIWLVESNSAHLMENSTLGSIVARVSIAQQYRDTKLRLIGSSALCPQQTDQAHVYLLLLCGI-LDRETASEHHLKFLLEKDGQIIIEHPQLL----TIGDINDNAPQWHSS---QIHISLNRTQGGSRTLTAKDPDLGQ-NGWIRYSVLDT---------ELVSIDKETGRIFVPNTIDCNIGSEIKFRVRAEDGGSPALSTDLQVVADLLDTESKPPQFEKALW-------------QVEIPEDTPIGTCLVKVVANNSQCGNSKRIRYSLQNQDEH------LTVDTMSGTVCIQK 599          

HSP 8 Score: 53.9138 bits (128), Expect = 9.993e-7
Identity = 128/534 (23.97%), Postives = 219/534 (41.01%), Query Frame = 3
Query:  747 SIMVMRSLNYELKQIYFCKLKVCDKTYQN--CVRKSIIVQVIDENDNEP-IFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTV-YAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEH----KFIMSIDASDKDKGAILRYSL--DEIGR--IYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHT-ATMFVTVTILDQNDNAPQFVHTL------PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKA 2291
            SI V+  L+ E  Q +   + + D   +N  C   ++ V V D+NDN+P +       ++I ES  +G  + +  A D D     K  + F+   +     ++  E+G + L++  S+      L  V + +  L       Y +  +EI + N      + L  ++   Y   IDE   P+  F   +  +  G+      +  +   ++      D E   IRT    D EIL+    +++   SG   + +R  + + + ++N+  PS       +S    +PE+     ++ ++ A D D  A LRY L  D  G+   +F I+  TG I ++   LD E+       +  TD   +  T  T+FV+    D NDNAP F   L      P T   G  F      +IEA D D          R   TY+  +      IF V+ +      + +       Y +T+ A D G P  S ST++ ++VI + +  P     P    +  E RF + + + IG  +  L  
Sbjct: 1681 SISVL-PLDREASQEHLLIIILTDGGSRNDSC---TVRVTVADQNDNKPQLDASTPSELEIAESSRVGDVLHRFRASDMDIGQNGK--FSFELLEDSSGSLDLVPETGDLVLRRLSSLQSWKIKLRVVDHGVPGL-------YVEKNLEISNRNPQTEAKAPLE-FLKQTYLSTIDEGL-PRGQFIAKLQPELAGL------TYSIVEGNIDSAFSVDSEGV-IRTNLELDREILERYSLKVIGTGSGQ-QIGTR--VDVRVNNLNDNVPSF-----PMSKPRRVPENLRVGSYVATVGAKDVDNLAPLRYFLVSDSSGQTPTHFNIDQFTGTIHLT-APLDFEVLPEHTLTIKATDGSFDTFTNLTIFVS----DINDNAPTFSKPLYQTTVSPATFSPGQPF-----AKIEAHDLDA---------RGALTYS--LGQGSSSIFRVAPESG-ALFMKVLPPAGERYLVTVTATDNGVP--SFSTSVPVSVI-IGEAEP--TDKPGFEKA--EFRFEVMENSKIGLQIGNLSG 2155          
BLAST of Protocadherin 11 vs. Ensembl Celegans
Match: fmi-1 (FlaMIngo (Cadherin plus 7TM domain) homolog [Source:UniProtKB/TrEMBL;Acc:A0A0K3AUS4])

HSP 1 Score: 122.479 bits (306), Expect = 1.061e-27
Identity = 140/570 (24.56%), Postives = 254/570 (44.56%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID----ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLS---TRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + V+D NDN P+F    Y V I E+  I   I  V A D D     K  Y   S+  +  +  I+  +G ++L++ +   K S     + A D    ALS T       + I + D+ND+ P +      +     I ++EN    + +  ++  D+D+G N ++  S+      ++     D +   I+T +  D E       ++   D G+P+L +   I +++ D+N+  P+       ++  E +P    I+++ A D D+   + Y ++E  R  F+I      G I+  +  L K  +  V+ ++  TD           V V I D N +AP F +  PF+++  +  +S +      ++A+D D+ + N  I++ +  +   +++          S G+I     +DRE  + +++ + A D  +PP +TST I + + D+NDNS      P   SS   A   IS++  +G+   Q+ A+D D    G + Y  ++  S     Q   L+ TSG L +        +   +L I A D G P L   + + + +   NDN
Sbjct:    4 ITVVDVNDNAPVFASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGL-TIDYSTGEVTLRERIDA-KNSPITAVIRAKDGAQPALSSTVP-----LTINVIDINDHAPTL------IAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSEDFII-----DEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQKITYRIEEADREVFSILDIGDQGAILSVSGEL-KRQDHKVRVEISATDQ--GGLQGRCVVNVFIDDVN-SAPYF-NDHPFSVK--IPEHSPIGYPVITLKAEDHDRGD-NARIVYSIDSSQFFRID---------PSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNS------PQFTSSSYAA--TISEDIPVGTSFLQVSAIDADIGPNGIVDY-FLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDN 529          

HSP 2 Score: 108.612 bits (270), Expect = 1.795e-23
Identity = 124/473 (26.22%), Postives = 213/473 (45.03%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQI------RTIRSFDYEILQL---IEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI----MSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFIT--DSLINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            + + VID ND+ P  +  + ++ + E+  IG+++ +V A D DS       Y  + + +    F I+++SG+I   + L     +RY   V A D  + +       + + ++D+NDN P       +    Y + I E  P  + + ++   D D              +K    + +AD E++ I        I S   E+ +    +  EI   D G   L  R  + + I DVN         F +  F   IPEH  I    +++ A D D+G  A + YS+D     +F I+  +G+I +S+  LD+E  D   F V +T  D    P   +  + V + D NDN+PQF       T+   I  G SF      ++ A DAD     + I+   L+  ++   +   ++F +  + G +     +DRE+ +   L I A+D+G P  S ++ IT+T+ DVNDN+P +
Sbjct:  106 LTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSMEGSED----FIIDEDSGLIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTT-IAVVLKDINDNAPT------FDKKEYNVTISEEMPRGSQIITLKAVDNDED------------QKITYRIEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEISATDQG--GLQGRCVVNVFIDDVNSAP-----YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDS--SQFFRIDPSSGDISVSS-DLDRE--DRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFL-----QVSAIDADIGP--NGIVDYFLNESSSSPSI---QLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTF 533          

HSP 3 Score: 98.9821 bits (245), Expect = 1.635e-20
Identity = 125/464 (26.94%), Postives = 200/464 (43.10%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPD-PYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI------DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPV 2192
            +I V + D NDN P F +K+Y V I E  P G +I+ + A D D      T+   +++  V SI +I  +  ++S+   L   K+  +   V  I A      +    V + I+DVN + P       Y  D P++++I E++P    + ++   D D G NA +     V   D  +  + D     I      D E        +   D  SP L +   I++I+ D+N+  P   ++    +  E+IP     + + A D D G   I+ Y L+E         F ++  +G + +S+  LD+E    +   +F  D      +A   +T+T+ D NDNAP F   +    I E     S + T I A+DAD+ + N  I FR+    +        K+FD+    E   VV I      D E  +N     L    G    S++  + I V DVNDN P 
Sbjct:  207 TIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIITLKAVDNDEDQ-KITYRIEEADREVFSILDIGDQGAILSVSGEL---KRQDHKVRV-EISATDQGGLQGRCVVNVFIDDVN-SAP-------YFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARI-----VYSIDSSQFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDNSPQFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSS-KLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPTFEQLSYDLYIAENSPVGSTVGT-IVARDADEGD-NADISFRIFGGAD-------AKLFDIEEDAEQNGVVRILTRAEFDYEAKANKFFFELQASSGQ--LSSTVPVRIHVSDVNDNKPA 640          

HSP 4 Score: 95.9005 bits (237), Expect = 1.344e-19
Identity = 123/460 (26.74%), Postives = 203/460 (44.13%), Query Frame = 3
Query: 1170 VEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRK-DLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLK--ISAHDHGHPPLKNYATLIINVQQPNDN 2528
            VEI + DVNDN P+      +  D Y + I EN T P  + ++  +D+D G N  V+ S+        L +  +  E+     I + +  I  +I A+    D   PAL S   + I ++D+N+  P++    + ++ +EN+   + +  + A D+D G   I++YS++  G   F I+  +G +I +   LD+E       KV   D        +  + V + D NDNAP F       TI E +   S++ T ++A D D+D+    I +R+         +L     D+  +G I +V    + +D    + I A D+G        N+ I   DVN       S P  N      +  I + + IG  V  LKA D D+ D  +I Y I S+       QF  ++ +SG +S+        R      ++A DH  PPL     + + +   NDN
Sbjct:    2 VEITVVDVNDNAPV------FASDSYNVTILENITIPAVIATVKATDEDFGTNGKVHYSMASSSGIGGLTIDYSTGEVTLRERIDAKNSPITAVIRAK----DGAQPALSSTVPLTINVIDINDHAPTLIAAQKMITLEENVAIGEEVGRVYAIDEDSGPNGIIKYSME--GSEDFIIDEDSG-LIKTTKLLDRETTARYSLKVTARDMGTPSLNTSTTIAVVLKDINDNAPTFDKKEYNVTISEEMPRGSQIIT-LKAVDNDEDQ---KITYRIEEADREVFSIL-----DIGDQGAILSVSGELKRQDHKVRVEISATDQGGLQGRCVVNVFID--DVN-------SAPYFNDHPFSVK--IPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS-------QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTSTQIEVILDDINDN 421          

HSP 5 Score: 90.1225 bits (222), Expect = 8.263e-18
Identity = 88/330 (26.67%), Postives = 152/330 (46.06%), Query Frame = 3
Query:  693 DESMTFQLFVYQYDPDILSIM------VMRSLNYELK-QIYFCKLKVCDKTYQNCVRKSIIVQV-IDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAVVNCSL-RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF----KENIPEHKFIMSIDASDKDKG 1640
            D+ +T++  + + D ++ SI+       + S++ ELK Q +  ++++   T Q  ++   +V V ID+ ++ P F +  + VKIPE  PIG  ++ + A+D D     +  Y   S+      F I+  SG IS+   L    ++ +   V A D  S         +E+ ++D+NDN P       +    YA  I E+ P  T F  +   D D G N +V+  L        +++ + D     +R     D E   +I   I   D G+P+L +   I + + DVN+  P+    FE+LS+     EN P    + +I A D D+G
Sbjct:  252 DQKITYR--IEEADREVFSILDIGDQGAILSVSGELKRQDHKVRVEI-SATDQGGLQGRCVVNVFIDDVNSAPYFNDHPFSVKIPEHSPIGYPVITLKAEDHDRGDNARIVYSIDSS----QFFRIDPSSGDISVSSDLDREDRATFSVIVTASDHASPPLNTS-TQIEVILDDINDNSP------QFTSSSYAATISEDIPVGTSFLQVSAIDADIGPNGIVDYFLNESSSSPSIQLFRLDRTSGTLRVSSKLDREQFAVIVLPIFARDRGTPSLSAASEITLTLSDVNDNAPT----FEQLSYDLYIAENSPVGSTVGTIVARDADEG 563          
BLAST of Protocadherin 11 vs. Ensembl Celegans
Match: cdh-4 (Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI5])

HSP 1 Score: 98.2117 bits (243), Expect = 2.871e-20
Identity = 136/585 (23.25%), Postives = 244/585 (41.71%), Query Frame = 3
Query:  735 PDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSS---------LFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLS----INKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDP-------YAIRIDENT--PPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEM--IKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV--HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI 2408
            P+   + +   L+YE  Q Y  KL       Q       IV + D ND  P F+      KI +S   G+ I  ++A D D++         L  K   G ++      +FNI   +G +SL + +     +N+ ++ +  V   D +       YA + +EI           L  G M  P       Y     ENT      L ++ V      +   +  +         E   +  D +  +I   R  +Y   +  +  ++  D+      S   + + ++D+N+  P     F   S  E+  E   +M + A+D D+   + YSL D     +F+++ R G I ++   L+ +   ++   +  TDS   PH AT  V V I  ++   P+F   H L F++ E     + +  R++  + + DEI  +I+     + ++ +    E+     S G+I    ++DRE+ + + +TI A   G       T +T+ + DVNDN+P +             RF IS++AA+G+ V    A+D+D    G+I + ++    ++       LNE SG L++
Sbjct: 2233 PETGDVTITGQLDYEKTQKYDLKLVATSSGKQVSSEAEFIVLIEDVNDEMPEFIRSDVSAKISDSAITGQFITIMSATDMDTTNSLDEESQKLLYKIVDGDET------LFNISPATGELSLARPVEQDDLVNEDTKKVLNVSVTDGMFTA----YAKLVVEI-----------LRSGSMQPPPRFEQSHYVANALENTIVNKSALLTVAVKGGVPPLQFSLAPTTSSNSSTSKEAWPVAIDRKTGRIHVSRVLNYHRDKRYQIPLVVEDATGRRAFS--TLTLSVIDINDKPPFFVLPFYSTSISESAKEGDTVMMVSATDDDENDTIEYSLLDGSESQFFSVHPRQGTITVAK-KLEHKAGVTLSLTIKATDSANPPHHATTTVEVNIASESVKVPRFSNSHYL-FSVMEDADVGNVIG-RVQQMETEIDEIRFTIVPGSEES-DSFLPFSVER-----STGKIIVKSSLDRERKNQWKMTIRADAAGG--VHAITTVTVDIGDVNDNAPAF--------HGDYERFTISEDAAVGTSVTIFSAMDRDDSPSGRIRFSLVEENPYFD------LNENSGWLTV 2769          

HSP 2 Score: 96.6709 bits (239), Expect = 9.604e-20
Identity = 178/682 (26.10%), Postives = 294/682 (43.11%), Query Frame = 3
Query:  594 LSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDT---GINAVV--NCSLRVRRKDL-LEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIP----EHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-------KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKE-AAIGSIVAQLKALXXXXXXFGKISY---VIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDNL--FSGLNMAIII 2561
            +SE  ++ TS++I  AMD+D S   + + +   +E+  F L     + +   + V   L+ E    Y    +  D+   N      IV V D ND+ P F ++++ + +    P    IL  + KD D S  N + + F    N + +F I+  + ++ LK+   +  K +Y   V A D +  T  K    V+I ++   D+                IR  E    KT+     S K T   G ++++  N + ++   D  + ++     I +++     DYE  Q +E   L I   S   + ++ I ++I ++N+  P I     ++S  EN+P      ++I  I A D D   I    +D+ G + F I+   G + +    LD E+       V  +D       AT+ VTV  +DQNDNAP F               S  S ++   ++   E+ H   FR      N+    + K  DV+S        G +     +D E  S   LT++A+D G PP  T   + I+V+D NDN+P +         E E      KE +  G  V  +KALD D + FG +SY   ++  T +      F  +N    +L I Q  + Y +     LK+ A D G PPL++ A L I+V+  ND+   F   NM  ++
Sbjct: 2721 ISEDAAVGTSVTIFSAMDRDDSPSGRIR-FSLVEENPYFDL-----NENSGWLTVASQLDREKIDHYKLIARATDEGGFNTDLPFTIV-VSDVNDSPPQFEKEEFNIDL--HLPSTSPILHFSIKDDDLSPNNVSQF-FIPKGNEEGVFWIDSNNDLL-LKRPEIVENKMQYQLKVTAFDGVFETSTK----VKINLKSSKDS---------------DIRCPEAN--KTVILAENSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSE--VCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDADFDEIKFRMVDDFGGL-FQIDDINGVVTVVK-PLDSEILGFFNLTVVASDGEFE-DKATILVTV--IDQNDNAPTFEK-------------STYSMKVMESESIGYELAH---FRASGGDQNETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKF---------EKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPF-AINSNGDVL-ISQS-IDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALV 3335          

HSP 3 Score: 84.3445 bits (207), Expect = 5.629e-16
Identity = 129/540 (23.89%), Postives = 238/540 (44.07%), Query Frame = 3
Query:  666 NQKKNYQFFDES------MTFQL-------FVYQYDPDILSIMVMRSLNYEL-KQIYFCKLKVCDKTYQNCVRKSIIVQVIDE-NDNEPIFVEKKYLVKIPESYPIGKK----ILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK---GAILRYSLDEIGR-------IYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQD-KGNPPKSTSTNITITVIDVNDNSP 2189
            N KK      ES      +TF+L       FV  +   I+ +     ++YE  +Q+ F +L + D +    V K +I  VI+  NDN P  +EK   V I E+ P  +     I ++ A+DAD   F++  +    ++    +F I+  +GV+++ + L       +  TV A D     F +D A + + + D NDN P       +    Y++++ E+ +    L     S  D   N  +   L  +  D+   +  + +   +   +  D+E L  ++  ++  DSG P L +   ++I ++D N+  P           KEN    + ++++ A D D    GA+  Y L+ +         + F INS  G++++S  ++D E       KV   D    P  +   + + + D+ND+AP F    +   +QEG +   +L   ++   +D D   +   F +      +++    K F V+ K E+ T   ++  K   Y LT++A+D KG   K+T   +TI +   + ++P
Sbjct: 2924 NSKKGTVVLGESSLLGPNVTFKLSDNDGNVFVVNFRNGIVKVKESDQIDYEKNQQLEFHRLTIQDNSE---VCKELITVVIENLNDNRPKIIEKLLKVSIDENLPTSEDARQYITRIVAEDAD---FDEIKFRMVDDFG--GLFQIDDINGVVTVVKPLDSEILGFFNLTVVASDG---EF-EDKATILVTVIDQNDNAPT------FEKSTYSMKVMESESIGYELAHFRASGGDQ--NETIEYYL--KPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDSGVPPLETEAQVEISVMDENDNAPKFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAV-SYELEIVSETTTDTPVLPFAINS-NGDVLISQ-SIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHRL---LKFSVSDLDGPKNGAPFTV------EIQGDGAKSFKVNEKLELLTAKKLEYRKKDKYLLTVIAKDVKG---KTTDCPLTIFIRQTSRHAP 3426          

HSP 4 Score: 82.0333 bits (201), Expect = 2.527e-15
Identity = 121/492 (24.59%), Postives = 222/492 (45.12%), Query Frame = 3
Query:  828 QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKK---ILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSR-YLFTVYAID---------ALSVTFKKDYADVE------IEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNC---SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAE--ILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF----KENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV--HT---LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEK--IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDN 2183
            +    K + ++++D ND+ P+F   K++ + P    IGK    ++KV A D D     K  Y F S   ++    I   +G I+L   + + KK   +  TV+AID         AL++ F K+   +       I  E  N + P+ S        P  + + E+ P  T+ + +  +D+DTG N  +      +     ++L + +   EI     +     E L++++ +  +  ID+G+P   S K +K+ I DVN   P     F+E+S+     EN    K I  + A+D D G    +++SL  ++      +I+++TG I+    +LD+E  D   F +  +D       +   +T+++ D NDN P+ V  H+   +P  +  G +F S ++        D+D   +S +  LL++      + H    IF  + +        +D  K   + L+I   D G+P  STS ++ + ++D+  N
Sbjct:  471 EKLAEKDVSIEILDSNDHAPVF-SAKWMRQTP--IVIGKPGDVLVKVDATDQDEGENGKIVYKFTSELPLE----INANTGEITL---VEVPKKGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSF------PEIVEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSHEVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNHSP----QFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTG-IVKLLKSLDREDQDVHTFAIIASDEGFPMRVSVTNLTISVEDVNDNPPKCVVQHSRARIPEDLPHG-AFVSCMAA------FDEDIGQNSKLKFLLNSEKVPFRIDHHSGCIFIHAPE------YPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHN 928          

HSP 5 Score: 79.7221 bits (195), Expect = 1.331e-14
Identity = 138/576 (23.96%), Postives = 245/576 (42.53%), Query Frame = 3
Query:  843 KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVS-DKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDV--NEFEPSIRNNFEELSFKENIPEHKFIMSIDASD-----KDKGAILRYS-LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLIN-----PHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIF---DVSSKGEIET--VVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL---SIHQHPLSYGRTLLKISAHDHGHPPLKNYATLII 2504
            K++ +++ D N++ P F E  Y ++I E+   GK I KVTA D D     K  +   +N    S+ +I+ ++G++ L +SL    +  + F + A D      +    ++ I +EDVNDN P   + H         RI E+ P     S   + D+D G N+ +   L    K    +      I+        DY         I   D G P L +   + + +VD+  N       +  +E S  EN      ++ I+A +     K K   L Y  +   G  +F+I+ + G +  +++ LD+E   +    V   DS  +          + V + ILD+ND+ P  V   P  I             ++ +  D D++++     L+     K+E    + F   D++S G I T  +  +DREK S + L +   D G P   ++  + + V+D NDNSP +           +A  + S  +     + ++ A+D D+ +  +++Y I       +G+   +++    I+   +IH    SY    L + A DHG P  +  AT ++
Sbjct:  704 KTMKLRIKDVNNHSPQFDEVSYYLRISENEKPGKDIFKVTANDFDGGNNGKIKFSLGNNQEKSSVISIDAKTGIVKLLKSLDREDQDVHTFAIIASDE-GFPMRVSVTNLTISVEDVNDNPPKCVVQHSRA------RIPEDLPHGAFVSCMAAFDEDIGQNSKLKFLLN-SEKVPFRIDHHSGCIFIHAPEYPLDYHKTPFFNLSIEVADHGDPILSTSCHLHVELVDIAHNHLAIEFDDVAKEASVYENSEIGTEVIMIEAKETGDEQKVKAENLEYRIIGGDGWPHFSIDQK-GTVRTTHL-LDRETKSAYWITVEARDSKTDLYKDPRRRDVLHVFIRILDRNDHRP--VAKKPMYIASVAENSPANVVIVKVEATDADDVDNDAAAPLMF----KIERGDPQSFFRIDLTS-GYITTSGIRRLDREKQSEHELWVSICDGGEPQLCSNVIVIVNVLDENDNSPTFT----------QAIHHYSVRSKFAGKLCRIFAVDADEGENARLTYNIT------EGDARFSIDNNGNIIASEAIHGDE-SYA---LTVQATDHGTPGQQFAATRVV 1242          

HSP 6 Score: 78.1814 bits (191), Expect = 4.191e-14
Identity = 97/425 (22.82%), Postives = 183/425 (43.06%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP-KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEI---YQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRN-NFEELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF------VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLL 1982
            + V++ L+ E+   +   +   D  +++  + +I+V VID+NDN P F +  Y +K+ ES  IG ++    A   D    N+T   +    +V S  N+  ++G+++L + L     S    TV A D+  V   +  A VEI + D NDN P       +  + Y  ++ EN+   + + ++   D D+     V+  L +  +   +       I     +   +S DYE ++    +++  D G P L S   ++I + D N+  P+  + N   L  +     H+ ++    SD D    GA     +   G   F +N +    +++   L+    D     V   D  +   T    +T+ I   + +AP        ++TL   + EG      +  R++A D D+++ N  + F L+
Sbjct: 3068 VTVVKPLDSEILGFFNLTVVASDGEFED--KATILVTVIDQNDNAPTFEKSTYSMKVMESESIGYELAHFRASGGDQ---NETIEYYLKPSDVTSFVNLNAQTGILTLAKPLDFETLSALKLTVVAKDS-GVPPLETEAQVEISVMDENDNAP------KFEKEKYVGKVKENSKSGEKVLTVKALDVDSEHFGAVSYELEIVSETTTDTPVLPFAINSNGDVLISQSIDYEKIKKYNLKVIAKDGGRPPLRSEALLEIHVEDENDHAPTFDDCNMTALVQEGEAIGHR-LLKFSVSDLDGPKNGAPFTVEIQGDGAKSFKVNEKLE--LLTAKKLEYRKKDKYLLTVIAKD--VKGKTTDCPLTIFIRQTSRHAPTMKPMKIQINTLQNELPEG------IIGRLKASDEDEEDQNGLLRFGLV 3469          

HSP 7 Score: 63.5438 bits (153), Expect = 9.772e-10
Identity = 152/657 (23.14%), Postives = 285/657 (43.38%), Query Frame = 3
Query:  768 LNYELKQIYFCKLK-VCDKTYQNCVRKS--IIVQVIDENDNEPIFV--EKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENT-PPKTL----FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEI-------------LQLIEAEILCIDSG-----SPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFK--ENIPEHKFI--MSIDASDKDKGAILRYSLD------EIGRIYFTINSRTGEIIMSNVTLDKEMNDSVK---FKVFITDSLINPHTATMFVTVTILDQNDNAP----QFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNP-PKSTSTNIT---------------ITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVI--MSTESHYQGEQFLTLNETSGILSIH-------QHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            LN ELK  Y   +K +C +   + +  +  I ++VID ND  P+F+  E+ Y  +I +       +L+V A DAD  + +  ++      N    F +E  +G +   +SL   K  +Y   V + D  S  +  D  +V+           ++  +    P P  I +D+    P  L     +  ++ KD+  +A+V   L+   K+     + + E+      +   + +             + L   E     SG      P + + + + I I  + E      +N E+L+ K  E  P  + +  M+++  + D  +++RYSL+          + F I S+ G + +S      ++N S +   FKV  +   IN   A   V++ ILD ND+AP    +++   P  I +       +  +++A D D+ E N  I+++   T    +E+        ++ GEI T+V + + K +++  T+ A D G P  + ++ N+                I     N +SPV+ S P +          ++++A IG++VA+L+A D+D    G I YVI  ++  SH    + LT++E SG +++        +  L      LK+SA D G P   +  T+ + ++  N++
Sbjct:  109 LNRELKDFYDILVKAMCKRRDLSNLETTARIHLRVIDRNDASPVFLVGEQGYEAEIDDDLEPFSTVLRVEASDADIGINSAIYFSL---VNRSHDFIVEPVTGWV---RSLRHVKPGKYSLKVKSEDRASRLYYFDENEVQPSW-----TADVLITVRETKPKPRRILVDQRKINPNILNNRQLAAIITLKDSPNDAIVG--LKGNEKE--HWFEVEPEVVGNDGTKELRWMLYAKNGSQVPKNTNVTLTIGEDYIRRSGFSISKKPVIPTNETVTIQIERLAEHLIRFLDN-EKLTLKTDEMAPIGRILYRMNVNVENPDDVSLIRYSLEYSKSDLPNATLPFAIGSKNGILRVS-----AKINRSERVYNFKVIASLHGINEKLAEKDVSIEILDSNDHAPVFSAKWMRQTPIVIGKP----GDVLVKVDATDQDEGE-NGKIVYKF--TSELPLEI-------NANTGEI-TLVEVPK-KGNSWPATVWAIDLGLPLSRMSALNLMFYKNGTKIPAKPKPIIIQESENKHSPVFSSFPEI--------VEVTEDAPIGTVVAKLQANDEDTGYNGFIRYVIHDIAGSSH----EVLTVDEQSGEITVASDLSKLMKEKLEVLDVQLKVSAIDAGTPVKSSVKTMKLRIKDVNNH 716          

HSP 8 Score: 57.3806 bits (137), Expect = 7.945e-8
Identity = 96/454 (21.15%), Postives = 188/454 (41.41%), Query Frame = 3
Query:  921 PESYPIGKKILKVTAKDADSS-----LFNKTFYGFQSNYNVK---SIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP------PKTLFSIHVS--DKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPAL--LSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV----HTLPF---TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPP 2207
            PE+    +K+ + T  D+        + N   +G  S Y ++   + F +   SG + L   L+  K  + +     ++  S   ++D A V  +I   N + PI      +    Y   I EN P       K+L  + VS  D+D G N +V   +   + +  +M   D     IRT  SFD+E ++     +   D G P    L    I + ++D N+  P   +N  ++S          +    A D D    LRY + +   + F+++S+TG++++ +     +M      +VF+TD      +A+  + ++ +   ++  +F     HT      T+  G    S  +          D+++H   F +++ +  +   +H     +SS G     + +DREK +   L + A+     P      + + + ++ND +P+++  P
Sbjct: 1568 PETAKFDRKVYQTTLYDSTRPGTPVLVLNALHHGTVS-YKLEPNCTFFEVHTLSGAVHLATWLTKLKHRKSVECTAIVE--STEGQQDIAKVIAKIIRTNQHSPI------FRRQVYRGTIRENMPTGSSVLSKSLLPLVVSAIDEDPGSNGLVGYRMLSPKDE--QMFSVDQYSGAIRTQMSFDFEKMKEYSFYVQAFDMGQPPRRSLMPSLIVVTVIDENDEPPRFPSNSLDISMILPTANGVSVGGQTAQDMDSVGSLRYFIKD-QSVPFSVDSKTGDVLVKDSNGISDMTKLFDLEVFVTD---GKQSASYVMKISTISTENSKFKFTRNEYHTSLIENTTLPPGSIILSVATI--------GDKLDH---FSIVNPH--EAFFIHPGTGVISSSG-----IALDREKSAIIRLVVQAKSHEKNPVMARALVVVGIENINDETPIFMGTP 1988          
BLAST of Protocadherin 11 vs. Ensembl Celegans
Match: hmr-1 (Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Prot;Acc:Q967F4])

HSP 1 Score: 87.4261 bits (215), Expect = 5.236e-17
Identity = 132/523 (25.24%), Postives = 219/523 (41.87%), Query Frame = 3
Query: 1065 ISLKQSLSINKKSRYLFTVYAIDALS-VTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP---------KTLFSIHV--SDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKA-------IKIIIVDVNEFEPSIRNNFEELSF----KENIPEHKFIMSIDASDKDKGAILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT--IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSN---YTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSG----ILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + + + L   + + Y  T+ A D  S V   K +    +E+ DVND  P  ++      D +   IDE   P         K + ++    +D D   N V    +     +  +  + D    +I     FD E + +    +   D    AL            ++I+I DVN+  PS    FEE  +    KE+  E   +++I A D DK + LRY L     GRI F + + +G I +    LD E +D     +  +D     H AT  V + I D NDNAPQF      T  I+E +    K+   + A DAD+DE +  I++RL            +++F +    G IE V  +DR+  +    +   + A D          ++ + V D+NDNSP++  P  L     E R  I  +  +  +  Q +  D    +   I Y I+  +    GE    +++ +G    + S+ +   S    ++++ A+D G P  + +A + I V   NDN
Sbjct: 1164 VVIMEGLDYEQVNNYTLTLTATDMTSRVASTKTFV---VEVRDVNDVVPQFTV------DLFTGTIDEEMTPNEHLEKTNGKPIVTVKAIDTDSDGPQNEVHYRIVGEANGEETKHFRIDELTGEIFPNEKFDREKIDMYILTVEASDRSVSALPGANGPNKDNVKVQIVINDVNDNAPS----FEEQKYIGRVKESEGEGHDVITIKAHDLDKHSNLRYHLIGAGGGRIPFGVRTDSGTIFVKE-PLDFEASDQYHLVLIASDGR---HNATTNVYIHIEDVNDNAPQFEQQKYATTVIEEDVDI-PKVLFNVHATDADQDEKSSRIVYRLEGQG-------ADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPIF--PERLFGYIEENREPIHSDG-VYFMDVQARDFDDPTTENANIEYGIVRNK-LINGESVFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDN 1657          

HSP 2 Score: 74.3294 bits (181), Expect = 4.855e-13
Identity = 93/368 (25.27%), Postives = 153/368 (41.58%), Query Frame = 3
Query:  840 RKSIIVQVI--DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP--PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAE---ILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF---KENI-PEHK---FIMSIDASDKDKG---------AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKF--KVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT 1868
            + ++ VQ++  D NDN P F E+KY+ ++ ES   G  ++ + A D D    +   Y        +  F +  +SG I +K+ L      +Y   + A D           +V I IEDVNDN P       +    YA  + E     PK LF++H +D D    +      R+  +   E+ +       I  +++ D +    + +    +  ID     L+    +++ + D+N+  P     F E  F   +EN  P H    + M + A D D            I+R  L   G   F I+  TG+I     +LD+E++   +F  +V   D  +        VT+ + D NDNAP F  T
Sbjct: 1316 KDNVKVQIVINDVNDNAPSFEEQKYIGRVKESEGEGHDVITIKAHDLDK--HSNLRYHLIGAGGGRIPFGVRTDSGTIFVKEPLDFEASDQYHLVLIASDGR----HNATTNVYIHIEDVNDNAP------QFEQQKYATTVIEEDVDIPKVLFNVHATDADQDEKS-SRIVYRLEGQGADEVFRIGKYSGTIELVKALDRDPPAGVPSWNFVVQAIDDDGNGLVGYADVQVNVRDINDNSPI----FPERLFGYIEENREPIHSDGVYFMDVQARDFDDPTTENANIEYGIVRNKLIN-GESVFRIDQNTGKIFAMR-SLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKT 1664          

HSP 3 Score: 72.7886 bits (177), Expect = 1.751e-12
Identity = 124/537 (23.09%), Postives = 216/537 (40.22%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYE---LKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS-NYNVKSIFNIEKESGVISLKQSLSINKKSR----YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAE------ILCIDSGSPALLSRK------AIKIIIVDVNEFEPSIRN--------NFEELSFKENIPEHKFIMSIDASDKDKGA------ILRYSLDEIGRIYFTINSRTGEIIMS-NVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRI------EAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPK-STSTNITITVIDVNDNSPVWVSPP 2207
            ++ DP    I + R L+++   L +++  KLKV  +         + +++ D NDN P F    Y  ++ E  P+ + ILKVTA D D+   ++  Y   + N+++ S       +G IS K  L  ++ +     Y F V A D          A + I  E+ ND   +      Y    +     +   P        +D+D    + ++ + R  +K  L  I     + ++R           L EAE      ++  D GS  +   K       + I I DVN  +P   +           E ++K + P    I+ ++A+D D  A       L Y+  E  R  F I+ +TG +  S +V  D+E        V  TD    P       +V ++D NDN+PQF      + +  +S +  + T +      +   A   EI +S+         ++ +L   ++ +  S GEI  +  I   K   +   ++A D G P    +S  +T+ V+D    +P W + P
Sbjct:  585 FRIDPSTGIIHLTRLLDFDDPALPKLH--KLKVTAREDNRESHVDLTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHNFSINS-------NGEISAKVRLDADQLNERHFVYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYT--AFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLR----HGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPT---IVKVEATDDDSSANGDIVYSLYYTQSE-SRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQFERP---SYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRS-GEITLIKPIPM-KTQKFIFNVIADDNGIPEALQSSAQVTLNVLDKQQKAPKWQTSP 1097          

HSP 4 Score: 64.6994 bits (156), Expect = 4.287e-10
Identity = 115/491 (23.42%), Postives = 204/491 (41.55%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVE-KKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK-SIFNIEKESGVISLKQSLSINKKSRY-----LFTVYAIDALSVTFKK----DYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRS--FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI----MSIDASDKDKG--AILRYSLD---EIGR-------IYFTINSRTGEIIMSNVTLDKEMNDSVK---FKVFITDSLINPHT--ATMFVTVTILDQNDNAPQFVHTLP-----FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYN--NKMELLHEKIFDVSSKGE-IETVV--TIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP 2189
            I ++  + ND   +F+   +Y   + E    G  ++++ A+DAD      +F         K ++F+I++ +G++ L+  +S    +       L  +   D     +       YA + I IEDVN+N P       Y      +     T P T+  +  +D D+  N  +  SL   + +  +    D +   +       FD E     +  +   D G   L+      + +VD+N+  P     FE  S++ ++   + +    +++ A D D    A + YSL+     G         +  +N R+GEI     TL K +    +   F V   D+ I P    ++  VT+ +LD+   AP++  T P      T+ E +   +K+  R  A  +  D  N  +I++L  +    NK E    +     +  E +E V+   +D E+ +NYTLT+ A D  +   ST T   + V DVND  P
Sbjct:  733 IHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPVIQIQARDADRDEVTYSFMDKNGRSTQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPINLTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEFPDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQSESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDNSPQ----FERPSYETSVSRFEAVGTSVITVFAFDNDAAHNAEITYSLEIDTTAGEEHQNDLDFFELVNRRSGEI-----TLIKPIPMKTQKFIFNVIADDNGI-PEALQSSAQVTLNVLDKQQKAPKW-QTSPDCKPGITVDENVEL-NKVILRCRAVSS-GDSRNSDVIYKLTASGGPGNKAESKFRQFNKFENGNEWVEVVIMEGLDYEQVNNYTLTLTATDMTSRVASTKT-FVVEVRDVNDVVP 1209          

HSP 5 Score: 61.6178 bits (148), Expect = 3.974e-9
Identity = 76/320 (23.75%), Postives = 141/320 (44.06%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYEL--KQIYFCKLKVCDKTYQNCVR-KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTF---YGFQSNYNVKSIFNIEKES--GVISLKQSL---SINKKSRYLFTVYAIDALSVTFKKDY-ADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIH-VSDKDTGINAVVNCSLRV-RRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKF-IMSIDASDKD 1634
            V++ D +   I  MRSL+ E+  ++ +  +++  D+   +     ++ ++V D NDN P F + +Y   + E+ PIG  ++  +A DAD    +  F      +S+Y   +     K+S  GV+ +KQ L    + ++  +   +   D      + D  A V + + D ND+ P I   HG        R+ E+ P  T    +  +D+D G  A      R+ R+ D       D +   +R   + D E + +    I   D+ +   + R+ + + + DVN+  P          F+EN P ++     I A+D+D
Sbjct: 1601 VFRIDQNTGKIFAMRSLDREISSEREFIIEVRANDRGVPSREGFANVTIKVTDMNDNAPFFEKTRYEGSVEETAPIGAAVMSFSAFDADEEAKDNVFTYQLSEESDYFYVTTDKDSKQSSVGVLRVKQPLDYEDVTQRDGFHLGIRVSDG-----RHDAEAAVHVALVDRNDHAPHI---HGATEH----RVREDVPRGTSIGRYTATDRDAGDTA----RFRINRQSDPKRQFTIDQD-GTLRVAHTLDREDIAVYNLIIEAYDNSNN--IGRQMVAVYLQDVNDNGPEPYTVPRPCIFRENTPVNQLGTCEIRATDRD 1901          

HSP 6 Score: 54.299 bits (129), Expect = 5.949e-7
Identity = 89/363 (24.52%), Postives = 161/363 (44.35%), Query Frame = 3
Query: 1506 IKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH------TATMFVTVTILDQNDNAPQFVHTLPFT--IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMEL--LHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGN----PPKSTSTNIT--ITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL----SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + I I DVN+  P+          +E+IP ++ I+ + A DKD G  + + YS+D      F+INS  GE I + V LD +  +   F V+  +     H      +++  + +   + ND +  F+ T  +T  + E     + +  +I+A+DAD+DE+ +S + +   +   KM L  + E    V  +  +      + E   N  LT++ QD G+    P K+ ++  T  I + DVN+N P +   P        A+            + +++A D D    G I Y +  T+S  +  +   ++  +G+L+   H +    +  R  + + A D G  PL  +    + V   NDN
Sbjct:  628 LTIRIDDVNDNVPTFTRPLYTAQVREDIPLNQTILKVTAVDKDTGDNSRITYSVDNHN---FSINS-NGE-ISAKVRLDADQLNERHF-VYRFNVTARDHGEPVSLSSSAMIHIRTENTNDESAVFLPTSQYTAFVAEDAQGGTPV-IQIQARDADRDEVTYSFMDKNGRS-TQKMNLFSIDEHTGLVKLRHGVSAADLAEAENPIN--LTVIVQDDGSCCVYPSKTHTSYATLLIGIEDVNNNKPEF---PDCAKYSDIAKIMEGTYKTDPPTIVKVEATDDDSSANGDIVYSLYYTQS--ESRKAFVIDRQTGVLTPSPHVVFDRETRPREDVTVKATDRGDRPLIGFCQFSVEVVDINDN 975          
BLAST of Protocadherin 11 vs. Ensembl Fly
Match: ft (gene:FBgn0001075 transcript:FBtr0077478)

HSP 1 Score: 189.504 bits (480), Expect = 3.635e-48
Identity = 179/669 (26.76%), Postives = 315/669 (47.09%), Query Frame = 3
Query:  600 EKISINTSISIDGAMDKDFSKINQKKNY---QFFDESMT-FQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQ-NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF---QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENT-PPKT--LFSIHVSDKDT-GINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLIN-PHTATMFVTVTILDQNDNAPQFVHT-----LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSS---EPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLL---KISAHDHGHPPLKNYATLIINVQQPNDN 2528
            E ++INT +    A+D D  + N   +Y   +  DE M       +  +P    + V+ +L+ EL+  Y   +   D+          ++++++DENDN P+F  K+Y   + E+  IG  +L+V+A D D     +  Y       N++    F+I +++GV+ + ++L+  + SRY  TV A D        D A++ I I D+NDN P       ++  PY  R+ ENT PP    + +++  D DT  +N+ V   L+    DL  +  +  +I     ++  D E        ++ +D+GSP L     +++ + D+N+ +P         + +EN+P    +++  A+DKD+G  A LR++L       F I+S TGEI  +  TLD+E        +   DS I  P  +++ +T+++ D NDN P+F  T     +P  I +G   +   +  ++  D +   ++++I  R  H ++     ++ K   VS+K E++T        D  YT+ I A D+G   +S S+   +TVI         + PP L  +      + F +S++   G ++ ++ A    +   GKI Y I        G+  L ++  SG+LS+ Q  L Y  T L    I A D   P L++   + +NV   NDN
Sbjct: 2177 ENVAINTVVIAVKAVDNDEGR-NGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD----FSISEDTGVVRVAKNLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPT------FLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSDLFRINASSGDIA---LLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHRFHIDSETGEISTA-TTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIPKFDSTTYNVAVPERISKGEFVFGARA--LDLDDGENAVVHYTISGRDQHYFD-----INTKTGVVSTKLELKT--KTKSHDDLTYTIVISAMDQGE--QSLSSKAELTVI---------LRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAIAGG---IMGDS-LRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDN 2806          

HSP 2 Score: 153.68 bits (387), Expect = 4.428e-37
Identity = 147/562 (26.16%), Postives = 259/562 (46.09%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESM--TFQLFVY---QYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII---VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNK-TFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYAD--------VEIEIEDVNDNYPIISLLHGYMPDPYAIR-IDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIK----ADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSP 2189
            I  SE  +  T + +D A D D  +      Y+    ++   F+L        D   L +    +L+ E +  Y  +L +  +   +  R   +   V ++D NDN PIF    Y V + E+   G  ++ V A D D    +K T+Y  ++ +     F +  E+GVIS  + ++  +++    +      +   F +D+          V + + D ND+ PIIS    + PD   +  +DEN    T+ + + V D D+G+N     S+R+   + L   +    AD+ I ++  +   D E +      ++ +D G+PA  +   + I + DVN+ EP    +       E  P   F+ SI A+D+D G  A + Y +     + +F+++  TG +I++   LD+E+ D+V+  +   D   NP  A   + V ILD+ND APQF            +    +   + A D D+   N S+ F L  +    +E L+   F + +  G++ T   +DREK S Y ++++A+D+G P P+S +  + + V DVNDN P
Sbjct:  163 ISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSY--QLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQ----FTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFR--FFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNG--RTSVRIVSGNELGHFRLEEAADLHIVRVNGV--LDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELKWFSMDPLTG-LIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQFSQREQNVTLGEDAPPQTIVALMTATDHDQG-TNGSVTFALAPS----VERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDP 706          

HSP 3 Score: 137.502 bits (345), Expect = 4.254e-32
Identity = 159/595 (26.72%), Postives = 261/595 (43.87%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISL--LHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIY-----------FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITD--SLINPHTATMFVTVTILDQNDNAPQFV-HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLK-----ISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGM 2567
            +++ V  EN + P F    Y V +PE+ P+G  IL V A D D+       Y   S  N +  F++++ +G I ++Q L  +    Y   +   D L        A + I + DVNDN P+ +    H Y+P        EN P  T +F  H +DKD+  NA+++ +      D    I  +     I +  SFDYE  ++   +I   +  S ++ S   + + ++ VNEF P            E       + ++ A+DKD G        E GR+Y           F I++ TG I ++   LD+E  + V   V   +  S+    T    V ++I D ND  P+F+ H    TI E     +K++T ++A D D    N+   + +++       L      DV + GEI T   +DRE+ S Y L I A D G PP++ S  + I + DVNDN P + +P  LN    E       E A  SI+  + +      + G  +Y ++  +     + +L+++  SG++   +   S+ R +       I   D G P  K+   L I V   NDN  +  ++ I + +
Sbjct: 3215 VVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSI-SGGNERQDFSVDERTGGIVIQQQLDYDLIQEYHLNITVQD-LGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIP--------ENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFI-MNQSNGTISSAVSFDYEERRIYTLQIKAKNPDS-SMESYANLYVHVLGVNEFYPQFLQPVFHFDVSETSAVGTRVGAVQATDKDSG--------EDGRVYYLLVGSSNDKGFRIDTNTGLIYVAR-HLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND-PPEFIKHYYTSTISEAAPVGTKVTT-VKAIDKDVRTQNNQFSYSIING-----NLKQSFKIDVQT-GEISTASRLDREETSTYNLVIGAIDTGLPPQTGSATVHIELEDVNDNGPTF-TPEGLNGYISE------NEPAGTSIMTLIASDPDLPRNGGPFTYQLIGGKH----KSWLSVDRNSGVV---RSTTSFDREMTPILEAIIEVEDSGKPKQKSQHLLTITVLDQNDNPSTTRSLHIAVSL 3766          

HSP 4 Score: 127.872 bits (320), Expect = 3.698e-29
Identity = 169/697 (24.25%), Postives = 290/697 (41.61%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVI-DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEIL------------------------QLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITD-SLINPHTATMFVTVTILDQNDNAPQFVHTLP-FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHY-QGEQFLTLNETSGILSIHQHPLSYGRTL-LKISAHDHGHPPLKNYAT---LIINVQQPNDN--LFSGLNMAII 2558
            I L E  ++   I +    D+D + +N + +Y   +         ++  P    + + R +  E   +   +L   D        K  +  +I D ND+ P+F    Y   +PE+  +  +   + A D D     +  Y      N + +F +  + G + ++  L   ++  Y  TV   DA   + +     V I + D NDN P       +    +   I EN P  T    +   D+D G NA ++ +L  + +D       D     I+T+R FD E L                         L+EA +   D+G P L  +  +K+I+ DVN+  P        ++  E   E   I  +   D D+G    + YSL   +E G+  F ++S TG++ +    LD+E  +     V   D +L +P ++   +T+ +LD+NDNAP+F  +    ++ E     ++L  R  A DAD+  +N  ++F +  +  N+ +  H      S  G +     +D E  ++YTL I A D G P  ST+    + V+D NDN P++ S   +          I +   + + +  + A D D    GK+SY I   E    QG  F    ET  I ++ +       T  L + A D   P  +  +T   + + V+  NDN  +F  +N AI+
Sbjct:  952 ISLPENAAVGQEIYLSRVRDRD-AGVNSRISYSLTNNPNQ----QFRIGPVTGVLYLQRPIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDLGDNGRISYEIIEG-NTERMFGVFPD-GYLFVRAPLDREERDYYALTVSCRDAGQPS-RSSVVPVVIHVIDENDNAP------QFTNSTFTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDF----TIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATV--SDNGIPRLQDKVKVKVIVTDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKGNEAGQ--FNLDSATGQLSLGR-RLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTEL-MRFRASDADQG-VNSQVVFSI--SAGNRRDTFHID----SITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVR--------QIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAIL 1609          

HSP 5 Score: 124.79 bits (312), Expect = 3.311e-28
Identity = 158/634 (24.92%), Postives = 277/634 (43.69%), Query Frame = 3
Query:  774 YELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFK----ENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKV------------------------------------FITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLL-HTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHG-HPPLKNYATLIINVQQPNDN 2528
            YE+ ++Y   L    +T +  VR    V V+D+ND+ P F++  ++  + E   IG  I  + A D D+ L + TF      ++ K  F +E  +G + L  +L    KS+Y   +   D   V + + YA   I++ D NDN P+      +    Y+  I EN      +  I   D D G NA    S  V      ++   + +   +      DYE +Q     +   D+G P+L +   +   ++D+N+  P     F+ +S+     EN+P    ++++ A D D G   ++ YS+   G +       +   I +   LD+E   +    V                                    F+        ++T+ VT+ I D ND  P F+      I E ++  + +   I  K  D DE  +  I  L+    +  M       F ++ + G++  V  +DRE  S+Y L I A+D+G PP+ST + + I ++D NDNSPV+  P   ++S       +++ A+IG++V Q+ A D D+   G+I Y I+  + ++      +++E +G++ + ++ L+Y    R  L + A D     P  + A L IN+   NDN
Sbjct: 1789 YEV-EVYAIALGGQPRTSRTKVR----VTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDT-LGSVTFL-LMDGHDGK--FLLEPSTGKLILNDTLDRETKSKYELRIRVSDG--VQYTEAYA--TIQVSDTNDNPPL------FEDTVYSFDIPENAQRGYQVGQIVARDADLGQNA--QLSYGVVSDWANDVFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPI----FDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSI-TAGDVDSEFGIDSNGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVKVTILIKDVNDEVPVFISANETAIMENVAINTVV---IAVKAVDNDEGRNGYIDYLMKEARDEDMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVF-DPKQYSAS-------VAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHD----FSISEDTGVVRVAKN-LNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDN 2380          

HSP 6 Score: 124.02 bits (310), Expect = 5.362e-28
Identity = 153/651 (23.50%), Postives = 276/651 (42.40%), Query Frame = 3
Query:  639 AMDKDFSKINQKKNYQFFDE--SMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEM------IKADMEI-YQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAI--LRYSLDEIGRIY---FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAP---QFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            A D D   +N +  Y F  E  S  F++     D     I +++ L+ E +  Y   L   D          I+ V+V D NDN+P+F  + Y   + E+ P G  +L   A D D  L  K  +     +  +  F+I+ E+G IS   +L   + S Y  T+ A D+     +    ++ I + DVNDN P       +    Y + + E  +  + +F     D D G NAVV+ ++  R +   ++      +   +E+  + ++     Y I+      I  +D G  +L S+  + +I+     F           +  E++   K I  + A+   KG +  +RY++   G I      ++  +G + +    LD E+    +  +   D       +   +T+ + D NDNAP   Q ++      +E      +L   ++A D D  + N ++I+RL + ++          F+++  GEI T + +DRE+  +Y   + A D+G P  + + ++ + ++D NDN P +    SL         N+++ A IGS V ++ + D D       SY      S   GE+F  +   SG +++  H         +LK+ A D      +    + I +Q  NDN
Sbjct: 2410 AYDADTPPLNSQVRY-FLKEGDSDLFRINASSGD-----IALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVFELQSYHATVRENLPSGTHVLTPRATDKDEGLNAKLRFNLLGEHMHR--FHIDSETGEISTATTLDREETSVYHLTLMAQDSSITEPRASSVNLTISVSDVNDNIP------KFDSTTYNVAVPERISKGEFVFGARALDLDDGENAVVHYTISGRDQHYFDINTKTGVVSTKLELKTKTKSHDDLTYTIV------ISAMDQGEQSLSSKAELTVILRPPELFPTFAYMANSHFAMSEDVRPGKMITKVSATSPKKGLVGKIRYAI--AGGIMGDSLRVDPNSGLLSVGQDGLDYELTHLYEIWIEAADGDTPSLRSVTLITLNVTDANDNAPVMEQLIYNAEVLEEESPP---QLIAVVKASDRDSGD-NGNVIYRLQNDFDG--------TFEITESGEIYTRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFSL---------NVTENAEIGSFVIRVTSSDLDLGANANASYSF----SENPGEKF-RIEPQSGNITVAGHLDREQQDEYILKVVASDGA---WRAETPITITIQDQNDN 3009          

HSP 7 Score: 123.25 bits (308), Expect = 9.061e-28
Identity = 144/549 (26.23%), Postives = 238/549 (43.35%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIV--QVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDA----------------------------------------LSVTFKKDYADVEIEIEDVNDNYPI-ISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIY-------QIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRYSLDEIGRIY-FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITD-SLINPHTATMFVTVTILDQNDNAPQFVHT--LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            V+  +P    + +   L+YE  Q Y   ++  D   Q  +  +I V   V+D NDN PIF    Y  ++ E+ PI  +++ V+AKD DS       Y   +  +V S F I+  +G I  +++L    +S Y  TV A D                                         LS T K     V I I+DVND  P+ IS     + +  AI    NT    + ++   D D G N  ++  ++  R +  +M ++D   +       Q+R + + D E+       I   D G P   +   + I I+D N+  P         S  EN      ++ + A+D D+GA   +RYS+    + + F+I+  TG + ++   L+ E        V   D +L NP   T  +T+ ILD NDN P F+ +  L   ++  +         + A DAD   +N  + + L    ++        +F + +S G+I  +  +DRE+ S YTLT++A D G+PP + +  + + V D+NDN PV+
Sbjct: 1969 VFSLNPQTGMLTLTARLDYEEVQHYILIVQAQDNG-QPSLSTTITVYCNVLDLNDNAPIFDPMSYSSEVFENVPIATEVVTVSAKDIDSGNNGLIEYSITAG-DVDSEFGIDS-NGTIRTRRNLDREHRSTYTLTVTARDCADEFASFSELEETQLKLKYRSPRKYQQTRQEFLAHQKQQRLSSTVK-----VTILIKDVNDEVPVFISANETAIMENVAI----NT---VVIAVKAVDNDEGRNGYIDYLMKEARDE--DMGQSDPLPFSLNPTDGQLRVVDALDRELRSSYLLNITARDRGEPPQSTESQLLIRILDENDNSPVFDPKQYSASVAENASIGAMVLQVSATDVDEGANGRIRYSIVLGDQNHDFSISEDTGVVRVAK-NLNYERLSRYSLTVRAEDCALENPAGDTAELTINILDINDNRPTFLDSPYLARVMENTVPPNGGYVLTVNAYDADTPPLNSQVRYFLKEGDSD--------LFRINASSGDIALLKPLDREQQSEYTLTLVAMDTGSPPLTGTGIVRVEVQDINDNDPVF 2491          

HSP 8 Score: 121.324 bits (303), Expect = 3.508e-27
Identity = 170/675 (25.19%), Postives = 291/675 (43.11%), Query Frame = 3
Query:  612 INTSISIDG---AMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQ-------IYFCKLKVCDKT----YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRV--RRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRYSLDEIG--RIYFTINSRTGEIIMSNVTLDKEMND--SVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDA-DKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQD----KGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKAL-XXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +  SI++ G   A D+D    N   +Y     S  F +     DP    +   +++ ++  Q       +Y   +   D      Y  C+   + + ++D ++N P F + +YL  +P+    G++I++V A D      N+  Y   + +N+ SIF++ +  G I+L + + +   +RY   V A D   V  + D   V I +   N + P  S+      + Y + + EN P   T+ ++  +D DTG N ++  S+     R+D       D     I   +  DY+++Q     I   D G   L S   + II+ DVN+  P   +        EN P   F+    A+DKD  K AI+ Y+    G  R +F +N   G  I S V+ D E     +++ K    DS +  + A ++V V  L  N+  PQF+     F + E     S + TR+ A  A DKD      ++ LL   +N      +K F + ++ G I     +DRE  +   LT++A++    +GN   +    + I++ D ND       PP        +   IS+ A +G+ V  +KA+    +    + SY I++       +Q   ++  +G +S       +   +Y    L I A D G PP    AT+ I ++  NDN
Sbjct: 3025 LQQSIALVGQIIATDRDKQGPNSVISYSLQQPSPMFSI-----DPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECL---VNINIVDAHNNPPKFEQAEYLAPLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMT-FNLSSIFSVGRHDGWITLVKPIQVPPNTRYELVVRATDR-GVPPQSDETRVVIVVTGENMDTPRFSV------NSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDF----SVDERTGGIVIQQQLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVFQAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQSNG-TISSAVSFDYEERRIYTLQIKAKNPDSSMESY-ANLYVHV--LGVNEFYPQFLQPVFHFDVSE----TSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN------DKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGN--DTDEAQVIISIQDGND-------PPEFIKHYYTS--TISEAAPVGTKVTTVKAIDKDVRTQNNQFSYSIINGNL----KQSFKIDVQTGEISTASRLDREETSTYN---LVIGAIDTGLPPQTGSATVHIELEDVNDN 3647          

HSP 9 Score: 118.627 bits (296), Expect = 2.162e-26
Identity = 157/593 (26.48%), Postives = 254/593 (42.83%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF---QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYAD--VEIEIEDVNDNYPI-ISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQI-RTIRSFDYEILQLIEAEI---LCIDSGSPALLSRKA-----IKIIIVDVNEFEPSIRNNFEELS-----FKENIPEHKFIMSIDASDKDKGAILRY---------SLDEIGRIYFTINSRTGEIIMSNVTLDKEMN-DSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT--IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            V V+D+NDN PIF     + +I E  P+   I+ VTA D DS L  K  Y     +        F I  E+GVI   + +       +  TV A D    + ++   +  V + +ED+NDN P+ +S+    +P  ++     +T    +  +H  D D+  N +V            E++    E++++ R      +      + E+   L + S   A+ S +      I II       E S+   FE+ S       EN P    I+++ A      A + Y         S  ++ R+ F I+++ G I+ +   LD+E   +  + +V+       P T+   V VT+LD+ND+ PQF+ T PF   + E L     +ST + A D D      S+ F L+  ++ K  L         S G++    T+DRE  S Y L I   D     + T    TI V D NDN P++         +    F+I + A  G  V Q+ A D D     ++SY ++S  ++       +LN  +G+L++    L Y      +L + A D+G P L    T+  NV   NDN
Sbjct: 1477 VLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSST---AVMQVHAKDADSSSNGLVT----------YEIVSGPQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQ-FEQRSKLSGSVYENEPIGTSILTVTA--HLASAEIEYFVTNVTATGSRGQVDRL-FDIDAKLG-ILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDT-PFVYNVSEDLQIGHTIST-LRAHDPD---TLGSVTFLLMDGHDGKFLL-------EPSTGKLILNDTLDRETKSKYELRIRVSDG---VQYTEAYATIQVSDTNDNPPLF--------EDTVYSFDIPENAQRGYQVGQIVARDADLGQNAQLSYGVVSDWAN----DVFSLNPQTGMLTLTAR-LDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDN 2023          

HSP 10 Score: 110.923 bits (276), Expect = 5.087e-24
Identity = 125/565 (22.12%), Postives = 241/565 (42.65%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCV--RKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIR-IDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEM--IKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPA---LLSRKAIKIIIVDVNEFEP---SIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFI--TDSLINPHTATMFVTVTILDQNDNA-----PQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELL------------HEKIFDVSSK-GEIETVVTIDREKD-SNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIM 2339
            + + R L+ E ++I+   +   D   ++ +    SI + V+DENDN P F +    V + E+ P G ++++  A DAD  + ++  +   +  N +  F+I+  +G + L + L     + Y   + A D  + +         + + D NDN PI        P    +R I E  P KT + ++   D D+G+N  V+ ++  +   L +      + E   I T+R  D E +      ++  D   P+   L + K + +I+ D+N+  P   S+        F  +      +M + A D D     ++ Y +    +  F +   TG I     T   +    V++++ +  TD  +     +  V +TI+           PQF               SKLS  +     + + I  SI+    H  + ++E               +++FD+ +K G + T   +DRE     Y + + A   G  P+++ T + +TV+D ND+ P ++  P +        +N+S++  IG  ++ L+A   D D  G +++++M
Sbjct: 1335 LSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAPEFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAG-NRRDTFHIDSITGSLYLHKPLDYEDITSYTLNITASDCGTPSLSTTVL-YNVLVVDDNDNPPI-------FPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSGPQELFKLQRNTGIITF---TPGPQFKQEVRYQLTLKSTDEAVQSERRSSEVYITIITPGSGGSESSVPQFEQ------------RSKLSGSV----YENEPIGTSILTVTAHLASAEIEYFVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFV--------YNVSEDLQIGHTISTLRA--HDPDTLGSVTFLLM 1861          

HSP 11 Score: 110.923 bits (276), Expect = 5.351e-24
Identity = 135/538 (25.09%), Postives = 236/538 (43.87%), Query Frame = 3
Query:  939 GKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVY--AIDALSVTFKKDYADVEIEIEDVNDNYPII-SLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILR--YSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIE-TVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPN 2522
            GK I KV+A      L  K  Y         S+  ++  SG++S+ Q   ++ +  +L+ ++  A D  + + +     + + + D NDN P++  L++       A  ++E +PP+ +  +  SD+D+G N  V   L+       E+ ++  EIY   T    D E +      +  +D G P +    ++ + ++D N+  P     F  L+  EN     F++ + +SD D GA     YS  E     F I  ++G I ++   LD+E  D    KV  +D      T    +T+TI DQNDNAP+F H+   F+  E L     L  +I A D DK   N  I + L     + M  +     +V SK  +        R  ++ Y LT+LA D G PP  +   + I ++D ++N      PP    +E  A   + ++A  G  + ++ A D+      ++ Y +M+    +      ++    G +++ + P+      R  L + A D G PP  +   ++I V   N
Sbjct: 2720 GKMITKVSATSPKKGLVGKIRYAIAGGIMGDSL-RVDPNSGLLSVGQD-GLDYELTHLYEIWIEAADGDTPSLRS-VTLITLNVTDANDNAPVMEQLIYN------AEVLEEESPPQLIAVVKASDRDSGDNGNVIYRLQNDFDGTFEITESG-EIY---TRMRLDREEIGDYAFVVEAVDQGVPHMTGTASVLLHLLDKNDNPPKFTRLFS-LNVTENAEIGSFVIRVTSSDLDLGANANASYSFSENPGEKFRIEPQSGNITVAG-HLDREQQDEYILKVVASDGAWRAETP---ITITIQDQNDNAPEFEHSFYSFSFPE-LQQSIALVGQIIATDRDKQGPNSVISYSLQQP--SPMFSIDPATGEVFSKKAVRFKHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNN------PPKFEQAEYLA--PLPQDAVRGQRIVRVHANDKQDLGTNEMDYSLMT----FNLSSIFSVGRHDGWITLVK-PIQVPPNTRYELVVRATDRGVPPQSDETRVVIVVTGEN 3223          

HSP 12 Score: 110.538 bits (275), Expect = 6.499e-24
Identity = 145/626 (23.16%), Postives = 278/626 (44.41%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTF-YGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFT---VYAIDALSVTFKKD--YAD--VEIEIEDVNDNYPIISLLHGYMPDPY-AIRIDENTPPKTLFSIHVSDK-DTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIG-RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-----LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSII-FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTST--NITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHG--HPPLKNYATLIINVQQPND 2525
            ++ +P   +I V   L+ E +  Y  K+   D  ++      I + + D+NDN P F    Y    PE       + ++ A D D    N    Y  Q       +F+I+  +G +  K+++   K S+Y+ +   +YA+  L+    K   Y++  V I I D ++N P         P P  A+R       + +  +H +DK D G N +    +      +  + + D  I  ++ I+       +L+   +   D G P       + I++   N   P    N  ++   EN P    I+++ A+D D G   +LRYS+     R  F+++ RTG I++    LD ++       + + D   +P ++   +T+ + D NDN P F H      +P     G   +       +A  ADKD   ++II +  L +  ++   +  +     S G I + V+ D E+   YTL I A+   NP  S  +  N+ + V+ VN+  P ++        +P   F++S+ +A+G+ V  ++A D+D  + G++ Y+++ + +    ++   ++  +G++ + +H    +  R +L + A ++G       + A +II++Q  ND
Sbjct: 2959 FRIEPQSGNITVAGHLDREQQDEYILKVVASDGAWR--AETPITITIQDQNDNAPEFEHSFYSFSFPELQQSIALVGQIIATDRDKQGPNSVISYSLQ---QPSPMFSIDPATGEVFSKKAVRF-KHSQYVRSPENMYALTVLATDNGKPPLYSECLVNINIVDAHNNPPKFEQAEYLAPLPQDAVR------GQRIVRVHANDKQDLGTNEMDYSLMTFNLSSIFSVGRHDGWITLVKPIQVPPNTRYELV---VRATDRGVPPQSDETRVVIVVTGENMDTPRFSVNSYQVIVPENEPVGSTILTVGATDDDTGPNGMLRYSISGGNERQDFSVDERTGGIVIQQ-QLDYDLIQEYHLNITVQDLGYHPLSSVAMLTIILTDVNDNPPVFNHKEYHCYIPENKPVGTFVF-------QAHAADKDSPKNAIIHYAFLPSGPDRHFFIMNQ-----SNGTISSAVSFDYEERRIYTLQIKAK---NPDSSMESYANLYVHVLGVNEFYPQFL--------QPVFHFDVSETSAVGTRVGAVQATDKDSGEDGRVYYLLVGSSN----DKGFRIDTNTGLIYVARHLDRETQNRVVLTVMAKNYGSIRGNDTDEAQVIISIQDGND 3541          

HSP 13 Score: 104.375 bits (259), Expect = 5.866e-22
Identity = 112/392 (28.57%), Postives = 168/392 (42.86%), Query Frame = 3
Query:  828 QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRV-RRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDE------IGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATM----FVTVTILDQNDNAPQFVHT----LP--FTIQEGLSFYSKLSTRIEAKDAD 1943
            Q+ V+  +IV   D NDN P F+   Y V I E    G  I  V  +DAD  L    +Y      N    FN++  +G +SL + L    +  +   V A DA         A + I + D NDN P       +      + + E +P  T L     SD D G+N+ V  S+    R+D   +      +Y     +  DYE +      I   D G+P+L +     +++VD N+  P   +       KE IP    I+++ A D D G    + Y++ +       GR +F IN+ TG +I +   +D+E  D+ +  V  TD    P    +     VTV + D NDNAP FV      LP  F+  +G    S    ++ AKDAD
Sbjct: 1259 QDKVKVKVIV--TDVNDNAPEFLRAPYHVTISEGASEGTHITHVFTQDADEGLNGDVYYSLAKG-NEAGQFNLDSATGQLSLGRRLDRESQEIHHLIVVAKDAALKHPLSSNASITIVVLDENDNAP------EFTQSSSEVSVLETSPTGTELMRFRASDADQGVNSQVVFSISAGNRRDTFHIDSITGSLY---LHKPLDYEDITSYTLNITASDCGTPSLSTTVLYNVLVVDDNDNPPIFPSTAIVRQIKEGIPLKTPIVTVTADDPDSGLNGKVSYAISKQEPQLPQGR-HFGINTETG-VIHTLREIDRESIDTFRLTVVATDR-AQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAILPPKFSTSKG---SSTAVMQVHAKDAD 1632          

HSP 14 Score: 102.834 bits (255), Expect = 1.388e-21
Identity = 126/551 (22.87%), Postives = 236/551 (42.83%), Query Frame = 3
Query:  585 IIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFF-DESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKT----YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGK----KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT---LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEI-LQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            + ++ E I + T I    A D D S +N K +Y     E    Q   +  + +   I  +R ++ E    +   +   D+      Q    K + V V D NDN P+FV     + +P  +   K     +++V AKDADSS      Y   S    + +F +++ +G+I+        ++ RY  T+ + D  +V  ++  ++V I I          S+         +  + EN P  T     + H++  +     V N +    R  +  +   D ++  + T    D E   +  E E+  I  G     SR  +++ ++D N+  P   +     +  E++     I ++ A D D    + + L +     F +   TG++I+ N TLD+E     + ++ ++D +        + T+ + D NDN P F  T+  F I E      ++  +I A+DAD  + N  + + ++  + N +  L+ +       G +     +D E+  +Y L + AQD G P  ST+  +   V+D+NDN+P++
Sbjct: 1495 VRQIKEGIPLKTPIVTVTADDPD-SGLNGKVSYAISKQEPQLPQGRHFGINTETGVIHTLREIDRESIDTFRLTVVATDRAQPSERQLSTEKLVTVIVEDINDNAPVFVSMNAAI-LPPKFSTSKGSSTAVMQVHAKDADSSSNGLVTYEIVSG--PQELFKLQRNTGIITFTPGPQFKQEVRYQLTLKSTDE-AVQSERRSSEVYITIITPGSGGSESSVPQFEQRSKLSGSVYENEPIGTSILTVTAHLASAEIEY-FVTNVTATGSRGQVDRLFDIDAKLGILSTAAELDREAGPEEYEVEVYAIALGGQPRTSRTKVRVTVLDKNDSPPQFLDTPFVYNVSEDLQIGHTISTLRAHDPDTLGSVTFLLMDGHDGKFLLEPSTGKLIL-NDTLDRETKSKYELRIRVSDGV---QYTEAYATIQVSDTNDNPPLFEDTVYSFDIPENAQRGYQVG-QIVARDADLGQ-NAQLSYGVVSDWANDVFSLNPQT------GMLTLTARLDYEEVQHYILIVQAQDNGQPSLSTTITVYCNVLDLNDNAPIF 2027          

HSP 15 Score: 98.2117 bits (243), Expect = 3.999e-20
Identity = 139/594 (23.40%), Postives = 242/594 (40.74%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD------SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSR--YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAE---------ILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF-----EELSFKENIPEHKFIMSIDASDKDKGAILRYSL-----DEIGRIYFTINSRTG-EIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHP-PLKNYATLIINVQQPNDN 2528
            + ++V+D NDN P F E    +   ES   G ++L   A DAD      +  +        + + + +  N   ++  + L+ + +++++SR  Y   + A D  S   +  Y  V + I DVNDN PI      +    Y + ++E   P T + ++  SD D G N+ +   L     +       + E   I T    +      +++          +   D GSP    R  + + ++D N+ +P I   F     +  +  EN      + ++   D D G   R S+     +E+G  +F +       I+  N  LD+E        V   D      T T  + + + D ND+ P F  +    +   L+        I A D D   +N  + + +L    N++     K F +    G I T   +DRE      L+I A+D G  PK   T + + ++D ND +P +        S+ E    + ++A   +IVA + A D DQ   G +++ +  +       QF  L+  +G L+  + PL   +     + + A D G P P    AT+ +NV   NDN
Sbjct:  142 VRIKVLDVNDNSPEFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPP-RFGYLQVNVTILDVNDNPPI------FDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYL----AETEHQFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDPIISFRFFPDGGKVATVDENAVNGTVVAAVAVKDSDSGLNGRTSVRIVSGNELG--HFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTG-VNAQVHYDILS--GNEL-----KWFSMDPLTGLIVTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDENDEAPQF--------SQREQNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQF-ALDALTGQLTT-RRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDN 704          

HSP 16 Score: 93.2041 bits (230), Expect = 1.420e-18
Identity = 77/304 (25.33%), Postives = 143/304 (47.04%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIH-VSDKDTGINAVVNCSLRVRRKDLLEMIKA-DMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKA-IKIIIVDVNEFEP---------SIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIM 1718
            +I+ V D ND+EP+F + +Y   + E  P G  +  +TA D D+ +  +  Y   S   +K  F+++  +G+I     L    +     ++ A D      K  Y  +++ I D ND  P  S           + + E+ PP+T+ ++   +D D G N  V  +L    + L  +  A D    Q+ T R  D E +   E  ++  D G+P   S  A + + + DVN+ +P         S+ ++ +++  K+ + + + ++ + ASDKD G  A++ Y L+  G   F +++R+G I +
Sbjct:  480 LIIDVNDVNDHEPVFEKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNELK-WFSMDPLTGLIVTTGPLDREIRDTVELSISARDG-GPNPKFAYTQLKVIILDENDEAPQFSQRE------QNVTLGEDAPPQTIVALMTATDHDQGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSATATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDGDNALIEYRLESGGEGLFQLDARSGAISL 775          

HSP 17 Score: 91.2781 bits (225), Expect = 4.708e-18
Identity = 125/483 (25.88%), Postives = 202/483 (41.82%), Query Frame = 3
Query: 1167 DVEIEIEDVNDNYPIISLLHGYMPDP-YAIRIDENTPPKT-LFSIHVSDKDTGINAVVN----CSLRVRRKDLLEMIK---ADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEI-IMSNVTLDKEMN-------DSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPF--------TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS---YGRTLLKISAHDHGHPPLKNYATLIINVQQPND 2525
            +V I++ DVNDN P         P+P  AI   E+    T L     +D D G N V +     +  V  K  L        D     + T  + D E     +  I   D GSP       + + I+DVN+  P   ++   +S  E       ++++ ASD D G  + + Y L E     FT+N  TG I     V   ++ N        S  F VF  D          +VTV +LD ND+ P  + +  F        T+ E  +    +   +  KD+D   +N     R++    +  EL H ++ + +    +     +DRE+   Y LT++A D+G P ++T+ ++ I V DVND+ PV+         + E    +S+ A  GS VA + A D+D     ++ Y I+S        ++ +++  +G++ +   PL         L ISA D G  P   Y  L + +   ND
Sbjct:  141 EVRIKVLDVNDNSP-------EFPEPSIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLHLETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIFDHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEH-QFTVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDHDP--IISFRFFPDGGKVATVDEN-AVNGTVVAAVAVKDSDSG-LNGRTSVRIV----SGNELGHFRLEEAADLHIVRVNGVLDREEIGKYNLTVVAMDQGTPARTTTAHLIIDVNDVNDHEPVF--------EKSEYSAVLSELAPTGSFVASITATDEDTGVNAQVHYDILSGNEL----KWFSMDPLTGLI-VTTGPLDREIRDTVELSISARDGGPNPKFAYTQLKVIILDEND 594          

HSP 18 Score: 87.8113 bits (216), Expect = 5.437e-17
Identity = 168/713 (23.56%), Postives = 288/713 (40.39%), Query Frame = 3
Query:  579 KQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTF-------QLFVYQYDPDILS--IMVMRSLNYELKQIYFCKLKVCDK---TYQNCVRKSIIVQVIDENDNEPIFVEKKYL---------VKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLK--QSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDE------NTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFD------YEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSI---RNNFEELSFKENIPEHKFIMSIDASDKDKGAILR--YSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-----LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMS---------------TESHYQGEQFLTLN---ETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +Q + L E     T +++  A D D          Q  + S+TF       +L+  Q+  D L+  +   R L+ E    Y   +   D+   T Q+    ++ + V D NDN+P F  + Y+         +K+ +     + +L VTA D D    +     ++     + +F ++  SG ISL+     S++ K  Y   V A DA     ++D A VEI ++   +         G     Y  ++ E      N+ P     I V  K T   A  +    + + D  +  + D    +I T R  D      Y +  L  +      + S     +  + I I+D+N+  P     R +   +S  EN    + I      D+D G   R  YSL       F I   TG + +    +  E    +  ++  TD+   P ++ + ++V I D ND+ P F HT     LP T +    F++  +T I+    D   I++ II           E   E++F V   G +     +DRE+   Y LT+  +D G P +S+   + I VID NDN+P +      NS+     F+I + A   + V +L A+D+D     ++S+ + S               T   +  E  + ++   E SG     +  ++    LL+ +  D+G P L++   + + V   NDN
Sbjct:  603 EQNVTLGEDAPPQTIVALMTATDHD----------QGTNGSVTFALAPSVERLYPLQFALDALTGQLTTRRPLDREKMSQYEISVIARDQGAPTPQSAT-ATVWLNVADVNDNDPQFYPRHYIYSLADDDDDIKLKKEVEKERILLHVTASDKDDG--DNALIEYRLESGGEGLFQLDARSGAISLRGDAPASMHWKPHYKLLVSARDAGQRRSQQD-AIVEIVLKSKLEMLECGQAQAGG----YEFQMVEDHEQQRNSQPNREVGI-VQVKSTNGKANSHIEYDIIQGDRAQNFRIDTRSGRITTARPLDREEQANYRLTILASSSSSSSAAASSVSYGQCIVNIAIIDLNDNAPVFALDRESEPTISLPENAAVGQEIYLSRVRDRDAGVNSRISYSLTNNPNQQFRIGPVTGVLYLQR-PIRAEPGSLIHVELMATDAGSPPLSSKLSLSVLIADVNDHTPVFDHTSYETSLPETTKVNTRFFALAATDIDL--GDNGRISYEII-----------EGNTERMFGVFPDGYLFVRAPLDREERDYYALTVSCRDAGQPSRSSVVPVVIHVIDENDNAPQFT-----NST---FTFSIPENAPADTFVGKLTAVDRDIGRNAELSFTLSSQTQDFTIDTRNGFIKTLRPFDREALVKVSRNAEASGEDGSLRGSMAGNYMLLEATVSDNGIPRLQDKVKVKVIVTDVNDN 1274          

HSP 19 Score: 76.2554 bits (186), Expect = 1.940e-13
Identity = 87/312 (27.88%), Postives = 136/312 (43.59%), Query Frame = 3
Query: 1683 FTINSRTGEIIMSNVTLDKE-MNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRI---EAKDADKDEIN----HSII-------FRLLHTYN--NKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNIS--KEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH-----------PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            FT++  TGE+  +NV LD+E M D     V     L +  T  + V + +LD NDN+P+F      +I    S  +   TR+    A DAD  E      + I+       FRL+ T N       LH           +ET   +DRE   +Y L I A+D G+PP+     + +T++DVNDN P++            + +N+S  + A  G+ V  + A D D  D  KI+Y +  TE  +      T+N  +G++S  +              S    +  + A DHG P       + +N+   ND+
Sbjct:  103 FTLDPVTGEV-KTNVVLDREGMRDHYDLVV-----LSSQPTYPIEVRIKVLDVNDNSPEFPEP---SIAISFSESATSGTRLLLDAATDADVGENGVTDQYEIVAGNVDNKFRLVTTANPSGDTSYLH-----------LETTGNLDRESRGSYQLNISARDGGSPPRFGYLQVNVTILDVNDNPPIF----------DHSDYNVSLNETALPGTPVVTVMASDNDLGDNSKITYYLAETEHQF------TVNPETGVISTTERVNCPQQTNVKSSASQKSCVFTVFARDHGSPRQDGRTYVTVNLLDTNDH 378          
BLAST of Protocadherin 11 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0078045)

HSP 1 Score: 155.992 bits (393), Expect = 7.537e-38
Identity = 192/776 (24.74%), Postives = 324/776 (41.75%), Query Frame = 3
Query:  219 PSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSK--YFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQN-CVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQ-----------SNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSI-HVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIY----QIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEEL-SFKENIPEHKFIMSIDASDKDKG--AILRYSL----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSF---YSKLSTRIEAKDADKDEINHSI-IFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDK--GNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMS-----TESHYQGEQFLTLNETSGILSIHQHPLSY 2429
            P I       +++ E+  RG ++G++           P     +      YF I+  + N+++   +D +           K + ++  +  + E   Y  +  + +EV+D++DN P F      I + E   +   +    A DKD S  + +  Y    ES      ++  D     +++ + L+YE  Q +   +   D    +     +I+V V D NDN P+F + +Y V + ES  I  +I++V A D D+    +  Y              S+ +V   F I   SG I L+  L    + RY  TV A D            V + + D NDN P       +    Y  RI+EN    ++  +   SD D G NA +  SL          I +  +++    +I T    D E+ +L +  +   D G+P   +R  ++I + DVN+  P I +  E++ S +E  P    ++ + A D+D G  A + YS+    D  G   F+I+  +G +I + V LD E     +  V  +D    P      + V +LD NDN P F  + L F ++E  +       +S      D  ++ +  S    R+ +T N   + L E  FD+    G +     +DRE  S + L I A D    N P+S++  + I V DVNDN+P W   P            +S+   +G+I+    A D D    G + Y ++       ES  Q      ++  +G LS+ Q PL +
Sbjct:  824 PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEA----------KSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKD-SGSSGQVTYSLVKESGKG---LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDN-GTPAAHAKTRVIVRVLDANDNDP------KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG-VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP--------IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPLDF 1559          

HSP 2 Score: 145.206 bits (365), Expect = 1.876e-34
Identity = 154/558 (27.60%), Postives = 253/558 (45.34%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK-SIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGIN-AVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI---YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTES-------HYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGH 2471
            ++ + + D NDN+PIF + +Y   +PE+  +G  +L+V A D D+       Y      + K  +F I+  +G I + ++L    K  +   V A D      +   A V I + DVNDN P I+++  ++ D  + +I E+  P    + I V D D+    A VN +L         +   D  IY +      D EI+      ++  D G+P L + K+I + I DVN+  P    +    +  E       ++ + A D+D+G  + L YSL E       +F I+ +TG +I +   +D E     +  V   D  + P ++T  V VTI D NDN P F  +             +   ++ A D D   +N  + + +   + +  E      F+V S+ GEI     +D E+ S+Y   +LA D+G    ST+  I + + DVNDN PV+  P     S  E+    S +A+   IVA + A D D  +FG++SY I++             GE F+   +   +LS+   P+     +L ISA D G+
Sbjct:  271 TVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETT-AFVSIRVTDVNDNQPTINVI--FLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLN-GGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFY-PREYKVSLRESP-KASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPD---MLSVRTQPMH----MLNISATDGGN 804          

HSP 3 Score: 135.191 bits (339), Expect = 1.781e-31
Identity = 179/699 (25.61%), Postives = 301/699 (43.06%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDE--------------SMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSL-RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVT-------------LDKEMNDSVKFKVFITDSLI--NPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIE---AKDADKDEINHSIIFRLLHTYN--NKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPK---STSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSY-----GRTLLKISAHDHGHP-PLKNYATLIINVQQPNDN 2528
            + +SE  SIN  I    A D D    N +  Y+  D               S  F +F     P+   I +   L+ E +  Y   +   D  T     +  +IV+V+D NDN+P F + KY  +I E+   G  +  VTA D D        Y   S   + S F +   +G IS ++ L    +  Y   V A D      +     V I + DVNDN P I+      P    + + E  PP T +  +   D+D G NA +  S+ + R  D   +   D     IRT    D+E   +    +   D G+P   + + +++ ++D+N+  P+  ++      +E+      + SI   ++    ++R S++E     R+ +T+N  T ++I +                LD+E+    + ++   D+    NP ++ + V + + D NDNAP++    P  +Q  +S  + + T I    A DAD    N  + +RL+  +   N+ +     +F + S  G +     +D E    Y L + A D+ +       TS  + + ++D ND++P +VSP S  S    A   IS    IG +VA + A+D+D  D G+++Y I        GE    +N  +GI+ + +   P +      GR  L I A DHG P P K+   L + VQ  ++N
Sbjct: 1043 VNVSESRSINAQIIQVNASDLDTGN-NARITYRIVDAGVDNVTNSISSSDVSQHFGIF-----PNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQ-GTPVRSARVPVRIHVSDVNDNAPEIA-----DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIER-PADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-PIDLQ--VSEATPVGTIIHNFTATDADTG-TNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS--SGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG----NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNN 1715          

HSP 4 Score: 132.494 bits (332), Expect = 1.397e-30
Identity = 124/468 (26.50%), Postives = 215/468 (45.94%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI---EKESGVISLKQSLS--INKKSR--YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEH----KFIMSIDASDKDKG---AILRYSLDEIGRIYFTINSRTGEI--IMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDE-INHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            ++V V DENDN P F +    ++ PE+ P   K   + A+D D   +N   Y   S  NV   F +    +  GV+ L   +S  +++++   Y   + A+D  +   +  +  V I I+DVNDN PI      +    Y   + EN T   ++  ++ SD D   N +V  ++  R+ D  +M + D     I   ++ D+E  +L E  ++  D G   L +   + I + DVN+ +P+I   F        I E     +F+  I   D D     A +  +L+  G  +F + +R   I  ++ ++ LD+E+  +    V  TD    P  A+  + + I D NDN P+F   L       +      ++ ++    D+DE +N ++ + L  T        H + F +  + G I T   ID E +    LT++A+D G PP S++  + +T+ DVNDN P++
Sbjct:  160 VLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSG-NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR-GFMTVNITIQDVNDNQPI------FNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHA--NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPET-----HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF 611          

HSP 5 Score: 124.79 bits (312), Expect = 3.299e-28
Identity = 153/600 (25.50%), Postives = 261/600 (43.50%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID--ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT------LFSIHVSDKDTGINAVVNCSLRV---RRKDLLEMIKADMEIYQIR----TIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFIT--DSLINPHTATMFVTVTILDQNDNAPQFVHTL-----PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIM--------STESHYQGEQFLTLNETSGILSIHQHPL---SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++V + D NDNEPIF +  Y V + E+ P+G+ ILKV+A D D  +     Y     +   + F +   SG I +   L   ++S Y F V A D   LS T     A +++++ DVNDN P+      + P  Y + + E+    +      + ++  +D D G    V  S R+       +  + ++  EI+ +R    ++R+    +L      I   D G+    +   + + I+D  +  P           KE+IP    + S+ A+  D    + +RYS+   D  G  YF+I + +G I ++   LD E    V   +  T  +  +  HT    V + + D NDNAP+F  ++     P + + G   Y+       A   DKD  +   +   L   + K       +F + ++ G +     +D E    +TL + A D G P  ST+  I + V DVNDN PV+         + E   N+S+  +I + + Q+ A D D  +  +I+Y I+        ++ S     Q   +   SG + + + PL   +  R  L + A D+G P       +I+ V   NDN
Sbjct:  596 TVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTT-----AMIKMQLTDVNDNRPV------FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV--SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-----ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAK-PLDHEAKSQVLLNIQATLGEPPVYGHTQ---VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA-------AHAHDKDSGSSGQVTYSLVKESGK------GLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF--------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYL-RAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN 1149          

HSP 6 Score: 114.005 bits (284), Expect = 6.428e-25
Identity = 151/632 (23.89%), Postives = 273/632 (43.20%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEP----IFVEKKYLVKIPESYPIGKKILKVTAKDADSSL----FNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKK--SRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGR--IYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV-HTLPFTIQEGLSFYSKLSTR----IEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVV--TIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFN--ISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++ DP   +I + ++L++E K+++   +   D   Q     + + ++V D NDN+P    IF+      KI ES   G+ + +++  D DS       N T  G   ++ + +     +++ +  +   L ++++  S Y  +V A D  +       + + + I DVNDN P       +  D Y   + E   P T +  +   D+D G+N+ +  SL    +   +  + D +   I T    D E   + +  ++  D G P L S   + + I DVN+ EP    +F  +S  EN P  + I+ + ASD D G  A++ Y++ E  +    F + S +GEI ++   LD E   S +F V  TD      + T  + + + D NDN P F       +++E     S+ S+     + A D D       + +R++             IF +  S GEI  V    +       + L I A D GN   +    + +++ID     P++           +AR+N  + ++   G++V  + A   D      + Y I S +     + + ++   SG + I + PL +    + LL I A   G PP+  +  + I V+  NDN
Sbjct:  335 MFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTT-----RDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS-IFLRITDVNDNPP------EFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAG-ELDFERRSSYEFPVLATDR--GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ-VSYRIVAGN-------EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF----------EKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP----DGYFSIETNSGNIRIAK-PLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDN 927          

HSP 7 Score: 108.612 bits (270), Expect = 2.589e-23
Identity = 174/714 (24.37%), Postives = 294/714 (41.18%), Query Frame = 3
Query:  594 LSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILS--IMVMRSLNYELKQIY-FCKLKVCDKTYQNCVRKSII---VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS-NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP-----------------KTLFSIHVSDKDTGINAVVNCS--LRVRRKDLLEMIK----------------------------ADMEIYQIRTIRSFDYEILQLIEAEILCI----DSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVS--PPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL-----SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + E   + TS+    A+D D   +N +  Y   +E+       +Q+  D  S  I  +  L+ EL+  Y F  L      Y+  VR + +   + V+D NDN PIF    Y+ ++P     G+ +LKV A DAD     +  Y   + N  V + F I   +G +S  QSL+          V A D  +   +     +E+ I +     P++     +  + Y + + EN+P                  K  FS    ++D GI ++ + S  +RV +  LL+  +                             +      R + S  + +      EI  +     + +P L S   + I + D N+  P         +  E   +  F+  + A D D G  A LRY + D      F I      I+ +N+ LD+E+ D  K K+  TD  +   T T  + V I+D NDN P F      T+ E       + T I A D D      ++ +RL     + +++ +  IF +    G++     +D E    Y L ++A D  +  +   T +T+ V D NDN+PV+++  PP+  +  P A   IS+  ++   +  + A D D +  G  S VI   E   +G    +++ ++G++S++   L     S G   ++I A D G P LK+   L +   Q NDN
Sbjct: 1961 VQEDAPLGTSVVQISAVDADLG-VNARLVYSLANETQ------WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYE--VRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPP-QSSLGLIELLIGEAPQGTPVLR----FQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNED-GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATEL-GAVITSISANDVDTYP---ALTYRL--GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPVFLAQQPPAYFAILP-AISEISESLSVDFDLLTVNATDADSE--GNNSKVIYIIEPAQEG---FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV---QANDN 2641          

HSP 8 Score: 107.071 bits (266), Expect = 7.835e-23
Identity = 127/482 (26.35%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDA------LSVTFKK----------------DYADVEIEIEDVNDNYPIISLLHGYMPDP-YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKA---IKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDS-LINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPV 2192
            +IVQ    ++N P F++  Y   I E+ P G  +L+VTAK    +      Y   +      +F+++ + G+I+ +       ++ Y+  VY  DA       S   +K                D A + I + DVNDN P       + P   Y + + EN+ P  + ++  SD D G NA +  S  +   +L      D    ++ + R  D E       +I   D G P   SR+    I I + D N+  P  + +    S +E+ P    ++ I A D D G  A L YSL    +  F I+ ++G +I +   LD+E+  S  F V  TD       +AT+ V + +LD NDN P F     +  +P  IQ G +       +++A DAD    N  I++ L    N +   +  K     S G +    ++  E      L ++A+DKGNPP+S+   I + + +    +PV
Sbjct: 1707 LIVQ--GSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGV-ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP------EFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYS--ITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPK--SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL-----KVQALDADLGA-NAEIVYSL----NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPV 2163          

HSP 9 Score: 88.9669 bits (219), Expect = 2.786e-17
Identity = 108/407 (26.54%), Postives = 171/407 (42.01%), Query Frame = 3
Query: 1149 FKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRI------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLP----------FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRL--------LHTYNNKMELLHEKIFD-VSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSS--EPEARFNISKEAAIGSIVAQL 2285
            F   YA++ IE+ED NDN P  S         +   + E     T  + +H  D D G NA +   +     D   +I+       +RT    D EI  + + +I+  D G P +     I++ IVDVN+ +P+   N   ++  E       I SI A+D D    L Y L     +       F ++  +G++++    LD E+    +  V  +D+    H A   +TV + D+NDNAP F+   P            I E LS    L T + A DAD +  N  +I+ +        +H  N  + +   ++   VSS G+              Y + I+A+D G P   +S   T+  +  NDN        S  S   + + R  IS+ A +GS+V QL
Sbjct: 2301 FLASYAELVIELEDENDNSPKFS------QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKR-RLDYELQQEYELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLT-VNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD--------------YFVRIIAKDAGKPALKSS---TLLRVQANDNG-------SGRSQFLQNQYRAQISEAAPLGSVVLQL 2670          

HSP 10 Score: 84.7297 bits (208), Expect = 4.186e-16
Identity = 75/297 (25.25%), Postives = 128/297 (43.10%), Query Frame = 3
Query:  762 RSLNYELKQIYFCKLKVCD----KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR--NNFEELSFKENIPEHKFIMSIDASDKD 1634
            R L+ E    Y  +++  D    K+ Q     +I V+  D+NDN P F   KY   + E  P+G  +++++A DAD  +  +  Y   +    +  F I+ +SG+I+    L    ++ Y F V A D      +     V+I + D+NDN PI          P  I+     P +TL  +   D D G NA +  SL      +    + +     +   +S   E  +L+  E++  D G+P   S   I+++I +  +  P +R  N    +  KEN P    ++ + A   D
Sbjct: 1907 RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQ-----PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 11 Score: 79.337 bits (194), Expect = 2.209e-14
Identity = 151/626 (24.12%), Postives = 253/626 (40.42%), Query Frame = 3
Query:  591 KLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVE-KKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPII---SLLHGYMPDPYAIRIDENTPP--KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEM-IKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAI--KIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA-------ILRY-----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTAT------MFVTVTILDQNDNAPQFV-------HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETV-----VTIDREKDSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVI 2336
            ++ E +   + + +  A D D  + N    Y     + +FQ+      P    I     L+ EL+++Y   ++  D+ T     R  + + V D NDN P   + ++ +V + E  P G ++++V A D D        Y      + +   +F+I+  SGVI  +  L   ++S Y   V A D  +   ++    + +E+ D+NDN P     SL+     D     +  +  P  +    +  S +++  +  V  +L    KDL+E     D     +   R  D E+      EI  +D+ +       AI  KI + DVN+  P    +  +L   E  P    I +  A+D D G        ++RY        E     F ++S TG + +    LD E   +V+  + I  +L      T      + V + ILD ND+AP FV        T    I +      ++   I A D D  + N  + + +  T  N      E  F ++S+ G IE V      T D EK   + L I A+D G P PK +S N+ + V   ++N P ++        +   R  I +    GS V Q+ A      +   +SY I
Sbjct: 1161 RIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLPINSSFQV-----HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPLDFE---AVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRI-GEVVAHIVAVDEDSGD-NGQLTYEI--TGGNG-----EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL--------QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI 1758          

HSP 12 Score: 75.0998 bits (183), Expect = 3.667e-13
Identity = 137/589 (23.26%), Postives = 243/589 (41.26%), Query Frame = 3
Query:  768 LNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK--SIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAI-----RIDENTPPK-TLFSIHVSDKDT-GINAVVNCSLRVRRKDLL-----EMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSI------DASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH----------TATMFVTVTILDQNDNAPQFVHTLPFTIQ-EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPP------SLNSSEPEARFN-----ISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILS 2405
            L+ E++ IY  K+   D+   Q     +I VQ++D NDN+P F     LV + E+  +G  I  ++A D D+        G +S  +++  SIF +++ SG + LK+ L    +  Y   V A DA      +    + + + D NDN P+   L    P  +AI      I E+      L +++ +D D+ G N+ V   +   ++         ++  +M   Q     S DY +       I+  D+G PAL S   +++   D      S R+ F +  ++  I E   + S+      DA D+    I        G           + I+    LD+E ND  K ++ ++    +PH          ++ + V +TILD NDN P F  +  +  +   L+       +++A DAD++   +S                 E ++D++S G  E + TID      +    L  D G    + S  + I   D +   P+    P        N +EP+         +++   +GS V +  A D D+  FG+++Y I    S     +   ++  SG+++
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAPV--FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFV------RIIAKDAGKPALKSSTLLRVQAND----NGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAII-------AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLS----HPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNS-----------------EVVYDITS-GNDEHMFTIDLVTGVLFVNNRLDYDSG----AKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 13 Score: 75.0998 bits (183), Expect = 3.990e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 3
Query: 1683 FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
              I+  TGEI  + V LD+E   S    V I  S  N     + V VT+ D+NDNAP F  T +     E      K  T + A+D D +  N      +    N+   L   +  D     +++    +DRE    Y+L I A D G PP      + IT+ DVNDN P++      N S   A   + + A +G+ V Q+ A D D D+ G + Y I   +S    EQ   ++  +G + I++      + L  L + A DHG  PL+  A + I V   NDN
Sbjct:  123 LAIDRATGEI-RTKVKLDRETRASYSL-VAIPLSGRN-----IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVK-RTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF------NQSRYFA--TVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS--DKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDN 389          

HSP 14 Score: 58.9214 bits (141), Expect = 3.275e-8
Identity = 136/592 (22.97%), Postives = 241/592 (40.71%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKK---YLVKIP------ESYPIGKKILKVTAKDADSSLFN-KTFYGFQSNYNVKSIFNIEKESGVISLKQSL---SINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP------ALLSRKAIKIIIVDVNEFEPSI-RNNFEELSFKENIPEHKFIMSIDASDKDK----GAILRYSLDEIGRIY-FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDS-LINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADK---DEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI--GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ 2414
            +++ R L+YEL+Q Y   +   D  ++   R  + V+V DENDN P+F+ ++   Y   +P      ES  +   +L V A DADS   N K  Y  +     +  F++   +GV+S+  S    +++    Y   + A DA     K   +   + ++  NDN    S    ++ + Y  +I E  P  ++      D      A++  +     +   E++++      I  ++  D E   L +  ++      P         S  ++ I I+D N+  P   R+   E    E  P    I  + A D D+     + + Y +      + FTI+  TG + ++N         S +  +   DS    P  +     + + D+NDN P+F     VH L      G S +     R  A D DK    ++N+SI            +    K+F V S+ G + +    D E+   Y + +LA D G    S +  + I   D  + +P +        +E   RF +    A+  G +V Q+ A D D    G++ Y + +  SH++      +N +SG + I +
Sbjct: 2487 LVLKRRLDYELQQEYELDVIASDAAHE--ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP---AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK---SSTLLRVQ-ANDNG---SGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN----EESAFELLQSK----AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVF-----RAHASDLDKGPFGQLNYSI-------GPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRD--EFTPQF--------TERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFK------VNRSSGAVLIKR 3030          
BLAST of Protocadherin 11 vs. Ensembl Fly
Match: ds (gene:FBgn0284247 transcript:FBtr0343249)

HSP 1 Score: 155.992 bits (393), Expect = 7.537e-38
Identity = 192/776 (24.74%), Postives = 324/776 (41.75%), Query Frame = 3
Query:  219 PSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSK--YFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQN-CVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQ-----------SNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSI-HVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIY----QIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEEL-SFKENIPEHKFIMSIDASDKDKG--AILRYSL----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSF---YSKLSTRIEAKDADKDEINHSI-IFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDK--GNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMS-----TESHYQGEQFLTLNETSGILSIHQHPLSY 2429
            P I       +++ E+  RG ++G++           P     +      YF I+  + N+++   +D +           K + ++  +  + E   Y  +  + +EV+D++DN P F      I + E   +   +    A DKD S  + +  Y    ES      ++  D     +++ + L+YE  Q +   +   D    +     +I+V V D NDN P+F + +Y V + ES  I  +I++V A D D+    +  Y              S+ +V   F I   SG I L+  L    + RY  TV A D            V + + D NDN P       +    Y  RI+EN    ++  +   SD D G NA +  SL          I +  +++    +I T    D E+ +L +  +   D G+P   +R  ++I + DVN+  P I +  E++ S +E  P    ++ + A D+D G  A + YS+    D  G   F+I+  +G +I + V LD E     +  V  +D    P      + V +LD NDN P F  + L F ++E  +       +S      D  ++ +  S    R+ +T N   + L E  FD+    G +     +DRE  S + L I A D    N P+S++  + I V DVNDN+P W   P            +S+   +G+I+    A D D    G + Y ++       ES  Q      ++  +G LS+ Q PL +
Sbjct:  824 PPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDGYFSIETNSGNIRIAKPLDHEA----------KSQVLLNIQATLGEPPVYGHT-QVNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYAAHAHDKD-SGSSGQVTYSLVKESGKG---LFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVFEKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYLRAPLDRETRDRYQLTVLATDN-GTPAAHAKTRVIVRVLDANDNDP------KFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRYSLLP--------INSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSG-VIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDP--------IDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPLDF 1559          

HSP 2 Score: 145.206 bits (365), Expect = 1.876e-34
Identity = 154/558 (27.60%), Postives = 253/558 (45.34%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK-SIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGIN-AVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI---YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTES-------HYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGH 2471
            ++ + + D NDN+PIF + +Y   +PE+  +G  +L+V A D D+       Y      + K  +F I+  +G I + ++L    K  +   V A D      +   A V I + DVNDN P I+++  ++ D  + +I E+  P    + I V D D+    A VN +L         +   D  IY +      D EI+      ++  D G+P L + K+I + I DVN+  P    +    +  E       ++ + A D+D+G  + L YSL E       +F I+ +TG +I +   +D E     +  V   D  + P ++T  V VTI D NDN P F  +             +   ++ A D D   +N  + + +   + +  E      F+V S+ GEI     +D E+ S+Y   +LA D+G    ST+  I + + DVNDN PV+  P     S  E+    S +A+   IVA + A D D  +FG++SY I++             GE F+   +   +LS+   P+     +L ISA D G+
Sbjct:  271 TVNITIQDVNDNQPIFNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETT-AFVSIRVTDVNDNQPTINVI--FLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLN-GGDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTG-LITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCG-VNAMVNYTIGEGFKHLTE------FEVRSASGEICIAGELDFERRSSYEFPVLATDRGG--LSTTAMIKMQLTDVNDNRPVFY-PREYKVSLRESP-KASSQASSTPIVAVV-ATDPDYGNFGQVSYRIVAGNEAGIFRIDRSTGEIFVVRPD---MLSVRTQPMH----MLNISATDGGN 804          

HSP 3 Score: 135.191 bits (339), Expect = 1.781e-31
Identity = 179/699 (25.61%), Postives = 301/699 (43.06%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDE--------------SMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSL-RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVT-------------LDKEMNDSVKFKVFITDSLI--NPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIE---AKDADKDEINHSIIFRLLHTYN--NKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPK---STSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSY-----GRTLLKISAHDHGHP-PLKNYATLIINVQQPNDN 2528
            + +SE  SIN  I    A D D    N +  Y+  D               S  F +F     P+   I +   L+ E +  Y   +   D  T     +  +IV+V+D NDN+P F + KY  +I E+   G  +  VTA D D        Y   S   + S F +   +G IS ++ L    +  Y   V A D      +     V I + DVNDN P I+      P    + + E  PP T +  +   D+D G NA +  S+ + R  D   +   D     IRT    D+E   +    +   D G+P   + + +++ ++D+N+  P+  ++      +E+      + SI   ++    ++R S++E     R+ +T+N  T ++I +                LD+E+    + ++   D+    NP ++ + V + + D NDNAP++    P  +Q  +S  + + T I    A DAD    N  + +RL+  +   N+ +     +F + S  G +     +D E    Y L + A D+ +       TS  + + ++D ND++P +VSP S  S    A   IS    IG +VA + A+D+D  D G+++Y I        GE    +N  +GI+ + +   P +      GR  L I A DHG P P K+   L + VQ  ++N
Sbjct: 1043 VNVSESRSINAQIIQVNASDLDTGN-NARITYRIVDAGVDNVTNSISSSDVSQHFGIF-----PNSGWIYLRAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDNDPKFQKSKYEFRIEENLRRGSVVGVVTASDLDLGENAAIRY---SLLPINSSFQVHPVTGEISTREPLDRELRELYDLVVEARDQ-GTPVRSARVPVRIHVSDVNDNAPEIA-----DPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPPRETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIER-PADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQD-PIDLQ--VSEATPVGTIIHNFTATDADTG-TNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSLQAPLDFEAVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNS--SGGKTASLFISDATRIGEVVAHIVAVDEDSGDNGQLTYEITGG----NGEGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNN 1715          

HSP 4 Score: 132.494 bits (332), Expect = 1.397e-30
Identity = 124/468 (26.50%), Postives = 215/468 (45.94%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI---EKESGVISLKQSLS--INKKSR--YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEH----KFIMSIDASDKDKG---AILRYSLDEIGRIYFTINSRTGEI--IMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDE-INHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            ++V V DENDN P F +    ++ PE+ P   K   + A+D D   +N   Y   S  NV   F +    +  GV+ L   +S  +++++   Y   + A+D  +   +  +  V I I+DVNDN PI      +    Y   + EN T   ++  ++ SD D   N +V  ++  R+ D  +M + D     I   ++ D+E  +L E  ++  D G   L +   + I + DVN+ +P+I   F        I E     +F+  I   D D     A +  +L+  G  +F + +R   I  ++ ++ LD+E+  +    V  TD    P  A+  + + I D NDN P+F   L       +      ++ ++    D+DE +N ++ + L  T        H + F +  + G I T   ID E +    LT++A+D G PP S++  + +T+ DVNDN P++
Sbjct:  160 VLVTVKDENDNAPTFPQTSMHIEFPENTPREVKRTLLPARDLDLEPYNTQRYNIVSG-NVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLR-GFMTVNITIQDVNDNQPI------FNQSRYFATVPENATVGTSVLQVYASDTDADENGLVEYAINRRQSDKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNG-GDGHFALTTRDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKSIFLRITDVNDNPPEFEQDLYHA--NVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPET-----HAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIF 611          

HSP 5 Score: 124.79 bits (312), Expect = 3.299e-28
Identity = 153/600 (25.50%), Postives = 261/600 (43.50%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID--ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT------LFSIHVSDKDTGINAVVNCSLRV---RRKDLLEMIKADMEIYQIR----TIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFIT--DSLINPHTATMFVTVTILDQNDNAPQFVHTL-----PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIM--------STESHYQGEQFLTLNETSGILSIHQHPL---SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++V + D NDNEPIF +  Y V + E+ P+G+ ILKV+A D D  +     Y     +   + F +   SG I +   L   ++S Y F V A D   LS T     A +++++ DVNDN P+      + P  Y + + E+    +      + ++  +D D G    V  S R+       +  + ++  EI+ +R    ++R+    +L      I   D G+    +   + + I+D  +  P           KE+IP    + S+ A+  D    + +RYS+   D  G  YF+I + +G I ++   LD E    V   +  T  +  +  HT    V + + D NDNAP+F  ++     P + + G   Y+       A   DKD  +   +   L   + K       +F + ++ G +     +D E    +TL + A D G P  ST+  I + V DVNDN PV+         + E   N+S+  +I + + Q+ A D D  +  +I+Y I+        ++ S     Q   +   SG + + + PL   +  R  L + A D+G P       +I+ V   NDN
Sbjct:  596 TVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAGELDFERRSSYEFPVLATDRGGLSTT-----AMIKMQLTDVNDNRPV------FYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQV--SYRIVAGNEAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLN-----ISATDGGNLRSNADAVVFLSIIDAMQRPPIFEKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDPDG--YFSIETNSGNIRIAK-PLDHEAKSQVLLNIQATLGEPPVYGHTQ---VNIEVEDVNDNAPEFEASMVRISVPESAELGAPLYA-------AHAHDKDSGSSGQVTYSLVKESGK------GLFAIDARSGHLILSQHLDYESSQRHTLIVTATDGGVPSLSTNLTILVDVQDVNDNPPVF--------EKDEYSVNVSESRSINAQIIQVNASDLDTGNNARITYRIVDAGVDNVTNSISSSDVSQHFGIFPNSGWIYL-RAPLDRETRDRYQLTVLATDNGTPAAHAKTRVIVRVLDANDN 1149          

HSP 6 Score: 114.005 bits (284), Expect = 6.428e-25
Identity = 151/632 (23.89%), Postives = 273/632 (43.20%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEP----IFVEKKYLVKIPESYPIGKKILKVTAKDADSSL----FNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKK--SRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGR--IYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV-HTLPFTIQEGLSFYSKLSTR----IEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVV--TIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFN--ISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++ DP   +I + ++L++E K+++   +   D   Q     + + ++V D NDN+P    IF+      KI ES   G+ + +++  D DS       N T  G   ++ + +     +++ +  +   L ++++  S Y  +V A D  +       + + + I DVNDN P       +  D Y   + E   P T +  +   D+D G+N+ +  SL    +   +  + D +   I T    D E   + +  ++  D G P L S   + + I DVN+ EP    +F  +S  EN P  + I+ + ASD D G  A++ Y++ E  +    F + S +GEI ++   LD E   S +F V  TD      + T  + + + D NDN P F       +++E     S+ S+     + A D D       + +R++             IF +  S GEI  V    +       + L I A D GN   +    + +++ID     P++           +AR+N  + ++   G++V  + A   D      + Y I S +     + + ++   SG + I + PL +    + LL I A   G PP+  +  + I V+  NDN
Sbjct:  335 MFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDNQPTINVIFLSDDASPKISESAQPGEFVARISVHDPDSKTEYANVNVTLNGGDGHFALTT-----RDNSIYLVIVHLPLDREIVSNYTLSVVATDKGTPPLHASKS-IFLRITDVNDNPP------EFEQDLYHANVMEVADPGTSVLQVLAHDRDEGLNSALTYSLAETPETHAQWFQIDPQTGLITTRSHIDCETEPVPQLTVVARDGGVPPLSSTATVLVTIHDVNDNEPIFDQSFYNVSVAENEPVGRCILKVSASDPDCGVNAMVNYTIGEGFKHLTEFEVRSASGEICIAG-ELDFERRSSYEFPVLATDR--GGLSTTAMIKMQLTDVNDNRPVFYPREYKVSLRESPKASSQASSTPIVAVVATDPDYGNFGQ-VSYRIVAGN-------EAGIFRIDRSTGEIFVVRPDMLSVRTQPMHMLNISATDGGNLRSNADAVVFLSIIDAMQRPPIF----------EKARYNYYVKEDIPRGTVVGSVIAASGDVAHRSPVRYSIYSGDP----DGYFSIETNSGNIRIAK-PLDHEAKSQVLLNIQA-TLGEPPVYGHTQVNIEVEDVNDN 927          

HSP 7 Score: 108.612 bits (270), Expect = 2.589e-23
Identity = 174/714 (24.37%), Postives = 294/714 (41.18%), Query Frame = 3
Query:  594 LSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILS--IMVMRSLNYELKQIY-FCKLKVCDKTYQNCVRKSII---VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS-NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP-----------------KTLFSIHVSDKDTGINAVVNCS--LRVRRKDLLEMIK----------------------------ADMEIYQIRTIRSFDYEILQLIEAEILCI----DSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVS--PPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL-----SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + E   + TS+    A+D D   +N +  Y   +E+       +Q+  D  S  I  +  L+ EL+  Y F  L      Y+  VR + +   + V+D NDN PIF    Y+ ++P     G+ +LKV A DAD     +  Y   + N  V + F I   +G +S  QSL+          V A D  +   +     +E+ I +     P++     +  + Y + + EN+P                  K  FS    ++D GI ++ + S  +RV +  LL+  +                             +      R + S  + +      EI  +     + +P L S   + I + D N+  P         +  E   +  F+  + A D D G  A LRY + D      F I      I+ +N+ LD+E+ D  K K+  TD  +   T T  + V I+D NDN P F      T+ E       + T I A D D      ++ +RL     + +++ +  IF +    G++     +D E    Y L ++A D  +  +   T +T+ V D NDN+PV+++  PP+  +  P A   IS+  ++   +  + A D D +  G  S VI   E   +G    +++ ++G++S++   L     S G   ++I A D G P LK+   L +   Q NDN
Sbjct: 1961 VQEDAPLGTSVVQISAVDADLG-VNARLVYSLANETQ------WQFAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYE--VRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPP-QSSLGLIELLIGEAPQGTPVLR----FQNETYRVMLKENSPSGTRLLQVVALRSDGRRQKVQFSFGAGNED-GILSLDSLSGEIRVNKPHLLDYDRFSTPSMSALSRGRALHYEEEIDESSEEDPNNSTRSQRALTSSSFALTNSQPNEIRVVLVARTADAPFLASYAELVIELEDENDNSPKFSQKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGIVRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNNLVTVSEATEL-GAVITSISANDVDTYP---ALTYRL--GAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAAHEAR---TVLTVRVNDENDNAPVFLAQQPPAYFAILP-AISEISESLSVDFDLLTVNATDADSE--GNNSKVIYIIEPAQEG---FSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALKSSTLLRV---QANDN 2641          

HSP 8 Score: 107.071 bits (266), Expect = 7.835e-23
Identity = 127/482 (26.35%), Postives = 208/482 (43.15%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDA------LSVTFKK----------------DYADVEIEIEDVNDNYPIISLLHGYMPDP-YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKA---IKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDS-LINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPV 2192
            +IVQ    ++N P F++  Y   I E+ P G  +L+VTAK    +      Y   +      +F+++ + G+I+ +       ++ Y+  VY  DA       S   +K                D A + I + DVNDN P       + P   Y + + EN+ P  + ++  SD D G NA +  S  +   +L      D    ++ + R  D E       +I   D G P   SR+    I I + D N+  P  + +    S +E+ P    ++ I A D D G  A L YSL    +  F I+ ++G +I +   LD+E+  S  F V  TD       +AT+ V + +LD NDN P F     +  +P  IQ G +       +++A DAD    N  I++ L    N +   +  K     S G +    ++  E      L ++A+DKGNPP+S+   I + + +    +PV
Sbjct: 1707 LIVQ--GSHNNPPRFLQAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEIPAGV-ANDLFHVDWQRGIITTRGQFDRESQASYVLPVYVRDANRQSTLSSSAVRKQRSSDSIGDTSNGQHFDVATIYITVGDVNDNSP------EFRPGSCYGLSVPENSEPGVIHTVVASDLDEGPNADLIYS--ITGGNLGNKFSIDSSSGEL-SARPLDREQHSRYTLQIQASDRGQPK--SRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQFAIDGQSG-LITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQPGQTLL-----KVQALDADLGA-NAEIVYSL----NAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPV 2163          

HSP 9 Score: 88.9669 bits (219), Expect = 2.786e-17
Identity = 108/407 (26.54%), Postives = 171/407 (42.01%), Query Frame = 3
Query: 1149 FKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRI------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLP----------FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRL--------LHTYNNKMELLHEKIFD-VSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSS--EPEARFNISKEAAIGSIVAQL 2285
            F   YA++ IE+ED NDN P  S         +   + E     T  + +H  D D G NA +   +     D   +I+       +RT    D EI  + + +I+  D G P +     I++ IVDVN+ +P+   N   ++  E       I SI A+D D    L Y L     +       F ++  +G++++    LD E+    +  V  +D+    H A   +TV + D+NDNAP F+   P            I E LS    L T + A DAD +  N  +I+ +        +H  N  + +   ++   VSS G+              Y + I+A+D G P   +S   T+  +  NDN        S  S   + + R  IS+ A +GS+V QL
Sbjct: 2301 FLASYAELVIELEDENDNSPKFS------QKQFVATVSEGNNKGTFVAQVHAFDSDAGSNARLRYHIVDGNHDNAFVIEPAFSGI-VRTNIVLDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPN-NLVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKR-RLDYELQQEYELDVIASDA---AHEARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLT-VNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGD--------------YFVRIIAKDAGKPALKSS---TLLRVQANDNG-------SGRSQFLQNQYRAQISEAAPLGSVVLQL 2670          

HSP 10 Score: 84.7297 bits (208), Expect = 4.186e-16
Identity = 75/297 (25.25%), Postives = 128/297 (43.10%), Query Frame = 3
Query:  762 RSLNYELKQIYFCKLKVCD----KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR--NNFEELSFKENIPEHKFIMSIDASDKD 1634
            R L+ E    Y  +++  D    K+ Q     +I V+  D+NDN P F   KY   + E  P+G  +++++A DAD  +  +  Y   +    +  F I+ +SG+I+    L    ++ Y F V A D      +     V+I + D+NDN PI          P  I+     P +TL  +   D D G NA +  SL      +    + +     +   +S   E  +L+  E++  D G+P   S   I+++I +  +  P +R  N    +  KEN P    ++ + A   D
Sbjct: 1907 RPLDREQHSRYTLQIQASDRGQPKSRQGHCNITIFVE--DQNDNAPRFKLSKYTGSVQEDAPLGTSVVQISAVDADLGVNARLVYSLANETQWQ--FAIDGQSGLITTVGKLDRELQASYNFMVLATDGGRYEVRSATVPVQINVLDINDNRPIFERYPYIGQVPALIQ-----PGQTLLKVQALDADLGANAEIVYSLNAENSAVSAKFRINPSTGALSASQSLASESGKLLHLEVVARDKGNPPQSSLGLIELLIGEAPQGTPVLRFQNETYRVMLKENSPSGTRLLQVVALRSD 2194          

HSP 11 Score: 79.337 bits (194), Expect = 2.209e-14
Identity = 151/626 (24.12%), Postives = 253/626 (40.42%), Query Frame = 3
Query:  591 KLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVE-KKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPII---SLLHGYMPDPYAIRIDENTPP--KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEM-IKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAI--KIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA-------ILRY-----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTAT------MFVTVTILDQNDNAPQFV-------HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETV-----VTIDREKDSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVI 2336
            ++ E +   + + +  A D D  + N    Y     + +FQ+      P    I     L+ EL+++Y   ++  D+ T     R  + + V D NDN P   + ++ +V + E  P G ++++V A D D        Y      + +   +F+I+  SGVI  +  L   ++S Y   V A D  +   ++    + +E+ D+NDN P     SL+     D     +  +  P  +    +  S +++  +  V  +L    KDL+E     D     +   R  D E+      EI  +D+ +       AI  KI + DVN+  P    +  +L   E  P    I +  A+D D G        ++RY        E     F ++S TG + +    LD E   +V+  + I  +L      T      + V + ILD ND+AP FV        T    I +      ++   I A D D  + N  + + +  T  N      E  F ++S+ G IE V      T D EK   + L I A+D G P PK +S N+ + V   ++N P ++        +   R  I +    GS V Q+ A      +   +SY I
Sbjct: 1161 RIEENLRRGSVVGVVTASDLDLGE-NAAIRYSLLPINSSFQV-----HPVTGEISTREPLDRELRELYDLVVEARDQGTPVRSARVPVRIHVSDVNDNAPEIADPQEDVVSVREEQPPGTEVVRVRAVDRDHGQNASITYSIVKGRDSDGHGLFSIDPTSGVIRTRVVLDHEERSIYRLGVAASDGGNPP-RETVRMLRVEVLDLNDNRPTFTSSSLVFRVREDAALGHVVGSISPIERPADVVRNSVEESFEDLRVTYTLNPLTKDLIEAAFDIDRHSGNLVVARLLDREVQSEFRLEIRALDTTASNNPQSSAITVKIEVADVNDNAPEWPQDPIDLQVSEATPVGTIIHNFTATDADTGTNGDLQYRLIRYFPQLNESQEQAMSLFRMDSLTGALSL-QAPLDFE---AVQEYLLIVQALDQSSNVTERLQTSVTVRLRILDANDHAPHFVSPNSSGGKTASLFISDATRI-GEVVAHIVAVDEDSGD-NGQLTYEI--TGGNG-----EGRFRINSQTGIIELVKSLPPATEDVEKGGRFNLIIGAKDHGQPEPKKSSLNLHLIVQGSHNNPPRFL--------QAVYRATILENVPSGSFVLQVTAKSLHGAENANLSYEI 1758          

HSP 12 Score: 75.0998 bits (183), Expect = 3.667e-13
Identity = 137/589 (23.26%), Postives = 243/589 (41.26%), Query Frame = 3
Query:  768 LNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK--SIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAI-----RIDENTPPK-TLFSIHVSDKDT-GINAVVNCSLRVRRKDLL-----EMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSI------DASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH----------TATMFVTVTILDQNDNAPQFVHTLPFTIQ-EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPP------SLNSSEPEARFN-----ISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILS 2405
            L+ E++ IY  K+   D+   Q     +I VQ++D NDN+P F     LV + E+  +G  I  ++A D D+        G +S  +++  SIF +++ SG + LK+ L    +  Y   V A DA      +    + + + D NDN P+   L    P  +AI      I E+      L +++ +D D+ G N+ V   +   ++         ++  +M   Q     S DY +       I+  D+G PAL S   +++   D      S R+ F +  ++  I E   + S+      DA D+    I        G           + I+    LD+E ND  K ++ ++    +PH          ++ + V +TILD NDN P F  +  +  +   L+       +++A DAD++   +S                 E ++D++S G  E + TID      +    L  D G    + S  + I   D +   P+    P        N +EP+         +++   +GS V +  A D D+  FG+++Y I    S     +   ++  SG+++
Sbjct: 2386 LDREIRDIYKLKIIATDEGVPQMTGTATIRVQIVDVNDNQPTFPPNN-LVTVSEATELGAVITSISANDVDTYPALTYRLGAESTVDIENMSIFALDRYSGKLVLKRRLDYELQQEYELDVIASDAA----HEARTVLTVRVNDENDNAPV--FLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEPAQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFV------RIIAKDAGKPALKSSTLLRVQAND----NGSGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAII-------AGNEESAFELLQSKAIVLVKPLDRERNDLYKLRLVLS----HPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNS-----------------EVVYDITS-GNDEHMFTIDLVTGVLFVNNRLDYDSG----AKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSDESSWKMFRVDSESGLVT 2924          

HSP 13 Score: 75.0998 bits (183), Expect = 3.990e-13
Identity = 87/285 (30.53%), Postives = 127/285 (44.56%), Query Frame = 3
Query: 1683 FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
              I+  TGEI  + V LD+E   S    V I  S  N     + V VT+ D+NDNAP F  T +     E      K  T + A+D D +  N      +    N+   L   +  D     +++    +DRE    Y+L I A D G PP      + IT+ DVNDN P++      N S   A   + + A +G+ V Q+ A D D D+ G + Y I   +S    EQ   ++  +G + I++      + L  L + A DHG  PL+  A + I V   NDN
Sbjct:  123 LAIDRATGEI-RTKVKLDRETRASYSL-VAIPLSGRN-----IRVLVTVKDENDNAPTFPQTSMHIEFPENTPREVK-RTLLPARDLDLEPYNTQRYNIVSGNVNDAFRLSSHRERDGVLYLDLQISGFLDRETTPGYSLLIEALDGGTPPLRGFMTVNITIQDVNDNQPIF------NQSRYFA--TVPENATVGTSVLQVYASDTDADENGLVEYAINRRQS--DKEQMFRIDPRTGAIYINKALDFETKELHELVVVAKDHGEQPLETTAFVSIRVTDVNDN 389          

HSP 14 Score: 58.9214 bits (141), Expect = 3.275e-8
Identity = 136/592 (22.97%), Postives = 241/592 (40.71%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKK---YLVKIP------ESYPIGKKILKVTAKDADSSLFN-KTFYGFQSNYNVKSIFNIEKESGVISLKQSL---SINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP------ALLSRKAIKIIIVDVNEFEPSI-RNNFEELSFKENIPEHKFIMSIDASDKDK----GAILRYSLDEIGRIY-FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDS-LINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTIQEGLSFYSKLSTRIEAKDADK---DEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI--GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ 2414
            +++ R L+YEL+Q Y   +   D  ++   R  + V+V DENDN P+F+ ++   Y   +P      ES  +   +L V A DADS   N K  Y  +     +  F++   +GV+S+  S    +++    Y   + A DA     K   +   + ++  NDN    S    ++ + Y  +I E  P  ++      D      A++  +     +   E++++      I  ++  D E   L +  ++      P         S  ++ I I+D N+  P   R+   E    E  P    I  + A D D+     + + Y +      + FTI+  TG + ++N         S +  +   DS    P  +     + + D+NDN P+F     VH L      G S +     R  A D DK    ++N+SI            +    K+F V S+ G + +    D E+   Y + +LA D G    S +  + I   D  + +P +        +E   RF +    A+  G +V Q+ A D D    G++ Y + +  SH++      +N +SG + I +
Sbjct: 2487 LVLKRRLDYELQQEYELDVIASDAAHE--ARTVLTVRVNDENDNAPVFLAQQPPAYFAILPAISEISESLSVDFDLLTVNATDADSEGNNSKVIYIIEP---AQEGFSVHPSNGVVSVNMSRLQPAVSSSGDYFVRIIAKDAGKPALK---SSTLLRVQ-ANDNG---SGRSQFLQNQYRAQISEAAPLGSVVLQLGQDALDQSLAIIAGN----EESAFELLQSK----AIVLVKPLDRERNDLYKLRLVLSHPHGPPLISSLNSSSGISVIITILDANDNFPIFDRSAKYEAEISELAPLRYSIAQLQAIDADQENTPNSEVVYDITSGNDEHMFTIDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHHQRPLCSLQPFRLELHDENDNEPKFPLTEYVHFLAENEPVGSSVF-----RAHASDLDKGPFGQLNYSI-------GPAPSDESSWKMFRVDSESGLVTSAFVFDYEQRQRYDMELLASDMGGKKASVAVRVEIESRD--EFTPQF--------TERTYRFVLPAAVALPQGYVVGQVTATDSDSGPDGRVVYQLSAPHSHFK------VNRSSGAVLIKR 3030          
BLAST of Protocadherin 11 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0346077)

HSP 1 Score: 152.91 bits (385), Expect = 7.203e-37
Identity = 167/646 (25.85%), Postives = 287/646 (44.43%), Query Frame = 3
Query:  582 QIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCD-KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNE--FEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK---GAILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKD---EINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETV-VTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            Q + ++E + +  +++   A D+D    N K  +   D        V++ DPD   + ++  L+ E +  Y   + V D         K + + ++D NDN P+  +     ++ ES  IG  +  + A DADS +  +  Y         S F +   +G + L + L   K+  Y   + A D  S     + A V + ++DVNDN P+  +        Y  ++ E+ P  T+ + I   D+D G NA +  SL+   +D  E+ + D     IRT    DYE  Q+    +  ID G P+L S  +I I+I+DVNE  F P   +   E   KEN P+  F+M++ A D D     + + YS+   D +G   F +N +    I S   LD E  +     +   D  I P +  + V + + ++NDN P     + +      S  +     ++A D D D    I ++I+   L  Y           F++ SK G I+T    +DRE  + + L +   D G+P  S+++ I ++V+D+NDNSP +         +   +  +   A +   + Q+ A+D D  + G+I+Y I S     +G+    ++   G + I +   S     + I A D+G P
Sbjct:  777 QELSINESVQLGETVAWIEAKDRDLG-YNGKLVFAISDGDYDS---VFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVEC---SDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE-ALVYVLVDDVNDNAPVFGVQE------YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQD-EELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG--IFAVNDQGS--ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGY-----------FEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF--------DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSG----KGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIP 1380          

HSP 2 Score: 149.828 bits (377), Expect = 7.325e-36
Identity = 135/492 (27.44%), Postives = 228/492 (46.34%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY---SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVS 2201
            + + + L+ E  Q+ F  L +     +   + ++ + V D NDN P  ++ +Y +   ES  IG  +++V A D D   F      + S       F+I KESG++ +  +L      +Y    +  D    T ++ ++++ I + D+NDN PI S+        Y + + E+    TL + +H  DKD G+N  +  SL     D  ++ K+      IR  +S D E + L    +   D G P L S   + + I+D+N+  P            EN      +  + A+  D G  A + Y   S +E G+  F ++S TG++++ N TLD EM+      +   D    P +   +V ++ILD NDN+P F+  L    + E +   SK+   ++A D D D +N  + + +    N          F +  K G I     +DRE  S+YTL I A D+G+P +  S  I I ++D NDN+P++ S
Sbjct: 3022 LFIAKPLDRE--QLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGADD-FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFT-QECFSEIIITVNDINDNMPIFSMAQ------YRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKS---TGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGK--FKMDSTTGDLVL-NATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKI-LDVKATDEDSD-VNGLVTYNIERGDNIGQ-------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSS 3485          

HSP 3 Score: 126.716 bits (317), Expect = 7.631e-29
Identity = 163/635 (25.67%), Postives = 278/635 (43.78%), Query Frame = 3
Query:  843 KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSV-TFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQ--IRTIRSFDYEILQL-IEAEILCIDSGSPALLSRK-AIKIIIVDVNEFEPSIR--NNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL---DEIGRIYFTINSRTGEI---------IMSNVTLDKEMNDSVKFKVFITDSLINPH--------------------------TATMFVTVTILDQND---NAPQFVHTLPFTIQ---------EGLSFYSKLS-----------TRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            KS+ +Q+  E+ N PIF ++ Y V IPE+ PI   ++++   D D    N   Y      N    F I  +SG++   + L   KKS Y  TV AID  +V + K+  A V+I ++D+NDN PI   ++        I I+EN    + +  +   D+D+G N+ ++ S+       L  +  +++ +   ++T    D+E ++   E  I   D G P     +  + I++ D+N+  P     N + +++    +    F+ S  A D D G I+ Y L   +E G   F ++  +G +          ++N  L     D   F     D +IN H                             +  T+++ ++N+    +P     L  T           E ++F  +LS             IEAKD D    N  ++F +        +  ++ +F +   +GE++ +  +DRE+ + Y L I   D GNP KSTS  + IT++DVNDN PV          +  A F +++ A IG++V  L A D D     +++Y +    S +      T+N T+G L +++ PL   +     L I+A D G P L + A + + V   NDN
Sbjct:  384 KSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGK-NALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK------VISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN-----LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTS--AIDFDAGDIISYRLSDGNEDG--CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFS---DDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLG-YNGKLVFAI-------SDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVI--------QKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDF------TVNATTGCLRLNK-PLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDN 976          

HSP 4 Score: 120.939 bits (302), Expect = 4.471e-27
Identity = 130/503 (25.84%), Postives = 231/503 (45.92%), Query Frame = 3
Query:  747 SIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKS--IFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYP--IISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK--GAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVK-FKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-----TLPFTIQEG-----LSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPP--KSTSTNITITVIDVNDNSPVW 2195
            +I++ + L+YE +Q Y   + V D T+      +++VQVID NDN P F +  Y V I E+      I+++ A D D     K FY   +  +  S  +F I+  SG + + Q L   K ++++  V+  D      K++YA + + + D ND++P     ++   +P+  AI          L  +   D+D+G NA +  S+     ++  + + D     I    + +   +Q    ++  +D G+P L S+  + II+       P    N   +   EN+P   F+  + A         I+  +++E     F IN  TG I++ N  +D E   S+K F + +  + +   ++   + + ILD NDN P FV       LP +   G     +   SK    ++ KDAD   +N  + + ++       + L +  F + S+ G IE +  +D E ++ YT  +   D G P    +T+ ++TI VI+VND  PV+
Sbjct: 1460 NILLSKYLDYETQQSYNLTISVTDGTF--TAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDED--KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQ-GAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIG-------SKLAEVRAIDRDSGHNAEIQYSIIT--GNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINE----SFRINPSTGVIVI-NGNIDYE---SIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG-VNGMVEYHIV-------DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF 1932          

HSP 5 Score: 117.087 bits (292), Expect = 7.412e-26
Identity = 170/682 (24.93%), Postives = 298/682 (43.70%), Query Frame = 3
Query:  453 DKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKT--YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK--GAILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEG-LSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMST-ESHYQGEQFLTL-NETSGILSIHQHPLSYGRTLLKISAHD 2462
            D+E+ +     ++    ++ +  +++++VKD++DN P  L  +  I  +E ISI T++    A+D DF     +   +F+        F    +  IL   V  +L+ E    Y     V D     Q C  + II+ V D NDN PIF   +Y V +PE   +   I KV A D D  +  +  Y      +    F I K +G+I L +SL     S +  TV A D   V      A V + I D+NDN P  S+        Y+ +I EN    T +  ++ +  D G+NA ++    +   +     K D     +    + DYE+ +     I  ID G+P L +   + I I+D+N+  P+   N   ++  E+I     I+ + A+D+D     ++ Y++   D IG+  F+I+ + G I +S   LD+E       ++   D        ++ + + ILD NDNAP F  +     +QE  L  Y  L+ +I    +D DE  ++  +       N+  L     F +   G + T    +      + + +   D G PP  +   + + +I+ +   P+ V+P  +  +  E  F+       G+ + ++ A   DQD + ++++ ++S  +  YQ  +   + N T  I +I    L  G   L +S  D
Sbjct: 3029 DREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-----QSKLRFYLSGKGADDFSIGKESGILK--VASALDRETTPKYKLVAHVQDGKDFTQECFSE-IIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENH--DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDC-GVPKLHSIATVAVNILDINDNPPEFSMRQ------YSCKILENATHGTEVCKVYATSIDIGVNADIH--YFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ--FSIDPKNGTISVSR-PLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKI----SDADETPNTTPYTFDIRSGNEGGL-----FRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI-VTPLEVTINSFEDDFS-------GAFIGKVHA--SDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISN--LDIGLYKLNVSVSD 3667          

HSP 6 Score: 112.464 bits (280), Expect = 1.650e-24
Identity = 154/576 (26.74%), Postives = 253/576 (43.92%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNY-NVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDY-ADVEIEIEDVNDNYPIISL-LHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAP-----QFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLL---HTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++ V DENDN P F    Y   + E+      ++KV+A DAD+       Y  +S+  N+++IF+I+  SG I+L  SL    +S Y F V A D  +   K D    V I+I D NDN P+  L + G       + + EN  P T L ++ + D D     +    +   ++   ++ K+     ++   +  D E L      I+  D       ++  ++I + D+N+  P        +S  E+I     ++ + A D D  + LR+ L   G   F+I   +G I+     LD+E     K    + D           + +T+ D NDN P     Q+  ++P   Q      + L T++ A D D   +N  I + L+   H Y           F +S S G I    ++DRE  S + LT+ A+D G P   +   + + ++D+NDN      PP  +  +   +  I + A  G+ V ++ A   D      I Y IMS   + QG+    ++ T+G L ++   L Y  +    L I A D G PPL N A + I++   NDN
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD--NGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEG-------LSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG----ELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESG-ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQ-----LNTLITKVHAMDKDFG-VNRQIKYSLMGENHDY-----------FKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDN------PPEFSMRQYSCK--ILENATHGTEVCKVYATSIDIGVNADIHYFIMS--GNEQGK--FKMDSTTGDLVLNA-TLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDN 3374          

HSP 7 Score: 107.457 bits (267), Expect = 6.572e-23
Identity = 138/565 (24.42%), Postives = 249/565 (44.07%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKK-SRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++I+ + N P F +   L+KI ES P G  + K+      +  F  +    Q ++ +        +SG + L+Q+L   ++ S  L  V     + V F   YADV I++ D NDNYP            Y+  + EN+    +L  +  +D DTG N  +   L    +++  +   D+    I  + S D E+      +++  D+G P   ++  + I IVD N+  P  +   E LS  EN      ++++   D D  K  +  + +    +  F I  ++GE+ ++   LD+E        +  TD      TA   V + + D NDN P  +      +  E +S  + L   +E K  D D     + F L     +   +  E        G ++    +DRE    Y L    QD  +  +   + I ITV D+NDN P++        S  + R ++ ++A + +++ ++ A+D+D     +I Y +M  E+H     +  +++++GI+ +H+       +L  L + A D G P L + AT+ +N+   NDN
Sbjct: 2751 IEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM--IGNYTFKFSIAADQDHFMIS-------DSGELILQQTLDREQQESHNLIVVAETSTVPVFFA--YADVLIDVRDENDNYPKFDNTF------YSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAK-PLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTL---VEVKAIDFD-FQSKLRFYLSGKGADDFSIGKE-------SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF--------SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMG-ENH----DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDN 3269          

HSP 8 Score: 100.523 bits (249), Expect = 7.020e-21
Identity = 156/623 (25.04%), Postives = 276/623 (44.30%), Query Frame = 3
Query:  729 YDPDILS--IMVMRSLNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDP-YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL---SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN--LFSGLNMAIII 2561
            +D DI S  I ++ SL+ E++  Y  K+   D  + ++  +  + ++++D NDN P+F      + + E+   G  ++ +   D D       F+    +   +  F I K SG + + + L   +   Y  ++ A D    T K   A+VEI+++D+NDN P       Y   P Y I  +E+    T   + V   D    + +   L  +  D   + K   E   ++   + D E     +      D           I I + D+N+  P        +S  E+   +  I  + A DKD G    ++YSL      YF I+  TG II  + +LD+E        V   D  +    +   V V ILD NDN P+F +      I E  +  +++  ++ A   D   +N  I + ++ + N + +   +     S+ G++    T+D E    Y LTI A D G PP S +  + I+++D+NDNSP ++        +   R N++++  +GS +  +KA D+D D  G ++Y I   ++  Q     +++  +G +S+ + PL   +     L+I A D G P   N   + IN+   NDN  +FS  N ++++
Sbjct: 2910 FDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQ--FQIGK-SGELFIAKPLDREQLMFYNLSIIATDG-KFTAK---ANVEIDVKDINDNTP-------YCLKPRYHISTNESISIGTTL-VEVKAIDFDFQSKLRFYLSGKGADDFSIGK---ESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTG-IIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEV-CKVYATSIDIG-VNADIHYFIM-SGNEQGKFKMD-----STTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL--------QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ----FSIDPKNGTISVSR-PLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVL 3492          

HSP 9 Score: 97.8265 bits (242), Expect = 5.556e-20
Identity = 152/570 (26.67%), Postives = 236/570 (41.40%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF--QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDY----ADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP---PKTLFSIHVSDKDTGINA-VVNCSLRVRRKDLLEMIKAD-------MEIYQIRTI--RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITD--SLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREK-DSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIH--QHPLSYGRTLLKISAHDHGH 2471
            +I ++V+D ND  P+F   +Y V IPE  P  + ILKVTA DAD  +  + +Y     S Y     F I   +G I+L Q L   + S +  TV A D  S    +++      V I ++ VN           Y P+ +       TP   P     + V+DKDTGIN  +    +     D   ++KA        +E+ Q   +  + F Y +  L E      D G+P   + K++ I I   ++  P       E+S  E  P +  ++ +  SD D G      L+ +G      F IN  +G ++ +   LD E   S    V   D  ++ +   ++  V +++ D NDN P F +          +       ++ AKD D  E N  I + + +      E+ H         G ++T   +D E    NY L I A D G P  + T   ++I V D+NDN P +                ++K A +G+ V    A+D D  D   ISY +    S    +    L+ TSG LSI       +    +LK+SA D  H
Sbjct:  168 NIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEY-----FAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVN----------FYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAE------DLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSG-MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGE-NSYISYSIANLNAVPFEIDH-------FSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF--------ERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRL----SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH 693          

HSP 10 Score: 92.8189 bits (229), Expect = 1.586e-18
Identity = 129/517 (24.95%), Postives = 215/517 (41.59%), Query Frame = 3
Query:  711 QLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRR-----KDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIP------------EHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            +L  Y  D     I +   LN+  K      + V D  +    R  + + ++ EN   P+F +  Y  ++PE+   G  I+ V A D D   +   +Y   S   +K IF I++ +GVI+ K +    KK  Y+  +   D      K  +A +++ + DVNDN P   L    M     +  ++     T+ ++   D D   N  V+  +  +      KD++E+ +   +I       S+     Q     +   D G P   S   + I I++ +   P+   +   L   E+ P             + F  SI A+D+D               +F I S +GE+I+   TLD+E  +S    V    S +    A   V + + D+NDN P+F +T    ++ E       L  ++ A DAD    N  I + L     N      + IFD+    G I  + ++DRE  S Y   ++A D G+P       +TI ++D NDN+PV+  P
Sbjct: 2493 ELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYAR--LKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE-EMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGG---KFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQ-----TILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFF---VRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGNYTFKFSI-AADQD---------------HFMI-SDSGELILQQ-TLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISL-VKVSATDADTGP-NGDIRYYLESDTENI-----QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 11 Score: 90.1225 bits (222), Expect = 1.192e-17
Identity = 118/437 (27.00%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1242 PYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXF-GKISYVIMSTESHYQGEQFLTLNETSGILSIHQ-HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
            P  + I+E+    +T+  I   D+D G N  +     +   D   + + D +  +++ I   D E        I   D G+P   + K + I I+DVN+  P I+         E+      +  + A+D D G  A + Y+L  +    FT+N+ TG + + N  LD+E  D+    +   D      ++   V V + D NDNAP F V    F ++E L   + L+  IEA D D    N  I F L      K E   E++F +    G I T   +D E    + L + A D G+P  ++  +I I +IDVN+N       P  +    E +   +K    G+ V  + A D D  D   KI+Y I   +    G     +N+   I S+ Q    +     L + A D    PL N   + I V+  NDN+
Sbjct:  776 PQELSINESVQLGETVAWIEAKDRDLGYNGKL--VFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL-SVECSDFTVNATTGCLRL-NKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAV-IEAVDEDIGP-NAEIQFSL------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENR----FAPEFDDFVYEGKVKENKPK--GTFVMNVTARDMDTVDLNSKITYSITGGD----GLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNI 1190          

HSP 12 Score: 88.5817 bits (218), Expect = 3.723e-17
Identity = 146/584 (25.00%), Postives = 244/584 (41.78%), Query Frame = 3
Query:  828 QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYA-DVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG-------AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTAT-MFVTVTILDQNDNAPQFVHTLP-FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDNLFS 2537
            Q  ++ SI+V+  D NDN P F       K+ +S P+G ++   +A D D+   +   Y   S+ N    FN++  SG +S+   L     +  +  V A D     F  D   +V +  ED+  +    S+LHG+    +  R                  +TG+          RR                        E L L  AE   + S SP++ S  ++       N   P   N  +ELS  E++   + +  I+A D+D G       AI     D +    F I+   GE+ +    LD+E  +     + + D L NP  +T   + +TILD NDN P    TL  F + E     + +   + A DAD   IN  + + L    ++         F V ++ G +     +DREK  NY L I A+D G+P  S+   + + V DVNDN+PV+           E  F + ++   G+++A ++A+    +D G  + +  S +   Q E+   +++ +G +    + L Y       L +SA D G P L +  +++I +   N+N F+
Sbjct:  594 QTEIKLSIVVK--DINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRL-SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDG--THFSDDLIINVHLMPEDLGGDS---SILHGF--GSFECR------------------ETGV---------ARRL----------------------AETLSL--AEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSV----FRIDPDRGELQIIGY-LDRERQNEYVLNITVYD-LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHC-LHATDADSG-INAQVTYALSVECSD---------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVF--------GVQEYIFKVREDLPRGTVLAVIEAV---DEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGY-LDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFA 1085          

HSP 13 Score: 86.2705 bits (212), Expect = 1.803e-16
Identity = 92/364 (25.27%), Postives = 168/364 (46.15%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAV-VNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL----DEI--GRIYFTINSRTGEI-IMSNVTLD-KEMNDSV---KFKVF 1772
            ++ D     +++  +L+YE+ + YF  ++  D         + + + ++D NDN P F++  Y + + E   +G KIL V A D DS +     Y  +   N+   F+I+ ++G IS+ + L     S Y   + A D      + +   + I I D NDN PI S         Y++ + EN     +F +  +SD D   N       +R   +  L  ++ D     +RT   F++ +      ++   D+G+P L S   + + I++ +++ P +      ++  E+     FI  + ASD+DK   L +SL    D++      F I++ TG+I  +SN+ +   ++N SV   KF VF
Sbjct: 3321 FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQ-RCNSVPININILDTNDNAPIFS------SSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDG---SLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGLYKLNVSVSDGKFHVF 3673          

HSP 14 Score: 84.7297 bits (208), Expect = 5.353e-16
Identity = 106/397 (26.70%), Postives = 175/397 (44.08%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTG------INAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD-------------KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH---TATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTR-IEAKDADKDEINHSII 1970
            IIV V D ND+ P F  K    K+PES  IG K+ +V A D DS    +  Y   +  NV S+F I+   G+I+L  +L+INK   Y+  V A+D  +         V I I  +++N P       +  +  AI I EN P  T F   V+ + +       I+  +N S R+     + +I  ++           DYE +++    +   +  + +  S + I I I+D N+  P    N    +  E+     +++ +  S KD              G +  + +D++ + +F I+S TG I +    LD E N    F V ++D +  P    T T  VT+ +++ ND  P F +     +   L  +  +  R + AKDAD D +   I+
Sbjct: 1598 IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITG-NVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIP-VHI-IVTMSENDP-----PKFPTNNIAIEIFENLPIGT-FVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNI-----------DYESIKVFNLTVKGTNMAAES--SCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLR-QLDYETNAGYTFDVTVSD-MGKPKLHSTTTAHVTIRVINVNDCPPVF-NERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIV 1969          

HSP 15 Score: 77.0258 bits (188), Expect = 1.033e-13
Identity = 120/475 (25.26%), Postives = 217/475 (45.68%), Query Frame = 3
Query: 1131 DALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIK--ADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI-MSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYN--NKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGE-QFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPN 2522
            D ++   ++    ++I + DVNDN P+      ++  PY   +  + P  T+   +   D D+  N  V   L+    +L ++ +   ++ I Q     + +YE+       +   D       S   +++ ++D +   P     F  +S KE++  +  + +SI+A +   G  L Y++    +  F I+  TG I + N  LD E   S    +  TDSL   + A + ++V+I+D ND  P+    +   TI E  SF +++  +I A D D     ++ +   + + N  N  EL +  + D    G +     +D E+   + + +  +D G+P  S+ +N+ ITV D+NDN+P +V        EP     +S  A  G  VA  KA D+D  D   + Y I+     Y  E Q  ++++ +G++S+ Q+ L++     T+L IS  D  H     YA L I++   N
Sbjct: 2113 DGMNSNVRRAVTSIDISVLDVNDNCPL------FVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELT------VAAYDGAITPCSSEAPLQVKVIDRSM--PVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTISSESQ-SFEIDYNTGSIFVVN-ELDYEKISSHDVSIRATDSLSGVY-AEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQI-LKINATDNDSGA--NAKLSYYIESINGQNNSELFYIDVTD----GNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV--------EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIV-----YGNELQTYSIDKLTGVISL-QNMLNFTDKSSTVLNISVSDGVHTA---YARLKISLLPEN 2545          

HSP 16 Score: 73.9442 bits (180), Expect = 1.058e-12
Identity = 125/530 (23.58%), Postives = 223/530 (42.08%), Query Frame = 3
Query:  591 KLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDE-NDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPD----PYAIRIDENTPPKT-LFSIHVSDKDT-GINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDK--DKGAILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLST-RIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTST 2147
            +L+E   I T +    A D D S IN +  Y    E   F +     +     + + + L+ E +  Y   +   D        ++++  ++D+ NDN P+F  ++Y+ K+ E  P G  +  + A D D     +  +  +     + +F I+K +G I  +  L    K  +   V AID    +   D + V I I DVN+N         + P+     Y  ++ EN P  T + ++   D DT  +N+ +  S  +   D L +   + +   I ++   D E        +   D     L +   + I + + N+  P        ++  E   E+  I+++ A D   D    + Y++     + YF I+S+TG I  +   LD+E       +V I+D+     ++T  + V++LD NDN+P+F   + + +Q   S     S  ++ A D+D  E N  I      TY+ K      K    S +G I     +D   D+ + + I A+D G P KS + 
Sbjct:  885 RLTESARIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTV-----NATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIV-IMIIDVNENR--------FAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYS--ITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRV-YKVQVPSSATVNQSIFQVHAIDSDSGE-NGRI------TYSIKSGKGKNKFRIDSQRGHIHIAKPLD--SDNEFEIHIKAEDNGIPKKSQTA 1386          

HSP 17 Score: 72.0182 bits (175), Expect = 3.748e-12
Identity = 109/475 (22.95%), Postives = 204/475 (42.95%), Query Frame = 3
Query:  615 NTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIY--FCKLK--VCDKTYQNCVRK--SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKD---ADKDEINHSIIF-RLLHTY 1991
            NT ++  G ++   + +++   Y+  + +  F + +         ++  R    E+K +Y  F + K  + D    N  R   SI + V+D NDN P+FV   Y   +    P G  I++V A D DS+   +  Y  +       +F ++++SG +S+KQ +  + ++ Y  TV A D  ++T     A +++++  ++ + P+      +    Y + + E+    +  S+ +  +     + +  SL        +  + D     I  +   DYE +   +  I   DS S  + +   + + I+DVN+  P I ++   L+  EN      I+ I+A+D D G  A L Y ++ I        F I+   G + +    LD E        V + D      ++   V +T+ D NDNAP FV    FT     +   +     +A D   +D D + + I++   L TY
Sbjct: 2046 NTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDR----EVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG--ELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDG-AITPCSSEAPLQVKV--IDRSMPV------FEKQFYTVSVKEDVEMYSALSVSIEAE-----SPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLK-TPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY 2497          

HSP 18 Score: 60.8474 bits (146), Expect = 9.025e-9
Identity = 149/641 (23.24%), Postives = 262/641 (40.87%), Query Frame = 3
Query:  681 YQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYP-IISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKAD--MEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKD------ADKDEI--NHSIIFRLLHTYNNKMEL----LHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHY----QGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            Y    ES +F++     D +  SI V+  L+YE    +   ++  D          + V ++D ND  P      Y + IPE+   G +ILK+ A D DS    K  Y  +S    N   +F I+   G + LK  L   +   +   V   D  S +     ++V I ++D+NDN P  +   +       A+R      PK  +   +SD D+          ++   + L+    D    +  ++ + +F  +      + +L I        +   +KI ++  N + P    +  E    EN+     I+++ ASD D G  A L Y +  +E+ +I F I+  TG +I S VT D+E  D     + ++D       A++   V ++D NDN P F+      ++E   +   +ST +EA        A  D+I  N S+ F+++   N+K       ++EK  D+  K + E+         ++Y   + A D+G P   +   ++I +I+ + N P +     L          I +    G+++ +L  +      F      I + + H+     GE  L L +T        H L        + A     P    YA ++I+V+  NDN
Sbjct: 2276 YTISSESQSFEI-----DYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSS-RSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKA-YDKDISDTDS-------LEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDK-----SSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKI-FLIDQTTG-VITSKVTFDREKKDEYVVLLKVSDGGGKFGFASL--KVIVVDVNDNVPYFL------LKE---YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGV------NSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVL--------LKIIESTPPGTVLTKLHMIGNYTFKFS-----IAADQDHFMISDSGE--LILQQTLDREQQESHNLI-------VVAETSTVPVFFAYADVLIDVRDENDN 2856          

HSP 19 Score: 59.6918 bits (143), Expect = 2.204e-8
Identity = 90/381 (23.62%), Postives = 154/381 (40.42%), Query Frame = 3
Query: 1422 FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKD-----EINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
             DYE  Q     I   D    A  +   + + ++D+N+  P    +   ++  ENI E   IM + A+D+D+   L Y L    D      F I+S +G +I++   LD E        VF+ D           + V + D ND+ P+F    +   + E  +  SKL+   E +  D+D     EI +SII   + +           +F++    G I     ++  K   Y L + A D GNPP S+   + I V    ++ P +   P+ N +       I +   IG+ V Q+ A       F  IS  I         E F  +N ++G++ I+ +       +  ++          +   +II++   NDN+
Sbjct: 1467 LDYETQQSYNLTISVTDGTFTAFTN---LLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQ-RLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLA---EVRAIDRDSGHNAEIQYSIITGNVGS-----------VFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKF---PTNNIA-----IEIFENLPIGTFVTQVTARSSSSIFFNIISGNI--------NESF-RINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNI 1812          

HSP 20 Score: 58.151 bits (139), Expect = 6.212e-8
Identity = 46/174 (26.44%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKV----------TAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTF-KKDYADVEIEIEDVNDNYPI 1211
            ++ +P    I++  +++YE  +++   +K  +   ++   ++II+ ++D NDN P FV+ +Y+  +PES  IG  +LKV            KDAD  +     Y    +   K+ F I+  +G I L + L     + Y F V   D           A V I + +VND  P+
Sbjct: 1760 FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSC-QNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDL-AKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPV 1931          
BLAST of Protocadherin 11 vs. Ensembl Fly
Match: kug (gene:FBgn0261574 transcript:FBtr0332721)

HSP 1 Score: 152.91 bits (385), Expect = 7.203e-37
Identity = 167/646 (25.85%), Postives = 287/646 (44.43%), Query Frame = 3
Query:  582 QIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCD-KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNE--FEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK---GAILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKD---EINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETV-VTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            Q + ++E + +  +++   A D+D    N K  +   D        V++ DPD   + ++  L+ E +  Y   + V D         K + + ++D NDN P+  +     ++ ES  IG  +  + A DADS +  +  Y         S F +   +G + L + L   K+  Y   + A D  S     + A V + ++DVNDN P+  +        Y  ++ E+ P  T+ + I   D+D G NA +  SL+   +D  E+ + D     IRT    DYE  Q+    +  ID G P+L S  +I I+I+DVNE  F P   +   E   KEN P+  F+M++ A D D     + + YS+   D +G   F +N +    I S   LD E  +     +   D  I P +  + V + + ++NDN P     + +      S  +     ++A D D D    I ++I+   L  Y           F++ SK G I+T    +DRE  + + L +   D G+P  S+++ I ++V+D+NDNSP +         +   +  +   A +   + Q+ A+D D  + G+I+Y I S     +G+    ++   G + I +   S     + I A D+G P
Sbjct:  777 QELSINESVQLGETVAWIEAKDRDLG-YNGKLVFAISDGDYDS---VFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVEC---SDFTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSE-ALVYVLVDDVNDNAPVFGVQE------YIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQD-EELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYSITGGDGLG--IFAVNDQGS--ITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGY-----------FEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEF--------DQRVYKVQVPSSATVNQSIFQVHAIDSDSGENGRITYSIKSG----KGKNKFRIDSQRGHIHIAKPLDSDNEFEIHIKAEDNGIP 1380          

HSP 2 Score: 149.828 bits (377), Expect = 7.325e-36
Identity = 135/492 (27.44%), Postives = 228/492 (46.34%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY---SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVS 2201
            + + + L+ E  Q+ F  L +     +   + ++ + V D NDN P  ++ +Y +   ES  IG  +++V A D D   F      + S       F+I KESG++ +  +L      +Y    +  D    T ++ ++++ I + D+NDN PI S+        Y + + E+    TL + +H  DKD G+N  +  SL     D  ++ K+      IR  +S D E + L    +   D G P L S   + + I+D+N+  P            EN      +  + A+  D G  A + Y   S +E G+  F ++S TG++++ N TLD EM+      +   D    P +   +V ++ILD NDN+P F+  L    + E +   SK+   ++A D D D +N  + + +    N          F +  K G I     +DRE  S+YTL I A D+G+P +  S  I I ++D NDN+P++ S
Sbjct: 3022 LFIAKPLDRE--QLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFD---FQSKLRFYLSGKGADD-FSIGKESGILKVASALDRETTPKYKLVAHVQDGKDFT-QECFSEIIITVNDINDNMPIFSMAQ------YRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKS---TGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEVCKVYATSIDIGVNADIHYFIMSGNEQGK--FKMDSTTGDLVL-NATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKI-LDVKATDEDSD-VNGLVTYNIERGDNIGQ-------FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSS 3485          

HSP 3 Score: 126.716 bits (317), Expect = 7.631e-29
Identity = 163/635 (25.67%), Postives = 278/635 (43.78%), Query Frame = 3
Query:  843 KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSV-TFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQ--IRTIRSFDYEILQL-IEAEILCIDSGSPALLSRK-AIKIIIVDVNEFEPSIR--NNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL---DEIGRIYFTINSRTGEI---------IMSNVTLDKEMNDSVKFKVFITDSLINPH--------------------------TATMFVTVTILDQND---NAPQFVHTLPFTIQ---------EGLSFYSKLS-----------TRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            KS+ +Q+  E+ N PIF ++ Y V IPE+ PI   ++++   D D    N   Y      N    F I  +SG++   + L   KKS Y  TV AID  +V + K+  A V+I ++D+NDN PI   ++        I I+EN    + +  +   D+D+G N+ ++ S+       L  +  +++ +   ++T    D+E ++   E  I   D G P     +  + I++ D+N+  P     N + +++    +    F+ S  A D D G I+ Y L   +E G   F ++  +G +          ++N  L     D   F     D +IN H                             +  T+++ ++N+    +P     L  T           E ++F  +LS             IEAKD D    N  ++F +        +  ++ +F +   +GE++ +  +DRE+ + Y L I   D GNP KSTS  + IT++DVNDN PV          +  A F +++ A IG++V  L A D D     +++Y +    S +      T+N T+G L +++ PL   +     L I+A D G P L + A + + V   NDN
Sbjct:  384 KSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGK-NALVYLEIVGGNEGDEFRINPDSGMLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNK------VISINENNLAGSFVVKLTAKDRDSGENSYISYSIAN-----LNAVPFEIDHFSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQFERVNCYGKVTKSAPMGTEVFVTS--AIDFDAGDIISYRLSDGNEDG--CFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTHFS---DDLIINVHLMPEDLGGDSSILHGFGSFECRETGVARRLAETLSLAEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLG-YNGKLVFAI-------SDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVI--------QKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYALSVECSDF------TVNATTGCLRLNK-PLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDN 976          

HSP 4 Score: 120.939 bits (302), Expect = 4.471e-27
Identity = 130/503 (25.84%), Postives = 231/503 (45.92%), Query Frame = 3
Query:  747 SIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKS--IFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYP--IISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK--GAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVK-FKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-----TLPFTIQEG-----LSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPP--KSTSTNITITVIDVNDNSPVW 2195
            +I++ + L+YE +Q Y   + V D T+      +++VQVID NDN P F +  Y V I E+      I+++ A D D     K FY   +  +  S  +F I+  SG + + Q L   K ++++  V+  D      K++YA + + + D ND++P     ++   +P+  AI          L  +   D+D+G NA +  S+     ++  + + D     I    + +   +Q    ++  +D G+P L S+  + II+       P    N   +   EN+P   F+  + A         I+  +++E     F IN  TG I++ N  +D E   S+K F + +  + +   ++   + + ILD NDN P FV       LP +   G     +   SK    ++ KDAD   +N  + + ++       + L +  F + S+ G IE +  +D E ++ YT  +   D G P    +T+ ++TI VI+VND  PV+
Sbjct: 1460 NILLSKYLDYETQQSYNLTISVTDGTF--TAFTNLLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDED--KKLFYHLHATQDPSSLALFRIDSISGNVIVTQRLDFEKTAQHILIVFVKDQ-GAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIG-------SKLAEVRAIDRDSGHNAEIQYSIIT--GNVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKFPTNNIAIEIFENLPIGTFVTQVTARSSSSIFFNIISGNINE----SFRINPSTGVIVI-NGNIDYE---SIKVFNLTVKGTNMAAESSCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVG-VNGMVEYHIV-------DDLAKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPVF 1932          

HSP 5 Score: 117.087 bits (292), Expect = 7.412e-26
Identity = 170/682 (24.93%), Postives = 298/682 (43.70%), Query Frame = 3
Query:  453 DKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKT--YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK--GAILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEG-LSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMST-ESHYQGEQFLTL-NETSGILSIHQHPLSYGRTLLKISAHD 2462
            D+E+ +     ++    ++ +  +++++VKD++DN P  L  +  I  +E ISI T++    A+D DF     +   +F+        F    +  IL   V  +L+ E    Y     V D     Q C  + II+ V D NDN PIF   +Y V +PE   +   I KV A D D  +  +  Y      +    F I K +G+I L +SL     S +  TV A D   V      A V + I D+NDN P  S+        Y+ +I EN    T +  ++ +  D G+NA ++    +   +     K D     +    + DYE+ +     I  ID G+P L +   + I I+D+N+  P+   N   ++  E+I     I+ + A+D+D     ++ Y++   D IG+  F+I+ + G I +S   LD+E       ++   D        ++ + + ILD NDNAP F  +     +QE  L  Y  L+ +I    +D DE  ++  +       N+  L     F +   G + T    +      + + +   D G PP  +   + + +I+ +   P+ V+P  +  +  E  F+       G+ + ++ A   DQD + ++++ ++S  +  YQ  +   + N T  I +I    L  G   L +S  D
Sbjct: 3029 DREQLMFYNLSIIATDGKFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDF-----QSKLRFYLSGKGADDFSIGKESGILK--VASALDRETTPKYKLVAHVQDGKDFTQECFSE-IIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENH--DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDC-GVPKLHSIATVAVNILDINDNPPEFSMRQ------YSCKILENATHGTEVCKVYATSIDIGVNADIH--YFIMSGNEQGKFKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ--FSIDPKNGTISVSR-PLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVLQENRLLGYVFLTFKI----SDADETPNTTPYTFDIRSGNEGGL-----FRLEQDGSLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPI-VTPLEVTINSFEDDFS-------GAFIGKVHA--SDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISN--LDIGLYKLNVSVSD 3667          

HSP 6 Score: 112.464 bits (280), Expect = 1.650e-24
Identity = 154/576 (26.74%), Postives = 253/576 (43.92%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNY-NVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDY-ADVEIEIEDVNDNYPIISL-LHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAP-----QFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLL---HTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++ V DENDN P F    Y   + E+      ++KV+A DAD+       Y  +S+  N+++IF+I+  SG I+L  SL    +S Y F V A D  +   K D    V I+I D NDN P+  L + G       + + EN  P T L ++ + D D     +    +   ++   ++ K+     ++   +  D E L      I+  D       ++  ++I + D+N+  P        +S  E+I     ++ + A D D  + LR+ L   G   F+I   +G I+     LD+E     K    + D           + +T+ D NDN P     Q+  ++P   Q      + L T++ A D D   +N  I + L+   H Y           F +S S G I    ++DRE  S + LT+ A+D G P   +   + + ++D+NDN      PP  +  +   +  I + A  G+ V ++ A   D      I Y IMS   + QG+    ++ T+G L ++   L Y  +    L I A D G PPL N A + I++   NDN
Sbjct: 2846 VLIDVRDENDNYPKFDNTFYSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAAD--NGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEG-------LSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQIGKSG----ELFIAKPLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTLVEVKAIDFDFQSKLRFYLSGKGADDFSIGKESG-ILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQ-----LNTLITKVHAMDKDFG-VNRQIKYSLMGENHDY-----------FKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDN------PPEFSMRQYSCK--ILENATHGTEVCKVYATSIDIGVNADIHYFIMS--GNEQGK--FKMDSTTGDLVLNA-TLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDN 3374          

HSP 7 Score: 107.457 bits (267), Expect = 6.572e-23
Identity = 138/565 (24.42%), Postives = 249/565 (44.07%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKK-SRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++I+ + N P F +   L+KI ES P G  + K+      +  F  +    Q ++ +        +SG + L+Q+L   ++ S  L  V     + V F   YADV I++ D NDNYP            Y+  + EN+    +L  +  +D DTG N  +   L    +++  +   D+    I  + S D E+      +++  D+G P   ++  + I IVD N+  P  +   E LS  EN      ++++   D D  K  +  + +    +  F I  ++GE+ ++   LD+E        +  TD      TA   V + + D NDN P  +      +  E +S  + L   +E K  D D     + F L     +   +  E        G ++    +DRE    Y L    QD  +  +   + I ITV D+NDN P++        S  + R ++ ++A + +++ ++ A+D+D     +I Y +M  E+H     +  +++++GI+ +H+       +L  L + A D G P L + AT+ +N+   NDN
Sbjct: 2751 IEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHM--IGNYTFKFSIAADQDHFMIS-------DSGELILQQTLDREQQESHNLIVVAETSTVPVFFA--YADVLIDVRDENDNYPKFDNTF------YSASVAENSEKVISLVKVSATDADTGPNGDIRYYLESDTENIQNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQFQI-GKSGELFIAK-PLDREQLMFYNLSIIATDG---KFTAKANVEIDVKDINDNTPYCLKPRYHISTNESISIGTTL---VEVKAIDFD-FQSKLRFYLSGKGADDFSIGKE-------SGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIF--------SMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMG-ENH----DYFKISKSTGIIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDN 3269          

HSP 8 Score: 100.523 bits (249), Expect = 7.020e-21
Identity = 156/623 (25.04%), Postives = 276/623 (44.30%), Query Frame = 3
Query:  729 YDPDILS--IMVMRSLNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDP-YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL---SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN--LFSGLNMAIII 2561
            +D DI S  I ++ SL+ E++  Y  K+   D  + ++  +  + ++++D NDN P+F      + + E+   G  ++ +   D D       F+    +   +  F I K SG + + + L   +   Y  ++ A D    T K   A+VEI+++D+NDN P       Y   P Y I  +E+    T   + V   D    + +   L  +  D   + K   E   ++   + D E     +      D           I I + D+N+  P        +S  E+   +  I  + A DKD G    ++YSL      YF I+  TG II  + +LD+E        V   D  +    +   V V ILD NDN P+F +      I E  +  +++  ++ A   D   +N  I + ++ + N + +   +     S+ G++    T+D E    Y LTI A D G PP S +  + I+++D+NDNSP ++        +   R N++++  +GS +  +KA D+D D  G ++Y I   ++  Q     +++  +G +S+ + PL   +     L+I A D G P   N   + IN+   NDN  +FS  N ++++
Sbjct: 2910 FDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLPIEGLSVFENALPGTVLINLLLIDPDIEKQEMDFFIVSGDKQAQ--FQIGK-SGELFIAKPLDREQLMFYNLSIIATDG-KFTAK---ANVEIDVKDINDNTP-------YCLKPRYHISTNESISIGTTL-VEVKAIDFDFQSKLRFYLSGKGADDFSIGK---ESGILKVASALDRETTPKYKLVAHVQDGKDFTQECFSEIIITVNDINDNMPIFSMAQYRVSVPEDAQLNTLITKVHAMDKDFGVNRQIKYSLMGENHDYFKISKSTG-IIRLHKSLDRETISLFNLTVKAEDCGVPKLHSIATVAVNILDINDNPPEFSMRQYSCKILENATHGTEV-CKVYATSIDIG-VNADIHYFIM-SGNEQGKFKMD-----STTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFL--------QNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ----FSIDPKNGTISVSR-PLDRETISHYTLEIQACDQGDPQRCNSVPININILDTNDNAPIFSSSNYSVVL 3492          

HSP 9 Score: 97.8265 bits (242), Expect = 5.556e-20
Identity = 152/570 (26.67%), Postives = 236/570 (41.40%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF--QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDY----ADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP---PKTLFSIHVSDKDTGINA-VVNCSLRVRRKDLLEMIKAD-------MEIYQIRTI--RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITD--SLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREK-DSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIH--QHPLSYGRTLLKISAHDHGH 2471
            +I ++V+D ND  P+F   +Y V IPE  P  + ILKVTA DAD  +  + +Y     S Y     F I   +G I+L Q L   + S +  TV A D  S    +++      V I ++ VN           Y P+ +       TP   P     + V+DKDTGIN  +    +     D   ++KA        +E+ Q   +  + F Y +  L E      D G+P   + K++ I I   ++  P       E+S  E  P +  ++ +  SD D G      L+ +G      F IN  +G ++ +   LD E   S    V   D  ++ +   ++  V +++ D NDN P F +          +       ++ AKD D  E N  I + + +      E+ H         G ++T   +D E    NY L I A D G P  + T   ++I V D+NDN P +                ++K A +G+ V    A+D D  D   ISY +    S    +    L+ TSG LSI       +    +LK+SA D  H
Sbjct:  168 NIHIKVLDRNDLSPLFYPTQYTVVIPEDTPKYQSILKVTADDADLGINGEIYYSLLMDSEY-----FAIHPTTGEITLLQQLQYAENSHFELTVVAYDRGSWVNHQNHQASKTKVSISVKQVN----------FYAPEIFTKTFSSVTPTSNPLIYGIVRVNDKDTGINGNIGRLEIVDGNPDGTFLLKAAETKDEYYIELNQFAHLNQQHFIYNLTLLAE------DLGTPRRFAYKSVPIQIKPESKNIPIFTQEIYEVSIPETAPINMPVIRLKVSDPDLGKNALVYLEIVGGNEGDEFRINPDSG-MLYTAKQLDAEKKSSYTLTVSAIDQANVGSRKQSSAKVKISVQDMNDNDPIFENVNKVISINENNLAGSFVVKLTAKDRDSGE-NSYISYSIANLNAVPFEIDH-------FSGIVKTTSLLDFETMKRNYELIIRASDWGLPYRRQTEIKLSIVVKDINDNRPQF--------ERVNCYGKVTKSAPMGTEVFVTSAIDFDAGDI--ISYRL----SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDGTH 693          

HSP 10 Score: 92.8189 bits (229), Expect = 1.586e-18
Identity = 129/517 (24.95%), Postives = 215/517 (41.59%), Query Frame = 3
Query:  711 QLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRR-----KDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIP------------EHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            +L  Y  D     I +   LN+  K      + V D  +    R  + + ++ EN   P+F +  Y  ++PE+   G  I+ V A D D   +   +Y   S   +K IF I++ +GVI+ K +    KK  Y+  +   D      K  +A +++ + DVNDN P   L    M     +  ++     T+ ++   D D   N  V+  +  +      KD++E+ +   +I       S+     Q     +   D G P   S   + I I++ +   P+   +   L   E+ P             + F  SI A+D+D               +F I S +GE+I+   TLD+E  +S    V    S +    A   V + + D+NDN P+F +T    ++ E       L  ++ A DAD    N  I + L     N      + IFD+    G I  + ++DRE  S Y   ++A D G+P       +TI ++D NDN+PV+  P
Sbjct: 2493 ELQTYSIDKLTGVISLQNMLNFTDKSSTVLNISVSDGVHTAYAR--LKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSE-EMKKIFLIDQTTGVITSKVTFDREKKDEYVVLLKVSDGGG---KFGFASLKVIVVDVNDNVPYFLLKEYKMVVSTTVEANQ-----TILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGVNSYQFF---VRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVLLKIIESTPPGTVLTKLHMIGNYTFKFSI-AADQD---------------HFMI-SDSGELILQQ-TLDREQQESHNLIVVAETSTVPVFFAYADVLIDVRDENDNYPKFDNTFYSASVAENSEKVISL-VKVSATDADTGP-NGDIRYYLESDTENI-----QNIFDIDIYSGWITLLTSLDREVQSEYNFKVIAADNGHPKHDAKVPVTIKIVDYNDNAPVFKLP 2970          

HSP 11 Score: 90.1225 bits (222), Expect = 1.192e-17
Identity = 118/437 (27.00%), Postives = 186/437 (42.56%), Query Frame = 3
Query: 1242 PYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXF-GKISYVIMSTESHYQGEQFLTLNETSGILSIHQ-HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
            P  + I+E+    +T+  I   D+D G N  +     +   D   + + D +  +++ I   D E        I   D G+P   + K + I I+DVN+  P I+         E+      +  + A+D D G  A + Y+L  +    FT+N+ TG + + N  LD+E  D+    +   D      ++   V V + D NDNAP F V    F ++E L   + L+  IEA D D    N  I F L      K E   E++F +    G I T   +D E    + L + A D G+P  ++  +I I +IDVN+N       P  +    E +   +K    G+ V  + A D D  D   KI+Y I   +    G     +N+   I S+ Q    +     L + A D    PL N   + I V+  NDN+
Sbjct:  776 PQELSINESVQLGETVAWIEAKDRDLGYNGKL--VFAISDGDYDSVFRIDPDRGELQIIGYLDRERQNEYVLNITVYDLGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHCLHATDADSGINAQVTYAL-SVECSDFTVNATTGCLRL-NKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAV-IEAVDEDIGP-NAEIQFSL------KEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENR----FAPEFDDFVYEGKVKENKPK--GTFVMNVTARDMDTVDLNSKITYSITGGD----GLGIFAVNDQGSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNI 1190          

HSP 12 Score: 88.5817 bits (218), Expect = 3.723e-17
Identity = 146/584 (25.00%), Postives = 244/584 (41.78%), Query Frame = 3
Query:  828 QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYA-DVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG-------AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTAT-MFVTVTILDQNDNAPQFVHTLP-FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDNLFS 2537
            Q  ++ SI+V+  D NDN P F       K+ +S P+G ++   +A D D+   +   Y   S+ N    FN++  SG +S+   L     +  +  V A D     F  D   +V +  ED+  +    S+LHG+    +  R                  +TG+          RR                        E L L  AE   + S SP++ S  ++       N   P   N  +ELS  E++   + +  I+A D+D G       AI     D +    F I+   GE+ +    LD+E  +     + + D L NP  +T   + +TILD NDN P    TL  F + E     + +   + A DAD   IN  + + L    ++         F V ++ G +     +DREK  NY L I A+D G+P  S+   + + V DVNDN+PV+           E  F + ++   G+++A ++A+    +D G  + +  S +   Q E+   +++ +G +    + L Y       L +SA D G P L +  +++I +   N+N F+
Sbjct:  594 QTEIKLSIVVK--DINDNRPQFERVNCYGKVTKSAPMGTEVFVTSAIDFDAG--DIISYRL-SDGNEDGCFNLDPTSGSLSISCDLKKTTLTNRILKVSATDG--THFSDDLIINVHLMPEDLGGDS---SILHGF--GSFECR------------------ETGV---------ARRL----------------------AETLSL--AEKNNVKSASPSVFSDLSLTPSRYGQNVHRPEFVNFPQELSINESVQLGETVAWIEAKDRDLGYNGKLVFAISDGDYDSV----FRIDPDRGELQIIGY-LDRERQNEYVLNITVYD-LGNPTKSTSKMLPITILDVNDNRPVIQKTLATFRLTESARIGTVVHC-LHATDADSG-INAQVTYALSVECSD---------FTVNATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVF--------GVQEYIFKVREDLPRGTVLAVIEAV---DEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGY-LDYENKQVHNLIVSAIDGGDPSLTSDMSIVIMIIDVNENRFA 1085          

HSP 13 Score: 86.2705 bits (212), Expect = 1.803e-16
Identity = 92/364 (25.27%), Postives = 168/364 (46.15%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAV-VNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL----DEI--GRIYFTINSRTGEI-IMSNVTLD-KEMNDSV---KFKVF 1772
            ++ D     +++  +L+YE+ + YF  ++  D         + + + ++D NDN P F++  Y + + E   +G KIL V A D DS +     Y  +   N+   F+I+ ++G IS+ + L     S Y   + A D      + +   + I I D NDN PI S         Y++ + EN     +F +  +SD D   N       +R   +  L  ++ D     +RT   F++ +      ++   D+G+P L S   + + I++ +++ P +      ++  E+     FI  + ASD+DK   L +SL    D++      F I++ TG+I  +SN+ +   ++N SV   KF VF
Sbjct: 3321 FKMDSTTGDLVLNATLDYEMSKFYFLTIQAIDGGTPPLSNNAYVNISILDINDNSPTFLQNLYRINVNEDIFVGSKILDVKATDEDSDVNGLVTYNIERGDNIGQ-FSIDPKNGTISVSRPLDRETISHYTLEIQACDQGDPQ-RCNSVPININILDTNDNAPIFS------SSNYSVVLQENRLLGYVFLTFKISDADETPNTTPYTFDIRSGNEGGLFRLEQDG---SLRTASRFNHNLQDEFVIQVRVFDNGTPPLYSDAWVVVKIIEESQYPPIVTPLEVTINSFEDDFSGAFIGKVHASDQDKYDELNFSLVSGPDDMYQSSKLFNISNNTGKIYAISNLDIGLYKLNVSVSDGKFHVF 3673          

HSP 14 Score: 84.7297 bits (208), Expect = 5.353e-16
Identity = 106/397 (26.70%), Postives = 175/397 (44.08%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTG------INAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD-------------KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH---TATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTR-IEAKDADKDEINHSII 1970
            IIV V D ND+ P F  K    K+PES  IG K+ +V A D DS    +  Y   +  NV S+F I+   G+I+L  +L+INK   Y+  V A+D  +         V I I  +++N P       +  +  AI I EN P  T F   V+ + +       I+  +N S R+     + +I  ++           DYE +++    +   +  + +  S + I I I+D N+  P    N    +  E+     +++ +  S KD              G +  + +D++ + +F I+S TG I +    LD E N    F V ++D +  P    T T  VT+ +++ ND  P F +     +   L  +  +  R + AKDAD D +   I+
Sbjct: 1598 IIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLAEVRAIDRDSGHNAEIQYSIITG-NVGSVFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIP-VHI-IVTMSENDP-----PKFPTNNIAIEIFENLPIGT-FVTQVTARSSSSIFFNIISGNINESFRINPSTGVIVINGNI-----------DYESIKVFNLTVKGTNMAAES--SCQNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDLAKNFFKIDSTTGAIELLR-QLDYETNAGYTFDVTVSD-MGKPKLHSTTTAHVTIRVINVNDCPPVF-NERELNVTLFLPTFENVFVRQVSAKDADNDTLRFDIV 1969          

HSP 15 Score: 77.0258 bits (188), Expect = 1.033e-13
Identity = 120/475 (25.26%), Postives = 217/475 (45.68%), Query Frame = 3
Query: 1131 DALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIK--ADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI-MSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYN--NKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGE-QFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPN 2522
            D ++   ++    ++I + DVNDN P+      ++  PY   +  + P  T+   +   D D+  N  V   L+    +L ++ +   ++ I Q     + +YE+       +   D       S   +++ ++D +   P     F  +S KE++  +  + +SI+A +   G  L Y++    +  F I+  TG I + N  LD E   S    +  TDSL   + A + ++V+I+D ND  P+    +   TI E  SF +++  +I A D D     ++ +   + + N  N  EL +  + D    G +     +D E+   + + +  +D G+P  S+ +N+ ITV D+NDN+P +V        EP     +S  A  G  VA  KA D+D  D   + Y I+     Y  E Q  ++++ +G++S+ Q+ L++     T+L IS  D  H     YA L I++   N
Sbjct: 2113 DGMNSNVRRAVTSIDISVLDVNDNCPL------FVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNGELFKLDRKSGELSIKQHVEGHNRNYELT------VAAYDGAITPCSSEAPLQVKVIDRSM--PVFEKQFYTVSVKEDVEMYSALSVSIEA-ESPLGRSLIYTISSESQ-SFEIDYNTGSIFVVN-ELDYEKISSHDVSIRATDSLSGVY-AEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQI-LKINATDNDSGA--NAKLSYYIESINGQNNSELFYIDVTD----GNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFV--------EPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIV-----YGNELQTYSIDKLTGVISL-QNMLNFTDKSSTVLNISVSDGVHTA---YARLKISLLPEN 2545          

HSP 16 Score: 73.9442 bits (180), Expect = 1.058e-12
Identity = 125/530 (23.58%), Postives = 223/530 (42.08%), Query Frame = 3
Query:  591 KLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDE-NDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPD----PYAIRIDENTPPKT-LFSIHVSDKDT-GINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDK--DKGAILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLST-RIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTST 2147
            +L+E   I T +    A D D S IN +  Y    E   F +     +     + + + L+ E +  Y   +   D        ++++  ++D+ NDN P+F  ++Y+ K+ E  P G  +  + A D D     +  +  +     + +F I+K +G I  +  L    K  +   V AID    +   D + V I I DVN+N         + P+     Y  ++ EN P  T + ++   D DT  +N+ +  S  +   D L +   + +   I ++   D E        +   D     L +   + I + + N+  P        ++  E   E+  I+++ A D   D    + Y++     + YF I+S+TG I  +   LD+E       +V I+D+     ++T  + V++LD NDN+P+F   + + +Q   S     S  ++ A D+D  E N  I      TY+ K      K    S +G I     +D   D+ + + I A+D G P KS + 
Sbjct:  885 RLTESARIGTVVHCLHATDAD-SGINAQVTYALSVECSDFTV-----NATTGCLRLNKPLDREKQDNYALHITAKDGGSPVLSSEALVYVLVDDVNDNAPVFGVQEYIFKVREDLPRGTVLAVIEAVDEDIGPNAEIQFSLKEETQDEELFRIDKHTGAIRTQGYLDYENKQVHNLIVSAIDGGDPSLTSDMSIV-IMIIDVNENR--------FAPEFDDFVYEGKVKENKPKGTFVMNVTARDMDTVDLNSKITYS--ITGGDGLGIFAVNDQ-GSITSLSQLDAETKNFYWLTLCAQDCAIVPLSNCVEVYIQVENENDNIPLTDKPVYYVNVTEASVENVEIITLKAFDPDIDPTQTITYNIVSGNLVGYFEIDSKTGVIKTTERKLDRENQAEHILEVAISDNGSPVLSSTSRIVVSVLDINDNSPEFDQRV-YKVQVPSSATVNQSIFQVHAIDSDSGE-NGRI------TYSIKSGKGKNKFRIDSQRGHIHIAKPLD--SDNEFEIHIKAEDNGIPKKSQTA 1386          

HSP 17 Score: 72.0182 bits (175), Expect = 3.748e-12
Identity = 109/475 (22.95%), Postives = 204/475 (42.95%), Query Frame = 3
Query:  615 NTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIY--FCKLK--VCDKTYQNCVRK--SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKD---ADKDEINHSIIF-RLLHTY 1991
            NT ++  G ++   + +++   Y+  + +  F + +         ++  R    E+K +Y  F + K  + D    N  R   SI + V+D NDN P+FV   Y   +    P G  I++V A D DS+   +  Y  +       +F ++++SG +S+KQ +  + ++ Y  TV A D  ++T     A +++++  ++ + P+      +    Y + + E+    +  S+ +  +     + +  SL        +  + D     I  +   DYE +   +  I   DS S  + +   + + I+DVN+  P I ++   L+  EN      I+ I+A+D D G  A L Y ++ I        F I+   G + +    LD E        V + D      ++   V +T+ D NDNAP FV    FT     +   +     +A D   +D D + + I++   L TY
Sbjct: 2046 NTKVATIGLVNVIGNTLDENVEYRILNPTQLFDIGISSGALKTTGVIFDR----EVKDLYRLFVEAKSMLYDGMNSNVRRAVTSIDISVLDVNDNCPLFVNMPYYATVSIDDPKGTIIMQVKAIDLDSAENGEVRYELKKGNG--ELFKLDRKSGELSIKQHVEGHNRN-YELTVAAYDG-AITPCSSEAPLQVKV--IDRSMPV------FEKQFYTVSVKEDVEMYSALSVSIEAE-----SPLGRSLIYTISSESQSFEIDYNTGSIFVVNELDYEKISSHDVSIRATDSLS-GVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLK-TPLDYEQIKYHHIVVNVKDHGSPSLSSRSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKAYDKDISDTDSLEYKIVYGNELQTY 2497          

HSP 18 Score: 60.8474 bits (146), Expect = 9.025e-9
Identity = 149/641 (23.24%), Postives = 262/641 (40.87%), Query Frame = 3
Query:  681 YQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYP-IISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKAD--MEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKD------ADKDEI--NHSIIFRLLHTYNNKMEL----LHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHY----QGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            Y    ES +F++     D +  SI V+  L+YE    +   ++  D          + V ++D ND  P      Y + IPE+   G +ILK+ A D DS    K  Y  +S    N   +F I+   G + LK  L   +   +   V   D  S +     ++V I ++D+NDN P  +   +       A+R      PK  +   +SD D+          ++   + L+    D    +  ++ + +F  +      + +L I        +   +KI ++  N + P    +  E    EN+     I+++ ASD D G  A L Y +  +E+ +I F I+  TG +I S VT D+E  D     + ++D       A++   V ++D NDN P F+      ++E   +   +ST +EA        A  D+I  N S+ F+++   N+K       ++EK  D+  K + E+         ++Y   + A D+G P   +   ++I +I+ + N P +     L          I +    G+++ +L  +      F      I + + H+     GE  L L +T        H L        + A     P    YA ++I+V+  NDN
Sbjct: 2276 YTISSESQSFEI-----DYNTGSIFVVNELDYEKISSHDVSIRATDSLSGVYAEVVLSVSIMDVNDCYPEIESDIYNLTIPENASFGTQILKINATDNDSGANAKLSYYIESINGQNNSELFYIDVTDGNLYLKTPLDYEQIKYHHIVVNVKDHGSPSLSS-RSNVFITVKDLNDNAPCFVEPSYFTKVSVAAVRGQFVALPKA-YDKDISDTDS-------LEYKIVYGNELQTYSIDKLTGVISLQNMLNFTDK-----SSTVLNISVSDGVHTAYARLKISLLPENVYSPLFDQSTYEAQVPENLLHGHNIITVKASDGDFGTYANLYYEIVSEEMKKI-FLIDQTTG-VITSKVTFDREKKDEYVVLLKVSDGGGKFGFASL--KVIVVDVNDNVPYFL------LKE---YKMVVSTTVEANQTILTVKAKDDDIVDNGSVHFQIVQKSNDKAVKDVIEINEKTGDIVFKSKAESYGV------NSYQFFVRASDRGEPQFHSEVPVSIEIIETDANIPTFEKSSVL--------LKIIESTPPGTVLTKLHMIGNYTFKFS-----IAADQDHFMISDSGE--LILQQTLDREQQESHNLI-------VVAETSTVPVFFAYADVLIDVRDENDN 2856          

HSP 19 Score: 59.6918 bits (143), Expect = 2.204e-8
Identity = 90/381 (23.62%), Postives = 154/381 (40.42%), Query Frame = 3
Query: 1422 FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKD-----EINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
             DYE  Q     I   D    A  +   + + ++D+N+  P    +   ++  ENI E   IM + A+D+D+   L Y L    D      F I+S +G +I++   LD E        VF+ D           + V + D ND+ P+F    +   + E  +  SKL+   E +  D+D     EI +SII   + +           +F++    G I     ++  K   Y L + A D GNPP S+   + I V    ++ P +   P+ N +       I +   IG+ V Q+ A       F  IS  I         E F  +N ++G++ I+ +       +  ++          +   +II++   NDN+
Sbjct: 1467 LDYETQQSYNLTISVTDGTFTAFTN---LLVQVIDINDNPPQFAKDVYHVNISENIEEESVIMQLHATDRDEDKKLFYHLHATQDPSSLALFRIDSISGNVIVTQ-RLDFEKTAQHILIVFVKDQGAPGKRNYAKIIVNVHDHNDHHPEFTAKIIQSKVPESAAIGSKLA---EVRAIDRDSGHNAEIQYSIITGNVGS-----------VFEIDPTFGIITLAGNLNINKIQEYMLQVKAVDLGNPPLSSQIPVHIIVTMSENDPPKF---PTNNIA-----IEIFENLPIGTFVTQVTARSSSSIFFNIISGNI--------NESF-RINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSCQNIIIHILDANDNI 1812          

HSP 20 Score: 58.151 bits (139), Expect = 6.212e-8
Identity = 46/174 (26.44%), Postives = 81/174 (46.55%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKV----------TAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTF-KKDYADVEIEIEDVNDNYPI 1211
            ++ +P    I++  +++YE  +++   +K  +   ++   ++II+ ++D NDN P FV+ +Y+  +PES  IG  +LKV            KDAD  +     Y    +   K+ F I+  +G I L + L     + Y F V   D           A V I + +VND  P+
Sbjct: 1760 FRINPSTGVIVINGNIDYESIKVFNLTVKGTNMAAESSC-QNIIIHILDANDNIPYFVQNEYVGALPESAAIGSYVLKVHDSSKDHLTLQVKDADVGVNGMVEYHIVDDL-AKNFFKIDSTTGAIELLRQLDYETNAGYTFDVTVSDMGKPKLHSTTTAHVTIRVINVNDCPPV 1931          
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 225.328 bits (573), Expect = 5.010e-60
Identity = 233/802 (29.05%), Postives = 381/802 (47.51%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHP--LSYGRTLLKISAHDHGHPPLKNYATLII 2504
            + C +L P+I  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  TV A D  S   +   A + I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILD+NDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN+P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S            ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 VACFWLDPTI--AQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--FEDSECSFEIEVVILP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPAR---ATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVRLSILNDNENF-------ILDPDS-GVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVR----SLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 225.328 bits (573), Expect = 5.010e-60
Identity = 233/802 (29.05%), Postives = 381/802 (47.51%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHP--LSYGRTLLKISAHDHGHPPLKNYATLII 2504
            + C +L P+I  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  TV A D  S   +   A + I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILD+NDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN+P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S            ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 VACFWLDPTI--AQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--FEDSECSFEIEVVILP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPAR---ATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVRLSILNDNENF-------ILDPDS-GVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVR----SLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 224.557 bits (571), Expect = 7.657e-60
Identity = 233/802 (29.05%), Postives = 381/802 (47.51%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHP--LSYGRTLLKISAHDHGHPPLKNYATLII 2504
            + C +L P+I  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  TV A D  S   +   A + I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILD+NDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN+P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S            ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 VACFWLDPTI--AQELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--FEDSECSFEIEVVILP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPAR---ATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVRLSILNDNENF-------ILDPDS-GVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVR----SLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Match: CR847522.1 (pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:4879379:1 gene:ENSDARG00000111493.1 transcript:ENSDART00000185190.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR847522.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.457e-59
Identity = 232/801 (28.96%), Postives = 379/801 (47.32%), Query Frame = 3
Query:  201 LLCGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHP--LSYGRTLLKISAHDHGHPPLKNYATLII 2504
            + C +L   I+ QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  TV A D  S   +   A + I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILD+NDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN+P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S            ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 VACFWLDPTIA-QELIYPIREELQENVLIGNIPKDLNISHMNSATGATSNLVYRLVSKAGDTPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--FEDSECSFEIEVVILP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELLNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKVKVEDGGNPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPENSPVGTSVVQLQATDADVGANAEIKYMFGAQVSPATRRLFALNTTTGLITVQRPLDREETAIHKLTVLASDGSSSPAR---ATITINVTDVNDNAPNIDLRYIISPTNGTVMLSEKDPINTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNLRDMFLTTISATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFLFTVTARDNGTRALQSQAAVIVTILDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVRLSILNDNENF-------ILDPDS-GVIKSNVSFDREQQSSYTFDVRAVDNGSPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVSGNVR----SLFRIDPVTGNITLEEKPTIADIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 211.075 bits (536), Expect = 3.815e-55
Identity = 225/782 (28.77%), Postives = 357/782 (45.65%), Query Frame = 3
Query:  243 ITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVS-TIDLDTICSTDSECCDKEK-CVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD----ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVI-DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID-ALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIK--ADMEI-----YQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF-KENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHE----KIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESH-------YQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            I + + EE     ++G+L       L     + +  V + Y  +D +T ++      ID +T+     +C +K K C +E +V V +  Q +S   ++  ++  D N         ++ LS  E   +    SI  A DKD  + N   +Y          LF  Q   D    +  ++V+ SL+ ELK  Y   +K  D         +++  VI D NDN P F +  Y  ++ E+ PIG  +L+V A D+D     +  Y   Q+   V  +  I++ SG+I +K  L   + +   F V A D   S    K Y  V I++ D NDN P + +   G +     +  I E+ P  T  + + VSDKD G NAVV C   V   D+   ++  +D  +     Y ++T    DYE ++    EI+ +DSG+PAL S  ++K+ + D N+  P       E+ F +EN P  K ++ + ASD D G  A L YS+  D   R  F I+  +GE+  +   LD+E  D  +F+V   D  +  H  T  V + +LD+NDN P+F +    F++ E +   S +   +  +D D+ E             N +++L  E    K    +  G I + ++ DREK+S+YT  + A D G+PP+S+   +TI V+D NDN+PV   P   NSS       +S  AA  S+V  ++A D D     ++ Y I     H         GE  LT   T     +H       R ++K+S  D G P
Sbjct:   25 ILYRVHEEQPPSTLIGSL--AADQGLPDTGHLYKLEVGAPYLRVDGKTGDIFTTEIPIDRETL----KDCRNKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVPENTHMGALFSIPLATDKDTER-NGVADYTLTAGPEAVALFGLQVAEDRGEKLPQLIVLGSLDRELKDSYDLTIKAVDGGNPPRYSSALLRVVIADANDNAPKFEKSSYEAEVAENSPIGHSVLQVKANDSDLGPNGEIEYTLHQAIDPVPKLLRIDRSSGIIYVKGPLDREEINNLKFYVVARDKGPSPKSSKTY--VSIDVTDQNDNAPAVEIRGIGLVTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC---VVAGDVPFQLRPASDSSVDNKRKYFLQTTTPLDYERVRDYRVEIVAVDSGNPALSSTNSLKVQVTDTNDNSPIFSPTLFEVEFAEENQPGEK-VVEVVASDADSGTNAELVYSIIADSSTRGLFEIDPNSGEV-RARSPLDREHKDRYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSGYSFSVLENMPPLSPVGM-VTVQDMDEGE-------------NAQVQLSVEPDVGKFVIQNGTGTILSSISFDREKESSYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVVTKP--SNSS----FIRLSPMAAPDSVVEVVEAEDIDSGSNAELVYSIAGGNPHDLFYISPSNGEITLTKELTRKHSGLH-------RLVIKVS--DRGKP 763          
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Match: vapa (VAMP associated protein A [Source:Xenbase;Acc:XB-GENE-990155])

HSP 1 Score: 238.424 bits (607), Expect = 3.741e-64
Identity = 236/807 (29.24%), Postives = 391/807 (48.45%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGNL---------NYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHP-PLKNYATLIINVQQPNDN 2528
            F+LL     C  L S I+ QE+ + + EE    + +GN+         N    S      R+      S   ++ + T  +   ST ID + +C+  S   D+ +C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A+D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN+P+F E +  V IPE+ PIG  ++++ A DAD  S+   K  +G Q     K +F +   +G+I++++ L   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N+ V C +       L+ +  +   Y + T    DYE ++    +I+  D+G P+L     +++ + D N+  P       ELS  EN     ++ ++ ASD+D G  + + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I A D+D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI ++D NDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P +   G   L ++  D G+P PL     + + V +   N
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGSSTSLVYRLVSKAGDSPLVKVSSSTGEIFTTSTRIDREKLCAGSSNS-DENECFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSTVINISIPENTLINSRFPIPSAVDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNKPVFKESQVEVHIPENAPIGTSVVQLHATDADIGSNAEIKYIFGAQVTSATKRLFALNNTTGLITVQRPLDREETAVHKLTVLATDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPINTKIALITVSDKDTDVNSKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGIKEFSFKIVAADTGKPSLNQTALVRVELEDENDNPPIFSQPVIELSVSENNRRGLYLTTVSASDEDSGKNSDIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITATDSDAGE-NKAVTLSILNDNENF-------VLDPYS-GLIKSNVSFDREQQSSYTFDVKAVDGGQPPRSSTAKVTINIMDANDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDTDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPSAADVGLHRLVVNISDLGYPKPLHTLVLVFLYVNETAGN 780          
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 224.172 bits (570), Expect = 4.131e-59
Identity = 218/793 (27.49%), Postives = 373/793 (47.04%), Query Frame = 3
Query:  195 FHLLCGYLPSIISSQEITFHLVEENKRGLILGNL--NY-FITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCD---KEKCVIETKVVVQE-YSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTE-------SHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            F  L   LP + SS ++ + + EE    +++G+L  +Y +  SK      + +  +   Y  +D +T ++    T ID +++     EC +    EKC +E +V + +  S        ++E+ D++DN P F      + + E  +I     I  A D+D S +N   +Y+         LF  Q     D     ++VM  L+ E +  Y   +KV D         +++ + ++D NDN P F +  Y  ++PE+ P+G  +L+V A D+D  +  +  Y F Q++  V+ + ++++ +G+I+++  +         F+V A D      K     V I I D NDN P+I +   G +     +  I E+ P +T  + + VSD D G+NA V C     +  + K + +      + Y ++T  + DYE ++    EI+ +DSG+P L S  ++K+ + DVN+  P    +  E+ F EN   +  +M + A+D D G  + L YS+  D   R  F+IN  +G+I + N  LD+E  +   F V   D  I     T  V +T+LD+NDN P+F ++   F++ E +   S +   +   DADK E  H      +H     +E    +    +  G I + ++ DRE  S YT  + A D G+PP+S+   +TI V+D NDN+PV V P +++         ++ +   G+ V  ++A D D     ++ Y I S         SH  GE  +TL +   I+  H     YG   L +   D G P
Sbjct:   45 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSK-----HLYKLELGHPYLRVDGKTGDIYTTETSIDRESL----RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM-VTVIDADKGENAH------IHL---SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY------LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGE--VTLEK--AIIRKH-----YGLHRLVVKVTDKGKP 800          

HSP 2 Score: 119.783 bits (299), Expect = 1.343e-26
Identity = 139/587 (23.68%), Postives = 243/587 (41.40%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFK-------ENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++++D NDN P F      + IPE+  IG       A D DS +   + Y        + +F +       EK+  +I +   L   ++  Y  T+   D      +   A + I I D NDN P    +       Y   + EN+P   ++  +  +D D G+NA ++ S       +  ++  D     I      D E +  ++  ++  D G+    +R  + I I D N+ +P I    F  ++ +       E++P    +  +  SD D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V + D NDNAP F  +L   +    +  + L   + A DAD    N  + + +L   + +       IF ++   G+I     +DRE+  +Y   ++A DKG P    + ++ ITV+D NDN P ++    LN        N+ + + +G +            D G+ +++ +S E   +  +F+  N T  ILS      +H  +Y     ++ A D G PP  +Y  + INV   NDN
Sbjct:  156 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGM-LDREQRDSYDLTIKVQDG-GTPARASSALLRISILDTNDNAPKFEKMA------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGP-NSQLHYSILPDPSAR------GIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM----LNGYNFSVMENMPRLSPVGMVTV-------IDADKGENAHIHLSVEP--ESGEFVIQNGTGTILSSISFDREHQSTY---TFRLKAVDGGDPPRSSYVGVTINVLDENDN 711          
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 223.016 bits (567), Expect = 4.577e-59
Identity = 218/793 (27.49%), Postives = 373/793 (47.04%), Query Frame = 3
Query:  195 FHLLCGYLPSIISSQEITFHLVEENKRGLILGNL--NY-FITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCD---KEKCVIETKVVVQE-YSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTE-------SHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            F  L   LP + SS ++ + + EE    +++G+L  +Y +  SK      + +  +   Y  +D +T ++    T ID +++     EC +    EKC +E +V + +  S        ++E+ D++DN P F      + + E  +I     I  A D+D S +N   +Y+         LF  Q     D     ++VM  L+ E +  Y   +KV D         +++ + ++D NDN P F +  Y  ++PE+ P+G  +L+V A D+D  +  +  Y F Q++  V+ + ++++ +G+I+++  +         F+V A D      K     V I I D NDN P+I +   G +     +  I E+ P +T  + + VSD D G+NA V C     +  + K + +      + Y ++T  + DYE ++    EI+ +DSG+P L S  ++K+ + DVN+  P    +  E+ F EN   +  +M + A+D D G  + L YS+  D   R  F+IN  +G+I + N  LD+E  +   F V   D  I     T  V +T+LD+NDN P+F ++   F++ E +   S +   +   DADK E  H      +H     +E    +    +  G I + ++ DRE  S YT  + A D G+PP+S+   +TI V+D NDN+PV V P +++         ++ +   G+ V  ++A D D     ++ Y I S         SH  GE  +TL +   I+  H     YG   L +   D G P
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSK-----HLYKLELGHPYLRVDGKTGDIYTTETSIDRESL----RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM-VTVIDADKGENAH------IHL---SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY------LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGE--VTLEKA--IIRKH-----YGLHRLVVKVTDKGKP 808          

HSP 2 Score: 119.013 bits (297), Expect = 1.875e-26
Identity = 139/587 (23.68%), Postives = 243/587 (41.40%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFK-------ENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++++D NDN P F      + IPE+  IG       A D DS +   + Y        + +F +       EK+  +I +   L   ++  Y  T+   D      +   A + I I D NDN P    +       Y   + EN+P   ++  +  +D D G+NA ++ S       +  ++  D     I      D E +  ++  ++  D G+    +R  + I I D N+ +P I    F  ++ +       E++P    +  +  SD D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V + D NDNAP F  +L   +    +  + L   + A DAD    N  + + +L   + +       IF ++   G+I     +DRE+  +Y   ++A DKG P    + ++ ITV+D NDN P ++    LN        N+ + + +G +            D G+ +++ +S E   +  +F+  N T  ILS      +H  +Y     ++ A D G PP  +Y  + INV   NDN
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGM-LDREQRDSYDLTIKVQDG-GTPARASSALLRISILDTNDNAPKFEKMA------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGP-NSQLHYSILPDPSAR------GIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM----LNGYNFSVMENMPRLSPVGMVTV-------IDADKGENAHIHLSVEP--ESGEFVIQNGTGTILSSISFDREHQSTY---TFRLKAVDGGDPPRSSYVGVTINVLDENDN 719          
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 223.402 bits (568), Expect = 4.827e-59
Identity = 218/793 (27.49%), Postives = 373/793 (47.04%), Query Frame = 3
Query:  195 FHLLCGYLPSIISSQEITFHLVEENKRGLILGNL--NY-FITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCD---KEKCVIETKVVVQE-YSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTE-------SHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            F  L   LP + SS ++ + + EE    +++G+L  +Y +  SK      + +  +   Y  +D +T ++    T ID +++     EC +    EKC +E +V + +  S        ++E+ D++DN P F      + + E  +I     I  A D+D S +N   +Y+         LF  Q     D     ++VM  L+ E +  Y   +KV D         +++ + ++D NDN P F +  Y  ++PE+ P+G  +L+V A D+D  +  +  Y F Q++  V+ + ++++ +G+I+++  +         F+V A D      K     V I I D NDN P+I +   G +     +  I E+ P +T  + + VSD D G+NA V C     +  + K + +      + Y ++T  + DYE ++    EI+ +DSG+P L S  ++K+ + DVN+  P    +  E+ F EN   +  +M + A+D D G  + L YS+  D   R  F+IN  +G+I + N  LD+E  +   F V   D  I     T  V +T+LD+NDN P+F ++   F++ E +   S +   +   DADK E  H      +H     +E    +    +  G I + ++ DRE  S YT  + A D G+PP+S+   +TI V+D NDN+PV V P +++         ++ +   G+ V  ++A D D     ++ Y I S         SH  GE  +TL +   I+  H     YG   L +   D G P
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSK-----HLYKLELGHPYLRVDGKTGDIYTTETSIDRESL----RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM-VTVIDADKGENAH------IHL---SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY------LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGE--VTLEKA--IIRKH-----YGLHRLVVKVTDKGKP 808          

HSP 2 Score: 119.013 bits (297), Expect = 1.945e-26
Identity = 139/587 (23.68%), Postives = 243/587 (41.40%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFK-------ENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++++D NDN P F      + IPE+  IG       A D DS +   + Y        + +F +       EK+  +I +   L   ++  Y  T+   D      +   A + I I D NDN P    +       Y   + EN+P   ++  +  +D D G+NA ++ S       +  ++  D     I      D E +  ++  ++  D G+    +R  + I I D N+ +P I    F  ++ +       E++P    +  +  SD D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V + D NDNAP F  +L   +    +  + L   + A DAD    N  + + +L   + +       IF ++   G+I     +DRE+  +Y   ++A DKG P    + ++ ITV+D NDN P ++    LN        N+ + + +G +            D G+ +++ +S E   +  +F+  N T  ILS      +H  +Y     ++ A D G PP  +Y  + INV   NDN
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGM-LDREQRDSYDLTIKVQDG-GTPARASSALLRISILDTNDNAPKFEKMA------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGP-NSQLHYSILPDPSAR------GIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM----LNGYNFSVMENMPRLSPVGMVTV-------IDADKGENAHIHLSVEP--ESGEFVIQNGTGTILSSISFDREHQSTY---TFRLKAVDGGDPPRSSYVGVTINVLDENDN 719          
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Match: pcdh17 (protocadherin 17 [Source:Xenbase;Acc:XB-GENE-480220])

HSP 1 Score: 222.631 bits (566), Expect = 5.458e-59
Identity = 218/793 (27.49%), Postives = 373/793 (47.04%), Query Frame = 3
Query:  195 FHLLCGYLPSIISSQEITFHLVEENKRGLILGNL--NY-FITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCD---KEKCVIETKVVVQE-YSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTE-------SHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHP 2474
            F  L   LP + SS ++ + + EE    +++G+L  +Y +  SK      + +  +   Y  +D +T ++    T ID +++     EC +    EKC +E +V + +  S        ++E+ D++DN P F      + + E  +I     I  A D+D S +N   +Y+         LF  Q     D     ++VM  L+ E +  Y   +KV D         +++ + ++D NDN P F +  Y  ++PE+ P+G  +L+V A D+D  +  +  Y F Q++  V+ + ++++ +G+I+++  +         F+V A D      K     V I I D NDN P+I +   G +     +  I E+ P +T  + + VSD D G+NA V C     +  + K + +      + Y ++T  + DYE ++    EI+ +DSG+P L S  ++K+ + DVN+  P    +  E+ F EN   +  +M + A+D D G  + L YS+  D   R  F+IN  +G+I + N  LD+E  +   F V   D  I     T  V +T+LD+NDN P+F ++   F++ E +   S +   +   DADK E  H      +H     +E    +    +  G I + ++ DRE  S YT  + A D G+PP+S+   +TI V+D NDN+PV V P +++         ++ +   G+ V  ++A D D     ++ Y I S         SH  GE  +TL +   I+  H     YG   L +   D G P
Sbjct:   53 FLWLFFQLPILGSSTKVAYRVPEEQPPNILIGSLASDYGYPDSK-----HLYKLELGHPYLRVDGKTGDIYTTETSIDRESL----RECQNLEPGEKCFLEFEVSMTDLMSPVPRLLDGQIEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRD-SGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGMLDREQRDSYDLTIKVQDGGTPARASSALLRISILDTNDNAPKFEKMAYEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDK-GANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGPNSQLHYSILPDPSARGIFSINPDSGQIRV-NTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFMLNGYNFSVMENMPRLSPVGM-VTVIDADKGENAH------IHL---SVEPESGEFVIQNGTGTILSSISFDREHQSTYTFRLKAVDGGDPPRSSYVGVTINVLDENDNAPVIVVPSNISYKY------LTPQTHPGTPVNWVRAEDMDTGINAELDYSIASGNPFELFQISHNNGE--VTLEKA--IIRKH-----YGLHRLVVKVTDKGKP 808          

HSP 2 Score: 119.013 bits (297), Expect = 2.099e-26
Identity = 139/587 (23.68%), Postives = 243/587 (41.40%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFK-------ENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++++D NDN P F      + IPE+  IG       A D DS +   + Y        + +F +       EK+  +I +   L   ++  Y  T+   D      +   A + I I D NDN P    +       Y   + EN+P   ++  +  +D D G+NA ++ S       +  ++  D     I      D E +  ++  ++  D G+    +R  + I I D N+ +P I    F  ++ +       E++P    +  +  SD D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V + D NDNAP F  +L   +    +  + L   + A DAD    N  + + +L   + +       IF ++   G+I     +DRE+  +Y   ++A DKG P    + ++ ITV+D NDN P ++    LN        N+ + + +G +            D G+ +++ +S E   +  +F+  N T  ILS      +H  +Y     ++ A D G PP  +Y  + INV   NDN
Sbjct:  164 IEIMDINDNTPNFNSPVITLSIPENTNIGMLFPIPAATDRDSGVNGVSSYELIVGPEAQDLFGLQVAEDQDEKQPQLIVMGM-LDREQRDSYDLTIKVQDG-GTPARASSALLRISILDTNDNAPKFEKMA------YEAELPENSPMGHSVLQVKANDSDQGVNAEIDYSFHQASDTVRRLLHLDRSTGLITVQGPIDREDVGTLKFSVVAKDKGANPKTARTQVTITIRDTNDNKPVIEIRGFGLVTHQGGVANISEDVPVETPVALVQVSDIDEGVNAAVTCVVAGDVPFQLKQVSDTGSDSKKKYFLQTTTALDYESVKEYTIEIVAVDSGNPPLSSTNSLKVQVTDVNDNAPVFSQSLMEVVFPENNDINDLVMEVSATDADSGP-NSQLHYSILPDPSAR------GIFSINPDSGQIRVNTVLDREQREHYDFHVVAVDKGIPSLKGTASVVITVLDRNDNDPKFM----LNGYNFSVMENMPRLSPVGMVTV-------IDADKGENAHIHLSVEP--ESGEFVIQNGTGTILSSISFDREHQSTY---TFRLKAVDGGDPPRSSYVGVTINVLDENDN 719          
BLAST of Protocadherin 11 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 229.565 bits (584), Expect = 5.781e-62
Identity = 237/807 (29.37%), Postives = 384/807 (47.58%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL--SYGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  ++E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   D D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS N+S     F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K   TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDEDAGE-NKAVTLSILNDNENF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPS-NTS-----FKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KALHTLVL 769          

HSP 2 Score: 102.449 bits (254), Expect = 1.484e-21
Identity = 146/587 (24.87%), Postives = 246/587 (41.91%), Query Frame = 3
Query:  837 VRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++  IIV+  D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + +RE+   +  T+ A+D G PP  +   + +TV+D NDNSP +      N  +     N+ K + +G I           +D G+   V +S  +    E F+ L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  126 IKIKIIVK--DTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITV-------TDEDAGENKAVTLSILN--DNENFV-LDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          
BLAST of Protocadherin 11 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 231.106 bits (588), Expect = 1.610e-61
Identity = 236/807 (29.24%), Postives = 382/807 (47.34%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  ++E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   D D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K   TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDEDAGE-NKAVTLSILNDNENF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KALHTLVL 769          

HSP 2 Score: 103.99 bits (258), Expect = 5.873e-22
Identity = 145/583 (24.87%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + +RE+   +  T+ A+D G PP  +   + +TV+D NDNSP +      N  +     N+ K + +G I           +D G+   V +S  +    E F+ L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITV-------TDEDAGENKAVTLSILN--DNENFV-LDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 100.523 bits (249), Expect = 7.283e-21
Identity = 141/577 (24.44%), Postives = 240/577 (41.59%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +  +     R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 230.335 bits (586), Expect = 2.361e-61
Identity = 235/807 (29.12%), Postives = 383/807 (47.46%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   ++ +C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  ++E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   D D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K   TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGAS-YAEENECFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDEDAGE-NKAVTLSILNDNENF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KALHTLVL 769          

HSP 2 Score: 103.99 bits (258), Expect = 6.817e-22
Identity = 145/583 (24.87%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + +RE+   +  T+ A+D G PP  +   + +TV+D NDNSP +      N  +     N+ K + +G I           +D G+   V +S  +    E F+ L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITV-------TDEDAGENKAVTLSILN--DNENFV-LDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 100.523 bits (249), Expect = 8.173e-21
Identity = 141/577 (24.44%), Postives = 240/577 (41.59%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +  +     R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 230.72 bits (587), Expect = 2.639e-61
Identity = 236/807 (29.24%), Postives = 382/807 (47.34%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  ++E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   D D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K   TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDEDAGE-NKAVTLSILNDNENF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KALHTLVL 769          

HSP 2 Score: 104.375 bits (259), Expect = 5.078e-22
Identity = 145/583 (24.87%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + +RE+   +  T+ A+D G PP  +   + +TV+D NDNSP +      N  +     N+ K + +G I           +D G+   V +S  +    E F+ L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITV-------TDEDAGENKAVTLSILN--DNENFV-LDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 100.523 bits (249), Expect = 7.522e-21
Identity = 141/577 (24.44%), Postives = 240/577 (41.59%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +  +     R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. Ensembl Mouse
Match: Pcdh9 (protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801])

HSP 1 Score: 230.72 bits (587), Expect = 2.639e-61
Identity = 236/807 (29.24%), Postives = 382/807 (47.34%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  ++E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   D D  E N ++   +L+   N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K   TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDEDAGE-NKAVTLSILNDNENF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDIDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KALHTLVL 769          

HSP 2 Score: 104.375 bits (259), Expect = 5.078e-22
Identity = 145/583 (24.87%), Postives = 243/583 (41.68%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + +RE+   +  T+ A+D G PP  +   + +TV+D NDNSP +      N  +     N+ K + +G I           +D G+   V +S  +    E F+ L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTH----NHFQFFVSENLPKYSTVGVITV-------TDEDAGENKAVTLSILN--DNENFV-LDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 100.523 bits (249), Expect = 7.522e-21
Identity = 141/577 (24.44%), Postives = 240/577 (41.59%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +  +     R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFNREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Match: sp|Q9HC56|PCDH9_HUMAN (Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 PE=1 SV=2)

HSP 1 Score: 236.498 bits (602), Expect = 2.328e-62
Identity = 238/807 (29.49%), Postives = 385/807 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYLPSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            F+LL     C  L S I+ QE+ + + EE    + +GN                   L Y + SK    P +     + + F   N+         ID + +C+  S   + E C  E +VV+     ++    +K+ VKD +DN P+F      I + E   IN+   I  A D D +  N  ++Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D  T Q      + V V D NDN P+F E +  V IPE+ P+G  ++++ A DAD  S+   +  +G Q     K +F +   +G+I++++SL   + + +  TV A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +       L+ +  +   Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       ELS  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+   P  +   V VT+LD+NDN+P+F H    F + E L  YS +   I   DAD  E N ++   +L+  +N        + D  S G I++ V+ DRE+ S+YT  + A D G PP+S++  +TI V+DVNDNSPV +SPPS  S      F +   +AI GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:    6 FYLLAALIACLRLDSAIA-QELIYTIREELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEIFTTSNR---------IDREKLCAGASYAEENE-CFFELEVVILPNDFFRL-IKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPD-TGFNGVQHYELLNGQSVFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPAR---ATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREVPFHLKAVYDNQ--YLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NKAVTLSILNDNDNF-------VLDPYS-GVIKSNVSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDNSPVVISPPSNTS------FKLVPLSAIPGSVVAEVFAVDVDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDVGLHRLVVNISDLGYP--KSLHTLVL 769          

HSP 2 Score: 105.916 bits (263), Expect = 1.108e-21
Identity = 142/583 (24.36%), Postives = 242/583 (41.51%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCID-SGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I + V D NDN P+F      + IPE+  I  +    +A D D+       Y   +  +V  +  +E   G     + ++Q+L   +K  Y+  +   D      K   A +++ + DVNDN P+      +      + I EN P  T +  +H +D D G NA +      +     + + A      + T+ RS D E   + +  +L  D S +PA   R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   E+   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  ++ E       L+T I A D D  + N  I+++L           +   FD+  K  + T   + DRE+   +  T+ A+D G PP  +   + +TV+D NDNSP +        +    +F +S+     S V  +   D D  +   ++  I++   ++       L+  SG++  +   +S+ R         + A D G PP  + A + INV   NDN
Sbjct:  128 IKIIVKDTNDNAPMFPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDG-GTPQKSSTAILQVTVSDVNDNRPV------FKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTGLITVQRSLDREETAIHKVTVLASDGSSTPA---RATVTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTDVNGKVICFIEREV-PFHLKAVYDNQYLLETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIFNQPVIELSVSENNRRGLYLTT-ISATDEDSGK-NADIVYQLGP---------NASFFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENKAVTLSILNDNDNF------VLDPYSGVIKSN---VSFDREQQSSYTFDVKATDGGQPPRSSTAKVTINVMDVNDN 671          

HSP 3 Score: 99.7525 bits (247), Expect = 8.398e-20
Identity = 141/577 (24.44%), Postives = 239/577 (41.42%), Query Frame = 3
Query:  915 KIPESYPIGK--KILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA------IDALSVTFKKDY---ADVEIEIEDVNDNYPIISLLHGYMPDPYA-IRIDENTPPKTLFSI-HVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRY----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSK---LSTRIE---AKDADKDEINHSII--------FRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++PE+ PIG   K L ++  +A +       Y   S      +  +   +G I    S  I+++       YA       +   V    D+     ++I ++D NDN P+        P P   I I ENT   + F I   +D DTG N V +  L     V   D++E  + + +  Q+   ++ D E       +I   D G+P   S   +++ + DVN+  P  +    E+   EN P    ++ + A+D D G  A +RY     +    +  F +N+ TG +I    +LD+E     K  V  +D    P  AT  VT+ + D NDN P        +   G  + S+   ++T+I      D D D +N  +I        F L   Y+N+  L              ET   +D E    ++  I+A D G P  + +  + + + D NDN P++        ++P    ++S+    G  +  + A D+D      I Y +    S      F  L+  +G+L+  +        R +  ++A D+G PPL++ A +I+ V   NDN
Sbjct:   33 ELPENVPIGNIPKDLNISHINAATGTSASLVYRLVSKAGDAPLVKVSSSTGEI-FTTSNRIDREKLCAGASYAEENECFFELEVVILPNDFFRLIKIKIIVKDTNDNAPM-------FPSPVINISIPENTLINSRFPIPSATDPDTGFNGVQHYELLNGQSVFGLDIVETPEGE-KWPQLIVQQNLDREQKDTYVMKIKVEDGGTPQKSSTAILQVTVSDVNDNRPVFKEGQVEVHIPENAPVGTSVIQLHATDADIGSNAEIRYIFGAQVAPATKRLFALNNTTG-LITVQRSLDREETAIHKVTVLASDGSSTPARAT--VTINVTDVNDNPPNIDLRYIISPINGTVYLSEKDPVNTKIALITVSDKDTD-VNGKVICFIEREVPFHLKAVYDNQYLL--------------ETSSLLDYEGTKEFSFKIVASDSGKPSLNQTALVRVKLEDENDNPPIF--------NQPVIELSVSENNRRGLYLTTISATDEDSGKNADIVYQLGPNAS------FFDLDRKTGVLTASRVFDREEQERFIFTVTARDNGTPPLQSQAAVIVTVLDENDN 568          
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Match: sp|Q08174|PCDH1_HUMAN (Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 PE=1 SV=2)

HSP 1 Score: 205.297 bits (521), Expect = 1.029e-52
Identity = 202/753 (26.83%), Postives = 346/753 (45.95%), Query Frame = 3
Query:  342 EFHVSSKYFEIDNQTKNVQMVST-IDLDTICSTDSECCDK---EKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDI----LSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEK----IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINV 2510
            +  V + Y  +D +T ++    T ID + +     EC ++   + C++E +V + +  Q  S   L+ +++  D N         +I L+  E  +I +   I  A D+D    N   +Y+        +LF  Q   D       ++VM +L+ E    Y   +KV D         +++ V V+D NDN P F    Y  ++ E+ PIG  +++V A D+D     +  Y F Q+   V+ +  +++ +G+I+++  +     S   F+V A D      K   A V + ++D+NDN P I +   G +     +  I E+   +T  + + VSD+D G NA V C     +  + +   E      + Y ++T    DYE ++    EI+ +DSG+P L S  ++K+ +VDVN+  P    +  E++F EN    + I  I ASD D G  A L YSL  +   +  FTI+  TGEI +   +LD+E  +S + KV   D        T  V V +LD NDN P+F +    F++ E +   S +   +   D DK E             N +++L  E+        +  G I + ++ DRE+ S YT  + A D G PP+S    +TI V+D NDN+P +++ PS  S +      ++ +  +G  V+Q+ A D D     ++ Y I     +        +   SG +++ +      +G   L +   D G PP   Y T ++++
Sbjct:   91 KLEVGAPYLRVDGKTGDIFTTETSIDREGL----RECQNQLPGDPCILEFEVSITDLVQNGSPRLLEGQIEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGP-NGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDR-GTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQV-KTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENMPALSPVGM-VTVIDGDKGE-------------NAQVQLSVEQDNGDFVIQNGTGTILSSLSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDNAP-YITAPSNTSHK-----LLTPQTRLGETVSQVAAEDFDSGVNAELIYSIAGGNPY----GLFQIGSHSGAITLEKEIERRHHGLHRLVVKVSDRGKPP--RYGTALVHL 810          

HSP 2 Score: 141.354 bits (355), Expect = 1.391e-32
Identity = 135/498 (27.11%), Postives = 229/498 (45.98%), Query Frame = 3
Query: 1173 EIEIEDVNDNYP-----IISLLHGYMPDPYAIRIDENTPPKTLFSIHV-SDKDTGINAVVNCSLRV--RRKDLLEM-IKADMEIYQIRTI--RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILR-----YSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPF-TIQEGLSFYSK------LSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN----LFSGLNMAIIIGM 2567
            +IE++D+NDN P     +I+L            I ENT   +LF I + SD+D G N V +  L+     ++L  + +  D E  Q + I   + D E     +  I   D GSP   S   +++ ++D N+  P       E    EN P    ++ + A+D D+GA        +   E+ R    ++  TG +I     +D+E   +++F V   D   NP +A   V VT+ D NDNAP   +  +   T Q+G++  S+          ++  D D+ E N ++   +      ++    E   D   K  ++T   +D EK  +YT+ I+A D GNPP S++ ++ + V+DVNDN+PV+        S  E  F  + +   G ++A++ A      D G  + ++ S E     +   T++  +G + +      +   SY    LK+ A D G P L+  AT+++NV   NDN    + SG N +++  M
Sbjct:  155 QIEVQDINDNTPNFASPVITLA-----------IPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMGNLDRERWDSYDLTIKVQDGGSPPRASSALLRVTVLDTNDNAPKFERPSYEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTG-LITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGE-NAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQ------SVTEVAFPENNKP--GEVIAEITA---SDADSGSNAELVYSLEPEPAAKGLFTISPETGEIQVKTSLDREQRESY---ELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFMLSGYNFSVMENM 625          

HSP 3 Score: 117.472 bits (293), Expect = 3.447e-25
Identity = 138/588 (23.47%), Postives = 240/588 (40.82%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEEL--------SFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTIN--SRTGE------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++V D NDN P F      + IPE+  IG       A D D+       Y  Q+    + +F +       EK+  +I +  +L   +   Y  T+   D  S   +   A + + + D NDN P            Y   + EN+P   ++  +  +D D G NA +  +     + +  +++ D     I      D E L  +   +L  D G+    +R  + + + D+N+  P+I      L        +  E++ E   +  +  SD+D+G     +    G + F +   S TG        + +   LD E       ++   DS   P ++T  + V ++D NDNAP F  ++        +   ++   I A DAD    N  +++ L      + E   + +F +S + GEI+   ++DRE+  +Y L ++A D+G+P    +  + + V+D NDN P ++    L+        N+   + +G +            D G+ + V +S E       F+  N T  ILS     LS+ R        ++ A D G PP   Y  + INV   NDN
Sbjct:  156 IEVQDINDNTPNFASPVITLAIPENTNIGSLFPIPLASDRDAGPNGVASYELQAGPEAQELFGLQVAEDQEEKQPQLIVMG-NLDRERWDSYDLTIKVQDGGSPP-RASSALLRVTVLDTNDNAPKFERPS------YEAELSENSPIGHSVIQVKANDSDQGANAEIEYTFHQAPEVVRRLLRLDRNTGLITVQGPVDREDLSTLRFSVLAKDRGTNPKSARAQVVVTVKDMNDNAPTIEIRGIGLVTHQDGMANISEDVAEETAVALVQVSDRDEGENAAVTCVVAGDVPFQLRQASETGSDSKKKYFLQTTTPLDYEKVKDYTIEIVAVDSGNPPLSSTNSLKVQVVDVNDNAPVFTQSVTEVAFPENNKPGEVIAEITASDADSGS-NAELVYSL------EPEPAAKGLFTISPETGEIQVKTSLDREQRESYELKVVAADRGSPSLQGTATVLVNVLDCNDNDPKFM----LSGYNFSVMENMPALSPVGMVTV-------IDGDKGENAQVQLSVEQ--DNGDFVIQNGTGTILSS----LSFDREQQSTYTFQLKAVDGGVPPRSAYVGVTINVLDENDN 711          
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Match: sp|Q9BZA8|PC11Y_HUMAN (Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 GN=PCDH11Y PE=1 SV=1)

HSP 1 Score: 195.667 bits (496), Expect = 2.600e-49
Identity = 183/660 (27.73%), Postives = 304/660 (46.06%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN--VKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEI-YQIRTIRS----------FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-----GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH----PLSYGRTLLKISAHDHGHP 2474
            I + E  +IN+  ++  A+D D   IN  +NY+       F L V +  P+   +  ++V + L+ E K  Y  K+KV D  +      +I+ V V D NDN P+F E +  V IPE+ P+G  + ++ A DAD     K  + F +  +   + +F++   +G+I++K+ L   +   +   V A D          A V + + DVNDN P I + +   P    + + EN P  T  + I V+DKD   N  V C               D EI +++R + S           DYE  +    ++L  D+G P L     + I + D N+  P    +F  +S  EN      +M + A+D D G  A + Y L       F+++ RTG + +    LD+E  D   F +   D+ + P T+ + V V+I+DQNDN+P F H    F + E L  +  +   I   D D  + N ++   +L   ++         F + S+ G I   ++ DREK  +YT  + A+D G   +S+S  +TI V+DVNDN PV++ PP          +N S E  +     G++V Q+ A+D D     ++ Y I+   +         +++ +G +++ +      L   R L+K  A+D G P
Sbjct:  178 ISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIET-PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDG---GLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCF-------------TDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK-KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYKFYVPENLPRHGTVGL-ITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPP----------YNYSYELVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNT----RDLFAIDQETGNITLMEKCDVTDLGLHRVLVK--ANDLGQP 791          

HSP 2 Score: 102.064 bits (253), Expect = 1.755e-20
Identity = 122/475 (25.68%), Postives = 208/475 (43.79%), Query Frame = 3
Query: 1182 IEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVS-DKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYS----LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-----VHTLPFTI--QEGLSFYSKLS-TRIEAKDADKDE-----INHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            IED+NDN P+      +      I I EN+   + +++  + D D GIN V N  L     +   D++E  + D ++ Q+   +  D E       ++   D G P   S   +++ + D N+  P  +    E+S  EN P    +  + A+D D G  A + +S    +  I R  F +N+ TG I +    LD+E   + K  V  +D  + P  A + V VT  D NDN P       V+ +  T+   E +   +K++   +  KDAD +       +H I FRL   ++N+  L              E    +D E    Y + +LA D G PP + S  + I V D NDN+PV+        ++     +I +  + G  + ++ A D D     +I+Y++             +L+  +G+L++ +        + L  I A D+G PPL +  T+ +++   NDN
Sbjct:  161 IEDINDNAPL------FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGD-KMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL--------------ENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF--------TQSFVTVSIPENNSPGIQLMKVSATDADSGPNAEINYLLGP-----DAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDN 598          

HSP 3 Score: 102.064 bits (253), Expect = 2.028e-20
Identity = 144/583 (24.70%), Postives = 242/583 (41.51%), Query Frame = 3
Query:  867 DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLR------VRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSR-TGEIIMSNVT-LDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARF----NISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            D NDN P+F      + IPE+  I  K     A D D  +     Y    + N+  +  IE   G     + +++ L   +K  Y+  V   D      +   A +++ + D NDN+P+      +      + I EN P  T +  +H +D D G NA ++ S         RR   L  + A   +  I+     D E  +    ++L + S    + +R  + + + DVN+  PSI   +      + +   ENIP +  I  I  +DKD     R +      I F +    + + ++ N   LD E       K+   D+   P   +  + + + D+NDNAP F  + +  +I E  S   +L  ++ A DAD    N  I + L      +  L           G +  V  +DREK+  Y  TILA+D G PP +++  + +++ID NDNSPV+        +  E +F    N+ +   +G I            D+G  S V +S     + + F T++  +G++  +   +S+ R         + A D G     + A + INV   NDN
Sbjct:  163 DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPV------FKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR---LFHLNATTGLITIK--EPLDRE--ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLLENAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-MKVSATDADSGP-NAEINYLLGPDAPPEFSLDRRT-------GMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVF--------THNEYKFYVPENLPRHGTVGLITV-------TDPDYGDNSAVTLSILD--ENDDF-TIDSQTGVIRPN---ISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDN 701          
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Match: sp|Q6WXV7|PC11X_PONPY (Protocadherin-11 X-linked OS=Pongo pygmaeus OX=9600 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.935e-49
Identity = 179/644 (27.80%), Postives = 302/644 (46.89%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN--VKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH----PLSYGRTLLKISAHDHGHP 2474
            I + E  +IN+  ++  A+D D   IN  +NY+       F L V +  P+   +  ++V + L+ E K  Y  K+KV D  +      +I+ V V D NDN P+F E +  V IPE+ P+G  + ++ A DAD     K  + F +  +   + +F++   +G+I++K+ L   +   +   V A D   +  +   A V + + DVNDN P I + +   P    + + EN P  T  + I V+DKD   N  V C         L  + ++   + + T    DYE  +    ++L  D+G P L     + I + D N+  P    +F  +S  EN      +  + A+D D G  A + Y L       F+++ RTG + +    LD+E  D   F +   D+ + P T+ + V V+I+DQNDN+P F H    F + E L  +  +   I   D D  + N ++   +L   ++         F + S+ G I   ++ DREK  +YT  + A+D G   +S+S  +TI V+DVNDN PV++ PPS  S E      +      G++V Q+ A+D D     ++ Y I+   +         +++ +G +++ +      L   R L+K  A+D G P
Sbjct:  146 ISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNIFGLDVIET-PEGDKMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDGGLMPAR---AMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ--FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK-KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYE-----LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTR----DLFAIDQETGNITLMEKCDVTDLGLHRVLVK--ANDLGQP 759          

HSP 2 Score: 105.145 bits (261), Expect = 2.214e-21
Identity = 123/475 (25.89%), Postives = 208/475 (43.79%), Query Frame = 3
Query: 1182 IEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVS-DKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYS----LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQ-----FVHTLPFTI--QEGLSFYSKLS-TRIEAKDADKDE-----INHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            IED+NDN P+             I I EN+   + +++  + D D GIN V N  L     +   D++E  + D ++ Q+   +  D E       ++   D G P   S   +++ + D N+  P  +    E+S  EN P    +  + A+D D G  A + +S    +  I R  F +N+ TG I +    LD+E   + K  V  +D  + P  A + V VT  D NDN P       V+ +  T+   E +   +K++   +  KDAD +       +H I FRL   ++N+  L              ET   +D E    Y + +LA D G PP + S  + I V D NDN+PV+        ++     +I +  + G  + ++ A D D     +I+Y++             +L+  +G+L++ +        + L  I A D+G PPL +  T+ +++   NDN
Sbjct:  129 IEDINDNAPLFPATV------INISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGD-KMPQLIVQKELDREEKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL--------------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF--------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGP-----DAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDN 566          

HSP 3 Score: 103.605 bits (257), Expect = 6.296e-21
Identity = 120/465 (25.81%), Postives = 201/465 (43.23%), Query Frame = 3
Query:  867 DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLR------VRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKDK---GAILRYSLDEIG-RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            D NDN P+F      + IPE+  I  K     A D D  +     Y    + N+  +  IE   G     + +++ L   +K  Y+  V   D      +   A +++ + D NDN+P+             + I EN P  T +  +H +D D G NA ++ S         RR   L  + A   +  I+     D E  +    ++L + S    + +R  + + + DVN+  PSI   +      + +   ENIP +  I  I  +DKD    G +  ++  EI  R+    +++   ++ +   LD E       K+   D+   P   +  + + + D+NDNAP F  + +  +I E  S   +L T++ A DAD    N  I + L      +  L           G +  V  +DREK+  Y  TILA+D G PP +++  + +++ID NDNSPV+
Sbjct:  131 DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNIFGLDVIETPEGDKMPQLIVQKELDREEKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVFKETE------IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR---LFHLNATTGLITIK--EPLDRE--ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPINDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQF--LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSATDADSGP-NAEINYLLGPDAPPEFSLDRR-------TGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVF 570          
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Match: sp|Q6X862|PC11X_GORGO (Protocadherin-11 X-linked OS=Gorilla gorilla gorilla OX=9595 GN=PCDH11X PE=3 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 2.986e-49
Identity = 179/644 (27.80%), Postives = 300/644 (46.58%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN--VKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH----PLSYGRTLLKISAHDHGHP 2474
            I + E  +IN+  ++  A+D D   IN  +NY+       F L V +  P+   +  ++V + L+ E K  Y  K+KV D  +      +I+ V V D NDN P+F E +  V IPE+ P+G  + ++ A DAD     K  + F +  +   + +F++   +G+I++K+ L   +   +   V A D          A V + + DVNDN P I + +   P    + + EN P  T  + I V+DKD   N  V C         L  + ++   + + T    DYE  +    ++L  D+G P L     + I + D N+  P    +F  +S  EN      +  + A+D D G  A + Y L       F+++ RTG + +    LD+E  D   F +   D+ + P T+ + V V+I+DQNDN+P F H    F + E L  +  +   I   D D  + N ++   +L   ++         F + S+ G I   ++ DREK  +YT  + A+D G   +S+S  +TI V+DVNDN PV++ PPS  S E      +      G++V Q+ A+D D     ++ Y I+   +         +++ +G +++ +      L   R L+K  A+D G P
Sbjct:  146 ISIPENSAINSKYTLPAAVDPDVG-INGVQNYELIKSQNMFGLDVIET-PEGDKMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKEPLDREETPNHKLLVLASDG---GLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQ--FLLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGPDAPPEFSLDRRTGMLTVVK-KLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVFTHNEYNFYVPENLPRHGTVGL-ITVTDPDYGD-NSAVTLSILDENDD---------FTIDSQTGVIRPNISFDREKQESYTFYVKAEDGGRVSRSSSAKVTINVVDVNDNKPVFIVPPSNYSYE-----LVLPSTNPGTVVFQVIAVDNDTGMNAEVRYSIVGGNTR----DLFAIDQETGNITLMEKCDVTDLGLHRVLVK--ANDLGQP 759          

HSP 2 Score: 104.375 bits (259), Expect = 3.329e-21
Identity = 123/475 (25.89%), Postives = 209/475 (44.00%), Query Frame = 3
Query: 1182 IEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVS-DKDTGINAVVNCSLRVRRK----DLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYS----LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQ-----FVHTLPFTI--QEGLSFYSKLS-TRIEAKDADKDE-----INHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            IED+NDN P+      +      I I EN+   + +++  + D D GIN V N  L   +     D++E  + D ++ Q+   +  D E       ++   D G P   S   +++ + D N+  P  +    E+S  EN P    +  + A+D D G  A + +S    +  I R  F +N+ TG I +    LD+E   + K  V  +D  + P  A + V VT  D NDN P       V+ +  T+   E +   +K++   +  KDAD +       +H I FRL   ++N+  L              ET   +D E    Y + +LA D G PP + S  + I V D NDN+PV+        ++     +I +  + G  + ++ A D D     +I+Y++             +L+  +G+L++ +        + L  I A D+G PPL +  T+ +++   NDN
Sbjct:  129 IEDINDNAPL------FPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGD-KMPQLIVQKELDREKKDTYVMKVKVEDGGFPQRSSTAILQVSVTDTNDNHPVFKETEIEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARRLFHLNATTGLITIKE-PLDREETPNHKLLVLASDGGLMPARAMVLVNVT--DVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQFLL--------------ETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVF--------TQSFVTVSIPENNSPGIQLTKVSATDADSGPNAEINYLLGP-----DAPPEFSLDRRTGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDN 566          

HSP 3 Score: 104.375 bits (259), Expect = 4.117e-21
Identity = 121/465 (26.02%), Postives = 201/465 (43.23%), Query Frame = 3
Query:  867 DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLR------VRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKDK---GAILRYSLDEIG-RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            D NDN P+F      + IPE+  I  K     A D D  +     Y    + N+  +  IE   G     + +++ L   KK  Y+  V   D      +   A +++ + D NDN+P+             + I EN P  T +  +H +D D G NA ++ S         RR   L  + A   +  I+     D E  +    ++L + S    + +R  + + + DVN+  PSI   +      + +   ENIP +  I  I  +DKD    G +  ++  EI  R+    +++   ++ +   LD E       K+   D+   P   +  + + + D+NDNAP F  + +  +I E  S   +L T++ A DAD    N  I + L      +  L           G +  V  +DREK+  Y  TILA+D G PP +++  + +++ID NDNSPV+
Sbjct:  131 DINDNAPLFPATVINISIPENSAINSKYTLPAAVDPDVGINGVQNYELIKSQNMFGLDVIETPEGDKMPQLIVQKELDREKKDTYVMKVKVEDG-GFPQRSSTAILQVSVTDTNDNHPVFKETE------IEVSIPENAPVGTSVTQLHATDADIGENAKIHFSFSNLVSNIARR---LFHLNATTGLITIK--EPLDRE--ETPNHKLLVLASDGGLMPARAMVLVNVTDVNDNVPSIDIRYIVNPVNDTVVLSENIPLNTKIALITVTDKDADHNGRVTCFTDHEIPFRLRPVFSNQF--LLETAAYLDYESTKEYAIKLLAADAGKPPLNQSAMLFIKVKDENDNAPVFTQSFVTVSIPENNSPGIQL-TKVSATDADSGP-NAEINYLLGPDAPPEFSLDRR-------TGMLTVVKKLDREKEDKYLFTILAKDNGVPPLTSNVTVFVSIIDQNDNSPVF 570          
BLAST of Protocadherin 11 vs. TrEMBL
Match: A0A3R7DDS9 (Protocadherin-11 Y-linked (Fragment) OS=Clonorchis sinensis OX=79923 GN=PCDH11Y PE=4 SV=1)

HSP 1 Score: 311.227 bits (796), Expect = 3.780e-85
Identity = 249/893 (27.88%), Postives = 415/893 (46.47%), Query Frame = 3
Query:  234 SQEITFHL--VEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVV--QEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN--VKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKD---YADVEIEIEDVNDNYPII------SLLHGYMPDPY------------------AIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLE-------------MIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP-ALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY----------SLDEIGRI------------------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINP-HTATMFVTVTILDQNDNAPQFVH----------TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY---------------------NNKMELLHEK----------------IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKN---YATLIINVQQPNDNLF 2534
            ++E+  HL   EE      +G+++  +   L T      F   + +F +   T  V +   ID + +C     CC    C ++  V +  +E  ++ ++ +LKV+++D +DN P F    Q + +SE   + T I++  A D D   +NQ + Y   + + TF L + +  P +  + + R L+ E  ++Y   L+ CD     C R+++ +Q++DENDN+PIF   +Y  ++ E+  +G+ +L + A D D+    +  Y      +  +   F + +++G I LK+ L+ N +  Y F V A DA++     D    A++ + +ED+N+  P I      + L    P P                   ++ I ENTPP  +  + V D D G N+ V CSL     D L              +  +   IY +RT R +DYEI  ++  +++C D G P AL S + I + +VDVNEF+P            EN P  K I++I A+D+D+GA+LRY          + D+ GR                   YF +   TG I  S +TLD+E    V   V ++DS + P  TAT  V++ ++D+NDNAP FV+            PFT+ E    +++LS ++EA+D D+ E N  + F LL TY                     +   E+ H+                 IF V+  G IET+V +DRE    Y L + AQD+G  P +++  + I V+D NDNSPVWV P  ++ +      N++     GS+  +L+A D D ++ G+++Y+ +      +GE    ++   G+L         G TL++     +G  P  N    + L     +PN+N +
Sbjct:   22 AEEVQVHLQMREETPPHTRIGSVSSSLPVTLGTK---LHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESAVVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTEL-PSV-RLQLTRPLDREKTELYTATLEACDPGA--CARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFAGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLSRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRRVYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDDSGRSETATAMDDAGLSRMEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPIFVNPPSESTDRVRAKPFTVMENAPRFTRLSEKLEARDPDQGE-NGRVQFSLLDTYALTRSSRQGSTNIRTNEQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGAQPLASTIMLRIDVLDANDNSPVWVFPTPMDRT-----INLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGP----RGEPLRGVSLGEGLLD--------GLTLVR-----NGEKPPTNEQQRSALQTGPGRPNENGY 884          
BLAST of Protocadherin 11 vs. TrEMBL
Match: A0A074ZRN8 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_06647 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 7.473e-85
Identity = 242/853 (28.37%), Postives = 403/853 (47.25%), Query Frame = 3
Query:  201 LLCGYLPSIISSQEITFHL--VEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVV--QEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKD---YADVEIEIEDVNDNYPIISLLHGYM-------PDP-------------YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLE-------------MIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP-ALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY----------SLDEIGRI------------------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH-TATMFVTVTILDQNDNAPQFVHTL----------PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY---------------------NNKMELLHEK----------------IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL 2402
            LL   L S   ++E+  HL   EE      +G+++  + + L T      F   + +F +   T  V +   ID + +C     CC    C ++  V +  +E  ++ ++ +LKV+++D +DN P F    Q + +SE   + T I++  A D D   +NQ + Y   + + TF L + +  P +  + + R L+ E  ++Y   L+ CD     C R+++ +Q++DENDN+PIF   +Y  ++ E+  +G+ +L + A D D+    +  Y      + ++   F + +++G I LK+ L+ N +  Y F V A DA++     D    A++ + +ED+N+  P I  +           P P              ++ I ENTPP  +  + V D D G N+ V CSL     D L              +  +   IY +RT R +DYEI  ++  +++C D G P AL S + I + +VDVNEF+P            EN P  K I++I A+D+D+GA+LRY          + DE GR                   YF +   TG I  S + LD+E    V   V ++DS + P  TAT  V++ ++D+NDNAP FV+            PFT+ E    +++LS ++EA+D D+ E N  + F LL TY                     +   E+ H+                 IF V+  G IET+V +DRE    Y L + AQD+G+ P +++  + I V+D NDNSPVWV P  ++ +      N++     GS+  +L+A D D ++ G+++Y+ +      +GE    ++   G+L
Sbjct:   11 LLLVILASCECAEEVQVHLQMREETPPHTRIGSVSSSLPATLGTK---LHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESALVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTEL-PSV-RLQLTRPLDREKTELYTANLEACDPGA--CARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLFETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALASANPPPPDFTGQKSSEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLNRPFIGGSVSPNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRRVYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDESGRSESATAMDDAGLSRIESNKYFVMEPETGVIRTSQIALDRETVVGVTLVVLVSDSTMPPKFTATTTVSIEVIDENDNAPVFVNPPAESSDRVKVKPFTVMENAPRFTRLSEKLEARDPDQGE-NGRVQFSLLDTYALTRSSRQGSTNIRTNGQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGSQPLASTIMLRIDVLDANDNSPVWVFPTPMDRT-----INLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGP----RGEPLRGVSLGEGLL 846          
BLAST of Protocadherin 11 vs. TrEMBL
Match: G7YAD6 (Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN=CLF_103782 PE=4 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 1.129e-84
Identity = 249/893 (27.88%), Postives = 415/893 (46.47%), Query Frame = 3
Query:  234 SQEITFHL--VEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVV--QEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN--VKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKD---YADVEIEIEDVNDNYPII------SLLHGYMPDPY------------------AIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLE-------------MIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP-ALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY----------SLDEIGRI------------------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINP-HTATMFVTVTILDQNDNAPQFVH----------TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY---------------------NNKMELLHEK----------------IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKN---YATLIINVQQPNDNLF 2534
            ++E+  HL   EE      +G+++  +   L T      F   + +F +   T  V +   ID + +C     CC    C ++  V +  +E  ++ ++ +LKV+++D +DN P F    Q + +SE   + T I++  A D D   +NQ + Y   + + TF L + +  P +  + + R L+ E  ++Y   L+ CD     C R+++ +Q++DENDN+PIF   +Y  ++ E+  +G+ +L + A D D+    +  Y      +  +   F + +++G I LK+ L+ N +  Y F V A DA++     D    A++ + +ED+N+  P I      + L    P P                   ++ I ENTPP  +  + V D D G N+ V CSL     D L              +  +   IY +RT R +DYEI  ++  +++C D G P AL S + I + +VDVNEF+P            EN P  K I++I A+D+D+GA+LRY          + D+ GR                   YF +   TG I  S +TLD+E    V   V ++DS + P  TAT  V++ ++D+NDNAP FV+            PFT+ E    +++LS ++EA+D D+ E N  + F LL TY                     +   E+ H+                 IF V+  G IET+V +DRE    Y L + AQD+G  P +++  + I V+D NDNSPVWV P  ++ +      N++     GS+  +L+A D D ++ G+++Y+ +      +GE    ++   G+L         G TL++     +G  P  N    + L     +PN+N +
Sbjct:   22 AEEVQVHLQMREETPPHTRIGSVSSSLPVTLGTK---LHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASVFITNKETGEFAATVNLKVDIQDQNDNRPAFTSPSQKVAISESAVVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTEL-PSV-RLQLTRPLDREKTELYTATLEACDPGA--CARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNATDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFVGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLSRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDYEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRRVYVGRVSENSPAGKEILTITATDRDRGAVLRYYFAPVNTEQSTWDDSGRSETATAMDDAGLSRMEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPIFVNPPSESTDRVRAKPFTVMENAPRFTRLSEKLEARDPDQGE-NGRVQFSLLDTYALTRSSRQGSTNIRTNEQYSDSRYKEISHQSDPIDDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGAQPLASTIMLRIDVLDANDNSPVWVFPTPMDRT-----INLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGP----RGEPLRGVSLGEGLLD--------GLTLVR-----NGEKPPTNEQQRSALQTGPGRPNENGY 884          
BLAST of Protocadherin 11 vs. TrEMBL
Match: A0A4S2LLF4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006337 PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 7.964e-84
Identity = 236/841 (28.06%), Postives = 402/841 (47.80%), Query Frame = 3
Query:  234 SQEITFHL--VEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVV--QEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS--NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKD---YADVEIEIEDVNDNYPII------SLLHGYMPDPY------------------AIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLE-------------MIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSP-ALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY----------SLDEIGRI------------------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINP-HTATMFVTVTILDQNDNAPQFVHTL----------PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY----------NNKM------ELLHEK----------------IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL 2402
            ++E+  HL   EE      +G+++  + + L T      F   + +F +   T  V +   ID + +C     CC    C ++  + +  +E  ++ ++ +LKV+++D +DN P+F    Q + +SE   + T I++  A D D   +NQ + Y   + + TF L + +  P +  + + R L+ E  ++Y   L+ CD     C R+++ +Q++DENDN+PIF   +Y  ++ E+  +G+ +L + A D D+    +  Y      + ++   F + +++G I LK+ L+ N +  Y F V A DA++     D    A++ + +ED+N+  P I      + L    P P                   ++ I ENTPP  +  + V D D G N+ V CSL     D L              +  +   IY +RT R +D+EI  ++  +++C D G P AL S + I + +VDVNEF+P            EN P  K I++  A+D+D+GA+LRY          + D+ GR                   YF +   TG I  S +TLD+E    V   V ++DS + P  TAT  V++ ++D+NDNAP FV+            PFT+ E    +++LS ++EA+D D+ E N  + F LL TY          N +       E+ H+                 IF V+  G IET+V +DRE    Y L + AQD+G+ P +++  + + V+D NDNSPVWV P  ++ +      N++     GS+  +L+A D D ++ G+++Y+ +      +GE    ++   G+L
Sbjct:   22 AEEVQVHLQMREETPPHTRIGSVSSSLPATLGTK---LHFLTDNTFFSVAPNTGEVGVARLIDRERLCPDFKICCGVLACQLDASIFITNKETGEFAATVNLKVDIQDQNDNRPIFTSPSQKVAISESALVGTHINLVPATDADIEPVNQIQRYSLIEPTGTFVLDLTEL-PSV-RLQLTRPLDREKTELYTATLEACDPGA--CARQTLEIQILDENDNKPIFKVTRYKKQLQENIKVGEVVLHLNASDLDAGDRGRVLYALHGTVDPDLSETFELVRDTGEIRLKRPLAANIRDNYRFKVIACDAVNPACAGDENSTAEITLLVEDINNFAPTIHTVAAGAALVSANPPPLDFAGQKPVQLSNEASFRESLSIFENTPPSQVAVLTVRDADVGENSRVTCSLNESSGDDLNRPFNGGSVSSNFILTLSAPGIYSLRTSRMYDFEIEPVVSTKVVCHDFGKPHALTSARVITVRVVDVNEFQPEFSRRVYVGRVSENSPAGKEILTTTATDRDRGAVLRYYFAPVNTEQSTWDDSGRSESATAVDDAGLSRIEASKYFVMEPETGVIRTSQITLDRETVVGVTLVVLVSDSTMPPTFTATTTVSIEVIDENDNAPVFVNPPSESADRVKVKPFTVMENAPRFTRLSEKLEARDPDQGE-NGRVQFSLLDTYALTRSSRQGSNGQYSDPRYKEISHQSDPIEDLGLSKRVVDQPIFRVTPDGVIETLVELDREIVPAYILKVGAQDRGSQPLASTIMLRVDVLDANDNSPVWVFPTPMDRT-----INLTTAMKPGSLAGRLRAEDADINEAGRVTYLFLGP----RGEPLRGVSLGEGLL 845          
BLAST of Protocadherin 11 vs. TrEMBL
Match: A0A074ZL43 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_05267 PE=4 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 5.500e-83
Identity = 232/862 (26.91%), Postives = 406/862 (47.10%), Query Frame = 3
Query:  243 ITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEK-CVIETKVVVQE-YSQYKSSFSLKV---EVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQ--SNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTF---------------KKDYADVEIEIEDVNDNYPIISLLHGYMP-DPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLE------MIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEII-------------MSNVTLDKEMNDSVKFKVFITDSL---------------------------INPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKG-NPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----------------LLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGM 2567
            + F + EE+     +GN    I++ L   P IT     SK+F++   T  VQ+   +DL+++C+ +  CC  E+ C +   VV++   S+      ++V   ++ D   +F    ++ Q++++SE   + +  S+  A+D+D SK NQ + Y      +     +   +P  + + ++RSL+YE    Y   L+ CD   ++C+R+++ +++ D NDN P FV+  Y V +PE++ +G+ +L++ A+D DS  + +  + F   ++ ++ + F +E+ +G + L+  L+ +++S Y F V  ++  S                    + A V I +ED+ND  P I +   + P +   + + EN+PP  +  + V+D D+G N  V C L        E      ++    ++Y + T RSFD E    +   I+C D GSP   S + + I I D+NEF P +       +  EN      ++ I A D D  A L Y L   G+ YF ++  TG I+             + + TLD+E  + V F V ++D                                HT +  V VT+LDQNDN P F+   PF++ E    ++++S R+ A D D  E N  + + L H++ +   +    +F V + G I+T+  +DRE  + YTL ++A D     P  TS N T+TV+D NDN P+W  P      + +   NI+ +   G ++A++ A DQD  + G++ Y ++     ++   F   N+T  I     +P +   T                  L++ A D GHP       L +NV   +  + +GLN  II+ M
Sbjct:   33 LRFVVNEESALRTTIGN----ISAYLLPHPTIT---TDSKFFDV-TTTGLVQLARRLDLESLCTENFLCCKLEQPCELSFSVVIESGTSREMQPLEIRVRILDINDNVPSFGPNSENGQVLEVSEMAKVGSLFSLTPAVDRDVSKENQVQRYTLHGVELLRMFELDDSEPPNVRLRLVRSLDYEKTTSYTGSLEACDP--RSCMRQNLTIRITDANDNPPRFVKNTYSVNVPENFTVGQVVLQLEAEDIDSPPYAQMDFRFHGTADQDLYNTFRLERNTGRVVLRTRLAAHRRSEYKFDVSVVEGSSTAIMDHGSSTSVSNPILGSSNLAHVTITVEDLNDFSPNIKM---FSPSEGQQLSVPENSPPTRVCVVQVTDSDSGDNGRVACRLVRSAASASETTLDSFVLSNAGKLYTLSTTRSFDAEREPQVAVTIVCTDFGSPQRSSGRDLVIKIEDINEFPPELDKTTYHAAVYENAEAGVEVVRISARDPDHSAKLHYELSAQGKQYFHVDPLTGSILTIGDTGTDFDSAGLLSSTLDREKTERVTFTVCVSDGPPTSVCGGDDSNSKPSMRAMKQGSNTESARTHTVSATVFVTVLDQNDNRPHFIEKGPFSVAENQPRFTQVSGRLVAIDQDDGE-NGRVRYSLRHSWKSANGVPAPDLFQVDADGRIQTMEVLDRETTNAYTLELMACDSAPQTPLCTSLNATVTVLDENDNKPIWRYP-----HDQDKEVNITADLPPGHVIARVHATDQDAAENGRVVYSLIDP---HRRTVFQVDNKTGDIAVAQSNPAAPSETNFQSNANKPSPLLPGIYRLRLRASDQGHPQQVAETWLQVNVFSTDTVVSAGLNFMIIVVM 872          
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 226.483 bits (576), Expect = 2.170e-60
Identity = 235/809 (29.05%), Postives = 386/809 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLII 2504
            F+LL     C +L P+I  +QE+ + + EE +  +++GN                   L Y + SK   +P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D    N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPES P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  +V A D  S + +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILDQNDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  + G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I++  +    +    ++  +G +++ + P      L  L ++  D G+P  K+  TL++
Sbjct:    6 FYLLATLVACLWLDPAI--AQELIYPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--YEDSECSFEIEVVILP-NDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSAR---ATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVSLSILNDNENF-------ILDPYT-GVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN----KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP--KSLHTLVL 768          

HSP 2 Score: 92.0485 bits (227), Expect = 2.296e-18
Identity = 140/590 (23.73%), Postives = 243/590 (41.19%), Query Frame = 3
Query:  825 YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD---SSLFNKTFYGFQSNYNVKSIFNIEKESGV-ISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            Y   ++  I+V+  D NDN P+F      + IPE+  I  +    +A D D   +S++       QS + +  +   E E    + ++Q+L   +K  Y+  +   D  S   K   A +++ + DVNDN P+      +      + I E++P  T +  +  +D D G NA +      +       + A      + T+ R  D E     +  +L  D  S +  +R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   ++   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  T+ E       L+T I A D D    N  I+++L           +   FD+  K  + T   + DRE    +  T+ A+D G     +   + +T++D NDNSP +        +    +F +S+     S V  +   D D  +   +S  I++       E F+ L+  +G++  +   +S+ R         + A D GHPP  + A + INV   NDN
Sbjct:  121 YFRLIKIKIVVK--DTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQ-KSSTAILQVTVTDVNDNRPV------FKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSS--ARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTT-ITATDEDSGR-NAEIVYQLGP---------NASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILN-----DNENFI-LDPYTGVIKSN---VSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDN 670          
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Match: pcdh9 (protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1])

HSP 1 Score: 226.098 bits (575), Expect = 2.392e-60
Identity = 235/809 (29.05%), Postives = 386/809 (47.71%), Query Frame = 3
Query:  195 FHLL-----CGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD--SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLII 2504
            F+LL     C +L P+I  +QE+ + + EE +  +++GN                   L Y + SK   +P +     + + F   N+         ID + +C   S   +  +C  E +VV+   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D    N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN P+F E +  V IPES P+G  ++++ A DAD  ++   K  +G Q +   + +F +   +G+I++++ L   + + +  +V A D  S + +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT +N  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     ++ +I A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  +   F V   D+      +   V VTILDQNDN+P+F H    F + E L  YS +   I   DAD  E N  +   +L+   N        I D  + G I++ V+ DRE+ S+YT  + A D G+PP S++  +TI VIDVNDN P+ + PPS  S      F +   +AI GS+VA++ A+D D     ++ Y I++  +    +    ++  +G +++ + P      L  L ++  D G+P  K+  TL++
Sbjct:    6 FYLLATLVACLWLDPAI--AQELIYPIREELQENVLIGNIPKDLNISHMNTATGASNNLVYRLVSKAGDNPLLRVMSNTGEIFTTSNR---------IDREKLCPGPS--YEDSECSFEIEVVILP-NDYFRLIKIKIVVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGP-NSVYKYELVNGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNRPVFKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSSAR---ATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTTITATDEDSGRNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKFTHNHFQFFVSENLPKYSTVGV-ITVTDADAGE-NAVVSLSILNDNENF-------ILDPYT-GVIKSNVSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDNPPIVIYPPSNTS------FKLVPLSAIPGSVVAEVFAVDGDTGMNAELKYTIVNGNN----KGLFRIDPVTGNITLEEKPTEADSGLHRLVVNISDLGYP--KSLHTLVL 768          

HSP 2 Score: 92.0485 bits (227), Expect = 2.161e-18
Identity = 140/590 (23.73%), Postives = 243/590 (41.19%), Query Frame = 3
Query:  825 YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD---SSLFNKTFYGFQSNYNVKSIFNIEKESGV-ISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI-RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF------EELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTI-DREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            Y   ++  I+V+  D NDN P+F      + IPE+  I  +    +A D D   +S++       QS + +  +   E E    + ++Q+L   +K  Y+  +   D  S   K   A +++ + DVNDN P+      +      + I E++P  T +  +  +D D G NA +      +       + A      + T+ R  D E     +  +L  D  S +  +R  + I + DVN+  P+I   +        +   E  P +  I  I  SDKD    G ++ +   ++   +         ++ ++  LD E      FK+  +DS       T  V V + D+NDN P F    +  T+ E       L+T I A D D    N  I+++L           +   FD+  K  + T   + DRE    +  T+ A+D G     +   + +T++D NDNSP +        +    +F +S+     S V  +   D D  +   +S  I++       E F+ L+  +G++  +   +S+ R         + A D GHPP  + A + INV   NDN
Sbjct:  121 YFRLIKIKIVVK--DTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPDMGPNSVYKYELVNGQSAFGLDIVETPEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQ-KSSTAILQVTVTDVNDNRPV------FKESQIEVHIPESSPVGTSVVQLQATDADVGANAEIKYMFGTQVSPATRRLFALNSTTGLITVQRPLDREETANHKLSVLASDGSSSS--ARATVTINVTDVNDNAPNIDLRYIISPTNGTVLLSEKDPVNTKIALITVSDKDTDVNGKVICFIEKDV-PFHLKAVYDNQYLLETSALLDYEGTKEYIFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELTVSENNKRDLYLTT-ITATDEDSGR-NAEIVYQLGP---------NASFFDLDRKTGVLTASRVFDREDQERFLFTVTARDNGTRALQSQAAVIVTILDQNDNSPKF--------THNHFQFFVSENLPKYSTVGVITVTDADAGENAVVSLSILN-----DNENFI-LDPYTGVIKSN---VSFDREQQSSYTFDVRAVDSGHPPCSSAAKVTINVIDVNDN 670          
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Match: pcdh1b (protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-2])

HSP 1 Score: 214.927 bits (546), Expect = 1.139e-56
Identity = 203/702 (28.92%), Postives = 329/702 (46.87%), Query Frame = 3
Query:  189 ILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSEC---CDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKAD----MEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF-KENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSS 2222
            +L    CG      S   IT+ L EE     ++G+L       L     + +  V   Y  +D +T ++    T D+     T  +C    + + C +E +V + +  +      ++  ++  D+N         I++L+  E   +    SI  AMDKD    N   +Y+    S    LF  Q     D  +  ++V+ +L+ E +  Y   +KV D         +++ + + D NDN P F    Y  ++ E+ P+G+ +L+V A D D     +  Y F Q + NV+ + +I+  +G+I +K S+   +     F+V A D      K   A V I ++D NDN P I +   G +     I  + E+ P  T  + + VSDKD G NAVV C +       L    A        Y ++T    DYE ++    EI+ +DSG+PAL S  ++K+ + D+N+  P    +  E+ F +EN P  K ++ + A+D D G  A L YS+  D   +  F IN  TGE+ + N  LD+E  +  +F V   D  +     T  V V +LD+NDN P+F ++   F++ E +   S +   +   DADK E  H  +          +E  + K    +  G I + ++ DREK+S YT  + A D G+PP+S+   ITI V+D NDN+P +V+ PS NSS
Sbjct:   22 VLLLYSCGS-----SLASITYQLREEQPPNTLVGSL--AADQGLPDTGHLYKLEVGGPYLRVDGKTGDIY---TTDVPIDRETLKDCRNLFEGDPCFLEFEVSITDLMKGSGPRLIEGRIEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGS-NGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLGNLDREQRDTYDLSIKVIDGGTPPRYSSALLRITITDTNDNVPKFERSHYEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDN-GPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDK-VLDVVATDADSGTNAELLYSIITDSATKGLFDINPNTGEVRVMN-QLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGM-VTVIDADKGENAHVQL---------SVEPENGKFVIQNGTGTILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAP-YVTKPS-NSS 697          

HSP 2 Score: 117.472 bits (293), Expect = 3.324e-26
Identity = 146/589 (24.79%), Postives = 248/589 (42.11%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNI-------EKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFK-------ENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGE--------IIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT-----LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +++ DENDN P F      + IPE+  +G       A D D+       Y   S  +  ++F++       EK   +I L  +L   ++  Y  ++  ID      +   A + I I D NDN P     H      Y   + ENTP  +++  +  +D D G N  V  S      ++  ++  D     I+   S D E + L++  +   D+G  A  S+  + I + D N+  PSIR   F  ++ +       E++P    +  ++ SDKD+G     +    G + F + S +           + +   LD E     + ++   DS     ++T  + V + D NDNAP F  +L      E      K+   + A DAD    N  +++ ++     K       +FD++ + GE+  +  +DRE    Y   + A DKG P    +  + + V+D NDN P ++    LN        N+   + +G +V  + A      D G+ ++V +S E   +  +F+  N T  ILS     +S+ R        ++ A D G PP  +Y  + INV   NDN
Sbjct:  131 IEIQDENDNTPQFPSPILELAIPENTYVGAHYSIPVAMDKDAGSNGIADYKLNSGSDAMNLFSLQVADNTDEKVPQLIVLG-NLDREQRDTYDLSIKVIDG-GTPPRYSSALLRITITDTNDNVPKFERSH------YEGEMAENTPVGQSVLQVKANDDDLGANGQVTYSFHQPSPNVQRLLHIDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNSLKVQVTDMNDNAPVFSPSLYEVDFAEENQPGDKV-LDVVATDADSG-TNAELLYSIITDSATK------GLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFM----LNGYSFSVLENMPPLSPVG-MVTVIDA------DKGENAHVQLSVEP--ENGKFVIQNGTGTILS----SISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDN 686          

HSP 3 Score: 102.834 bits (255), Expect = 1.127e-21
Identity = 120/544 (22.06%), Postives = 234/544 (43.01%), Query Frame = 3
Query:  591 KLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEP--------IFVEKKYLVKIPESYPIGKKI--LKVTAKDADSSLFNKTFYGFQSNYNVKSIF---NIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRI-DENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLD-EIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITV 2165
            +++E   +  S+    A D D    N +  Y F   S   Q  ++  D +   I V  S++ E   +    ++  D   Q    K+++ + V D NDN P        +   +  +  + E  P+G  +  ++V+ KD   +            + ++S     +  K    +     L   +   Y   + A+D+ +       + +++++ D+NDN P+ S      P  Y +   +EN P   +  +  +D D+G NA +  S+ +       +   +    ++R +   D E  +  E  +   D G P+L     + + ++D N+ +P    N    S  EN+P    +  +   D DKG  A ++ S++ E G+  F I + TG  I+S+++ D+E   +  F++   D    P ++ + +T+ +LD+NDNAP +V     +  + L   +   TR+E  DA+  +I+  +   L+++           +F +SS  GEI       R+ +  + L +   DKG P + T+  + I V
Sbjct:  263 EMAENTPVGQSVLQVKANDDDLGA-NGQVTYSFHQPSPNVQRLLH-IDHNTGIIQVKGSVDREEVPLLKFSVQARDNGPQAKSSKAMVTITVKDRNDNAPSIRIRGFGLVAHEDGIANVSEDMPVGTPVALVEVSDKDEGENAVVTCVVAGDVPFQLRSASASDSTSKRKYFLQTTTPLDYERIKEYRIEIVAVDSGNPALSSTNS-LKVQVTDMNDNAPVFS------PSLYEVDFAEENQPGDKVLDVVATDADSGTNAELLYSI-ITDSATKGLFDINPNTGEVRVMNQLDREYKERYEFHVEAADKGVPSLKGTATVVVRVLDRNDNDPKFMLNGYSFSVLENMPPLSPVGMVTVIDADKGENAHVQLSVEPENGK--FVIQNGTG-TILSSISFDREKESTYTFRLKAVDGGDPPRSSYVGITINVLDENDNAP-YVTKPSNSSYKFLQPLTSPDTRVEKVDAE--DIDTGLNAELVYSITGGNP---HGLFRISSTDGEITLAKEFTRKHNGLHRLVVKVSDKGKPSRHTTALVHIFV 787          
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 211.075 bits (536), Expect = 2.951e-55
Identity = 201/707 (28.43%), Postives = 327/707 (46.25%), Query Frame = 3
Query:  180 GKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVS-TIDLDTICSTDSECCDKEK-CVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD----ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVI-DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIK--ADMEI-----YQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF-KENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS------SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            G  +LF LL   + S +    I +H+ EE     ++G+L       L     + +  V + Y  +D +T  +      ID +T+     +C  K K C +E +V V +  Q +S   ++  ++  D N         ++ LS  E   +  + +I  A D+D  + N    Y          LF  Q   D    +  ++V+ +L+ ELK  Y   +   D    +    +++  VI D NDN P F +  Y  ++ E+ P+G  +L+V A D+D     +  Y   Q++  V  +  IE+ +G+IS+K  L   + S + F V A D    + K     V IE+ D NDN P + +   G       +  I E+ P  T  + + VSDKD G NAVV C   V   D+   ++   D  +     Y ++T    DYE ++    EI+ +DSG+PAL S  ++++ + D N+  P       E+ F +EN P  K ++ + A D D G  A L YS+  D   R  F I+  +GE+  +   LD+E  +  +F+V   D  +  H  T  V + +LD+NDN P+F + +  F++ E +   S +   +   D DK E             N +++L  E   DV         G I + ++ DREK+S+YT  + A D G PP+S+   +TI V+D NDN+PV   P
Sbjct:   42 GWFLLFALLVDSINSALGG--ILYHVREEQPPNTLIGSL--AADQGLPDSGHLYKLEVGAPYLRVDGKTGEIFTTEIPIDRETL----KDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDK-GPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC---VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEV-RARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM-VTVLDMDKGE-------------NAQVQLSVEP--DVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP 717          
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Match: pcdh1a (protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-32])

HSP 1 Score: 208.764 bits (530), Expect = 8.439e-55
Identity = 201/706 (28.47%), Postives = 327/706 (46.32%), Query Frame = 3
Query:  180 GKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEK-CVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD----ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVI-DENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-GYMPDPYAI-RIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIK--ADMEI-----YQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF-KENIPEHKFIMSIDASDKDKG--AILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS------SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            G  +LF LL   + S +    I +H+ EE     ++G+L       L     + +  V + Y  +D +T  +   + I +D    T  +C  K K C +E +V V +  Q +S   ++  ++  D N         ++ LS  E   +  + +I  A D+D  + N    Y          LF  Q   D    +  ++V+ +L+ ELK  Y   +   D    +    +++  VI D NDN P F +  Y  ++ E+ P+G  +L+V A D+D     +  Y   Q++  V  +  IE+ +G+IS+K  L   + S + F V A D    + K     V IE+ D NDN P + +   G       +  I E+ P  T  + + VSDKD G NAVV C   V   D+   ++   D  +     Y ++T    DYE ++    EI+ +DSG+PAL S  ++++ + D N+  P       E+ F +EN P  K ++ + A D D G  A L YS+  D   R  F I+  +GE+  +   LD+E  +  +F+V   D  +  H  T  V + +LD+NDN P+F + +  F++ E +   S +   +   D DK E             N +++L  E   DV         G I + ++ DREK+S+YT  + A D G PP+S+   +TI V+D NDN+PV   P
Sbjct:    6 GWFLLFALLVDSINSALGG--ILYHVREEQPPNTLIGSL--AADQGLPDSGHLYKLEVGAPYLRVDGKTGEI-FTTEIPIDR--ETLKDCRIKGKPCFLEFEVSVTDLIQNQSPRLIEGRIEVQDINDNTPQFPSPVLTLSVQENAHMGATFAIPQATDRDTER-NGVLKYDLSAGPEASALFSLQMANDRGEKLPQLIVLGNLDRELKDSYDLTINAVDGGTPSRYSSALLRVVITDANDNAPQFEKSSYEAEVSENSPVGYSVLQVKANDSDLGPNGEIEYTIHQASDPVPKMLQIERSTGIISVKGPLDREEISSFKFHVIARDK-GPSPKSSTTYVSIEVTDQNDNAPAVEIRGIGLRTHSDGVANISEDMPVGTAVALVQVSDKDEGENAVVTC---VVAGDVPFQLRPAGDSSVDNKKKYFLQTTTPLDYERIRDYRVEIVAVDSGNPALSSTNSLRVQVTDTNDNSPIFSPPLFEVEFAEENQPGEK-VLDVIALDADSGTNAELVYSIIADSSTRGLFEIDPSSGEV-RARSPLDREHKERYEFRVTAADKGVPSHRGTATVVIKVLDRNDNDPKFMLSSYSFSVLENMPPLSPVGM-VTVLDMDKGE-------------NAQVQLSVEP--DVGNFVVQNGTGTILSSISFDREKESSYTFRLKAVDGGEPPRSSYVGVTINVLDENDNAPVVTKP 681          
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010725.1 (pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 gene:ENSPMAG00000009713.1 transcript:ENSPMAT00000010725.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 164.466 bits (415), Expect = 1.324e-41
Identity = 133/486 (27.37%), Postives = 230/486 (47.33%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYL-VKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYN---VKSIFNIEKESGVISLKQSLSINKKSR--YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPI---ISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFE--------ELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI-----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-------LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV--SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            + + V+D NDN P+FV+     V+I E   +G  ++++ A D D+       Y F +       ++  +++  +G+++++ +  +++++   +   V A D   ++ +     V +E+ D NDN P+   I+L   Y+PD   ++I EN P  T +  I VSD D G +  V+  +R+      E+   +   + ++T R  DYE  Q     +L  D G+P L     + I +VD+N+  P   N           E+S +EN P    ++++ A+D D G    + ++L E+         F++N RTG++ ++   LD+E     +  V   D       A   V VT+LD+NDNAP FV           F ++E  S  + + T +   D D+ + N  +   L+       E   + I     +  G + T+V +DRE    Y L++ A D G P  S S  ++ITV D NDN+PV  SP
Sbjct:  258 LTIVVVDANDNAPVFVDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLS-RSASVTVTVELNDDNDNAPVFEVIALQGEYLPD-GGVKIVENLPSGTPVVLISVSDPDLGSSGTVD--VRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLAT-PLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGT-VSTSDLDEGD-NARVALNLVR------EAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSP 730          

HSP 2 Score: 86.2705 bits (212), Expect = 2.326e-17
Identity = 91/341 (26.69%), Postives = 148/341 (43.40%), Query Frame = 3
Query:  762 RSLNYELKQIYFCKLKVCDKTYQNCVRK-SIIVQVIDENDNEPIFVEKK--------YLVKIPESYPIGKKILKVTAKDADS---SLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSL-RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKEN---IPEHKFI-MSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMS 1721
            R L+YE  Q Y   +   D+      +  ++I+ V+D NDN P+F+           Y V + E+ P G  +L + A DADS        T        +V  +F++   +G ++L   L   K+ RY  +V A D  S   +K  A V + + D NDN P    +       Y   ++E T   T + ++  SD D G NA V  +L R    D +     D     +RT+   D E     E  +  +DSG PAL +   + I + D N+  P I +     ++K      P    + +S+ A+D D G   R   + IG   +  F +N+ +G + ++
Sbjct:  453 RLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQ-RKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGG-AGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAPVITSPNTNDTWKHVRTFSPAGMLVGVSVTANDIDAGDNGRPLYEIIGGNPKGIFLLNADSGALSLA 791          

HSP 3 Score: 84.7297 bits (208), Expect = 8.214e-17
Identity = 101/459 (22.00%), Postives = 193/459 (42.05%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRS---LNYELKQIYFCKLKVCDKTYQNCVRKS---IIVQVIDENDNEPIF----VEKKYL----VKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG-------VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPII---SLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLR--VRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSI------RNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLD---EIGRIYFTINSRT-GEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAP 1853
            ++++E   + TS+    A D D    N    Y F  +  +       +      ++ +R+   L+ E   ++  +L V  +      R +   + V++ D+NDN P+F    ++ +YL    VKI E+ P G  ++ ++  D D         G     +V+  F    E         ++   + L   +  +Y  +V A D  +    K   ++ I + D+NDN P+    + + G +   Y + + EN P  T + ++  +D D+G N  +  +L      + + E+   +M   Q+      D E     E  +   D GSP   +R  +++ ++D N+  P+        N   +   +E      ++ ++  SD D+G   R +L+   E G  +      T G ++ + V LD+E     +  V   DS     +A+  V++T+ D NDNAP
Sbjct:  280 VRITEHSKVGTSVVQLRAADPDAGP-NGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVH--RLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPD--------LGSSGTVDVRLEFPTGAELASPNKVQFLLKTTRLLDYEEAQQYNVSVLAADRGTPKLSK-LLNLIISVVDINDNTPVFMNPASIEGDVA-VYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLATPLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDNAPTFVGVSNSTNCMYQFFVEEETSVGTYVGTVSTSDLDEGDNARVALNLVREAGPDWIGGAGDTPGGVVRTLVVLDREDRVQYELSVRAVDSGRPALSASCRVSITVSDTNDNAP 725          

HSP 4 Score: 83.5741 bits (205), Expect = 1.597e-16
Identity = 115/493 (23.33%), Postives = 198/493 (40.16%), Query Frame = 3
Query: 1167 DVEIEIEDVNDNYPIISLLH------------GYMPDPYAIRIDENTPPKTLFSIHVSDKDT---GINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIR-SFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHK----FIMSIDASDKDKG--AILRYSLDE-----IGRIYFTINSRTGEIIMSNV-TLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTL--PFTIQEGLSFYSKLSTR-----IEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            DV++ + D+ND+ P     H              +P P AI  D  T     + I  +  D    G  ++V          +       M    +  +R   D E +   E  +   D G+P L     + I++VD N+  P      +  +    I EH      ++ + A+D D G    + YS          +    ++  TG + + N   LD+E     +  V   D      +A++ VTV + D NDNAP F V  L   +    G+     L +      I   D D    + ++  RL      ++   ++  F       ++T   +D E+   Y +++LA D+G P  S   N+ I+V+D+NDN+PV+++P S+         ++ +    G++V  L A D D    G I++ +          +  +LN  +G L++   PL   + +   L + A D G P  K  A + + V   NDN
Sbjct:  129 DVQLLVRDINDHAPAFRAPHLNVSISESEAVGRRVPLPRAIDPDAGTNSIQHYRISAASGDGLQLGPFSLVESDDDDDGGGVGVDGDGGMGHRALLELREQLDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVF---VDPPTRPVRITEHSKVGTSVVQLRAADPDAGPNGAIAYSFHTKLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGS-SGTVDVRLEFPTGAELASPNKVQF------LLKTTRLLDYEEAQQYNVSVLAADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEGDVAVYEVSLRENGPAGTVVLNLLATDADSGPNGAITFTLSELAGGESVAELFSLNMRTGQLTLAT-PLDREKRMRYELSVEACDGGSPQRKARAIVRVTVLDENDN 610          

HSP 5 Score: 58.151 bits (139), Expect = 1.097e-8
Identity = 77/288 (26.74%), Postives = 125/288 (43.40%), Query Frame = 3
Query: 1731 LDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH--TLPFTIQEGLSFYSKLSTR-IEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVT---IDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFG----KISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIG 2564
            LD+E   S +  ++  D      + ++ +T+ ++D NDNAP FV   T P  I E    +SK+ T  ++ + AD D   +  I    HT      L  +    V     + TV     +DRE    + L ++A+D G   +S S  +T+ + D NDN+PV+          P+    I +    G+ V  +   D D    G    ++ +   +  +     QFL   +T+ +L  ++    Y  ++L   A D G P L     LII+V   NDN    +N A I G
Sbjct:  230 LDREAVPSYELLLWGEDGGNPKLSGSVLLTIVVVDANDNAPVFVDPPTRPVRITE----HSKVGTSVVQLRAADPDAGPNGAIAYSFHT--KLTSLATQAALHVDGTTGLVTVRNAEKLDRETMPVHRLVVVARDGGQLSRSASVTVTVELNDDNDNAPVFEVIALQGEYLPDGGVKIVENLPSGTPVVLISVSDPDLGSSGTVDVRLEFPTGAELASPNKVQFLL--KTTRLLD-YEEAQQYNVSVL---AADRGTPKLSKLLNLIISVVDINDNTPVFMNPASIEG 505          
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006996.1 (pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 gene:ENSPMAG00000006222.1 transcript:ENSPMAT00000006996.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 155.606 bits (392), Expect = 2.482e-38
Identity = 163/554 (29.42%), Postives = 264/554 (47.65%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS---NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKK-DYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAV-------------VNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPA--LLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAI--LRYSLDE-IGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL--PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKG--NPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL 2423
            + IV+V DENDN PIF    Y + IPE+   G  +L V A D D S      YG  S   +    + F I   SG I+    L     S+Y+  V A+D      +K   A V I + DVNDN P    L      PYA+ I ENTP  T +F++  +D D   N               +N +    R   L++ + D+      ++RS            +   D GSP     +   + +++ DVN+ EPS       L   E +P +  +  + A+D D+GA   + YS+   + R  F +++ TG +I + V LD+E   + + ++  TD      ++T  +++ +LD NDNAP F H      ++ E ++  S + + +   DAD   +N  + F +  T  N+     +  F V  + G + TVV++DRE  ++Y+L I A D G     ++ +T + + V+DVNDN P+++   S   S PE   N+++    G+I+ Q++A D D+   G++ Y I+S     Q   FL +N +SG++S    PL
Sbjct:  226 TAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQS----PEYGQLSLIYSLEGSTQFRINARSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDL------PYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFYRINAASGKIRTTGLQLDREDLNPISFASMRSI----------VVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYALQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQLDAATG-LITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF-HPARSAVSLMESVARDSVVIS-LNCTDADSG-LNAELSFFI--TGGNQ-----DGQFSVGFRDGLVRTVVSLDRETKASYSLVIEAIDNGPAGSRRTGTTTLDVLVLDVNDNRPLFLE-GSYEVSVPE---NVTR----GAIILQVQATDIDEGINGRVWYRIISGN---QDGNFL-VNVSSGLISRGATPL 736          

HSP 2 Score: 139.428 bits (350), Expect = 1.919e-33
Identity = 151/563 (26.82%), Postives = 252/563 (44.76%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG--VISLKQSLSINK--KSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENT-PPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAE--------ILCIDSG--SPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFK------VFITDSLINPHTATMFVTVTIL--DQNDNAPQFVHTLPFTIQ--EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            + + E  ++ TS+    A D D     Q  +Y F D+S  F L     DP    I V  +L++E    +   +   D   Q    + + + ++D NDN P+F    Y+    E+      +++V A D DS   N+  Y         S F+I    G  V++L ++L   K        T+ A+D  S         + +E+ D NDN PI      +  + Y+I I EN     T+  ++ +D D         S    +  L+  ++   + ++I   RS D     L++ E        +  +D G  +        + I ++DVN+ +P+ R+    ++  EN P    I ++ A+D D  +   L Y++D     Y  IN+ +G+I  + + LD+E  + + F       V   D    P  AT   TVT+L  D NDN P FV  LP+ +Q  EGL   S L  ++ A D D+   N ++      TY+    L        ++ G I T+V +DRE  + Y L ++A D+G P  S++T +++ V+DVNDN+P +
Sbjct:   37 VSVWENATLGTSVVQVLATDLDAGVFGQV-SYHFSDDSDKFSL-----DPASGLISVAAALDFEATPRFTVTVMARDGGGQETAGR-VRINLLDVNDNTPVFQRDSYVGTARENDNSLTPVVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAI-VEVFDENDNSPI------FDRNSYSIAIPENILAGATVLYVNATDGDQ--------SPEYGQLSLIYSLEGSTQ-FRINA-RSGDITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAWRDLPYAVTIVENTPGGTDIFTVSAADPDLNENGTLVYAIDPPNPFY-RINAASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVG-LPYALQVLEGLPANSTL-FQVTATDPDEGA-NGNV------TYSMTAALPRPDFQLDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDNAPTF 565          

HSP 3 Score: 132.109 bits (331), Expect = 3.860e-31
Identity = 155/587 (26.41%), Postives = 262/587 (44.63%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN----TPPKTLFSIHVSDKDTGINAVVNCS-LRVRRKDLLEMIKADMEIYQIRTIRSFDYEIL--QLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK----GAI-LRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLI--NPHTATMFVTVTILDQNDNAPQFVHTLPF--TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETV-VTIDREK------DSNYTLTILAQDKGNPPKSTSTNITITVI--DVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMST--ESHYQGEQFLTLNETSGILS--IHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            + +I+ENDN PIF    Y V + E+  +G  +++V A D D+ +F +  Y F  + +    F+++  SG+IS+  +L      R+  TV A D      ++    V I + DVNDN P+      +  D Y     EN    TP   +  +  +D+D+  N  +  S L          I        +   R+ DYE +    I   I+ +D GSP L S     + + D N+  P    N   ++  ENI     ++ ++A+D D+    G + L YSL+  G   F IN+R+G+ I S   LD+E        V   D     +  T    V +T+LD NDN P +   LP+  TI E     + + T + A D D +E N ++++ +     N    ++      ++ G+I T  + +DRE        S  ++ +   D+G+PP+  + + T+TV+  DVNDN P +V  P            + +     S + Q+ A D D+   G ++Y + +      +Q      L+  +G+++  +     +     L++ A D G P L +  TL + V   NDN
Sbjct:   18 ITLINENDNRPIFSLPLYNVSVWENATLGTSVVQVLATDLDAGVFGQVSYHFSDDSDK---FSLDPASGLISVAAALDFEATPRFTVTVMARDGGG---QETAGRVRINLLDVNDNTPV------FQRDSYVGTARENDNSLTP---VVRVRATDEDSPPNNQITYSILPTSAYSSYFSITVSGGYGVVTLARALDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDNSPIFDRNSYSIAIPENILAGATVLYVNATDGDQSPEYGQLSLIYSLE--GSTQFRINARSGD-ITSTTLLDREAVSQYILIVRAVDGGDGNDQKTGIATVNITLLDVNDNDPAW-RDLPYAVTIVENTPGGTDIFT-VSAADPDLNE-NGTLVYAI--DPPNPFYRIN------AASGKIRTTGLQLDREDLNPISFASMRSIVVSGADRGSPPRRATASATVTVLLQDVNDNEPSFVGLPYA--------LQVLEGLPANSTLFQVTATDPDEGANGNVTYSMTAALPRPDFQ------LDAATGLITTLVQLDREAVAAYQLRLVATDRGTPALSSTTTLSLVVLDVNDN 561          

HSP 4 Score: 128.642 bits (322), Expect = 3.810e-30
Identity = 131/525 (24.95%), Postives = 234/525 (44.57%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIF-VEKKYLVKIPESYPIGK--KILKVTAKDADS--SLFNKTFYGFQSNYNVKSIFNIEKESGV--ISLKQSLSINKKSRY-LFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYS--LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLP-----FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTN-ITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQF 2372
            + V V DENDN P F      LV++ ES   G    +L  T +DA S  ++  +      +    + I  I+ ESGV  + + ++  + K S++ LF + A+D  S      + ++ + + DVNDN PI        P  YA+ + E   P TL  S+  +D D G N  V   +     D L +  +D  I ++    + D E        ++ +D G+P L     +++++ DVN+  P+     + +S  E++    F+ ++ A++  KG   +Y+  +  IG+  FT+++ +G +  + +    E           TD    P      + V +LD ND+ P FV  LP       I E +    ++   + A D D+ + N ++ +  LH              + +S G I T   +DRE  + Y+L +LA D+G P    ST  + + + D++DN PV++  P  +   P   F+I + +  G+ V  +            I Y  ++  +  +G +F
Sbjct: 1825 VYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTF-NLSVIVLDVNDNVPIF-----LSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSD-GIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYER---FNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFV--LPPNGTVVNITEVMPVVIRI-VEVLAVDGDEGQ-NGAVRYSFLHAGGVGSRDWESFRINATS-GIISTARALDRESQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFIVLP--DGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGANAIVYYFIAAGN--EGNKF 2330          

HSP 5 Score: 126.716 bits (317), Expect = 1.492e-29
Identity = 150/585 (25.64%), Postives = 253/585 (43.25%), Query Frame = 3
Query:  810 VCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPES-YPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSIN-KKSRYLFTVYAIDALSVTFKK--DYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSL---RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG----AILRYSLDEI--GRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTA---TMFVTVTILDQNDNAPQFVHT-----LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVV--TIDREK--DSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXX--FGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHP 2474
            +C          S+++++ DENDN P F    Y V + E     G  +  VTA D D     +  Y   S  N  + F I+  +GV++  ++L        YL  V A D      ++    A V + + DVND  P    L  Y      I + E  P   + +   SD+D+G+N  +  S+     R + ++     D+   ++R     D E        I+  D G+P L S   + + ++DV++ +P   N     S  E       +  + ASD ++G    A+L++S      G   F  +S+TG ++  N  LD+E     +  + + D+  NP  A   +  + VTILD+NDN+P F        +P     G +  + L+  I A DAD   +N ++ + LL    +    L ++      +G +   +   +DRE        LTIL QD G   ++ +  + +TV+DVNDN+      P+ N +   A   +    A+G+ V  +KA+D+D      G + Y I S      G     ++E++G++ +   P+ Y      LL + A D   P
Sbjct: 1145 ICLTATPAQATTSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVSG-NTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPW--FLRSYE---GPIDVSEGQPGPRIATFMASDQDSGLNGELEYSIIDGDPRNEFVISPADGDL---RVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSFCNGERAFYADSQTG-LVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVTYEAEIPENSPNG-TVLTVLNGPIYASDADFG-VNATLAYSLLG--GSSAYFLIDR-----DRGNVSMALGQGLDREGIPGGRLELTILVQDGGR--RNATVRLGVTVLDVNDNT------PTFNVTSQTAHV-LENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIAS-----GGNDTFGIDESTGLI-VTVAPIDYETRPEYLLMVVATDQAPP 1695          

HSP 6 Score: 118.627 bits (296), Expect = 5.292e-27
Identity = 159/670 (23.73%), Postives = 269/670 (40.15%), Query Frame = 3
Query:  639 AMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLK----VCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYP-IGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLL-------HGYMPDPYAIRIDE---NTPPKTLFSIHV------SDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSG---SPALLSRKA---IKIIIVDVNEFEPSIRNNFEEL-SFKENIPEHKFIMSIDASDKDKGA----ILRYSLDEIGRI----YFTINSRTGEIIMSNVTLD--KEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQE-GLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELL-HEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            A D DF  +N    Y     S  +  F+   D   +S+ + + L+ E   I   +L+    V D   +N   + + V V+D NDN P F        + E+ P +G  ++ V A D D  + +     +         F I++ +G+I     +    +  YL  V A D  +  F     ++ + +++  D     SL           +P    +R+       PPK    + +       DK            + +  D  E+I A     +I T  + D E        +L  D G   + A+L+ K    + + + D N+  P        L   +E+      +  + A+D+D G+      R       RI       I + +G  I+     D  ++ +  + F++   D    P + T  ++V +LD NDN P F+    + +    L     L   + A DAD    N  + FR+     +K+ +   + I  V+    I      DRE  + YTL ++A D+GNPP S S  + + V DVND  P +++P    S        + +  ++GS VA +KA +  +    K +Y I        G+   T++ TSG+++  +   SY R  L   A DHG PPL   A L + V   ND+
Sbjct: 1528 ASDADFG-VNATLAYSLLGGSSAY--FLIDRDRGNVSMALGQGLDRE--GIPGGRLELTILVQDGGRRNATVR-LGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGLIVTVAPIDYETRPEYLLMVVATDQ-APPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDK----------RHKQQESDNAELIAALQG--EITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGP-NGQVTFRIESGGGDKLSIGPSDGIIRVAPGANI------DRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVS--------VLESLSVGSFVATVKATENYKGHNTKYTYKIAGI-----GKNAFTVHATSGLVTSTRLLKSYERFNLTAVATDHGRPPLWGQAGLYVEVLDVNDH 2158          

HSP 7 Score: 99.3673 bits (246), Expect = 3.329e-21
Identity = 169/733 (23.06%), Postives = 300/733 (40.93%), Query Frame = 3
Query:  354 SSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSE-KISINTSISIDGAMDKDFS---------KINQKKNYQF-FDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQ-NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSS---------LFNKTF----YGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID-----ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSI-HVSDKDTGINAVVNC------SLRVRRKDLLEMIKADMEIYQIRTIRS-FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPS-IRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEI-IMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQG------EQFLTLNETSGILS 2405
            SS YF ID    NV M     LD       E     +  +E  ++VQ+  +  ++  L V V D++DN P F    Q   + E   ++ TS+ +  AMD+D            I    N  F  DES                I+ +  ++YE +  Y   +   D+    +     + V + +E D +  F    Y   + E+   G  +++V A    +          L  K      +  Q + N + I  ++ E   I+ + +L       Y+ TV + D     A++V   K  A V + + D NDN P        +     + + E+  P TL ++ H +D+D G N  V+         R+  + +L +I+ +  +  +   ++ F  +  Q I   I+ +D GSP   +   + +I++DVN+  P  +      +S  E       + S+ A+D D G    + + ++  G    +I    G I +     +D+E   +    V   D    P + +  V V + D ND  P F+  +   ++ E LS  S ++T ++A +  K    H+        Y  K+  + +  F V +   + T   + +  +  + LT +A D G PP      + + V+DVND+ PV+V PP+          NI++   +   + ++ A+D D+   G + Y  +    H  G      E F  +N TSGI+S
Sbjct: 1547 SSAYFLIDRDRGNVSMALGQGLD------REGIPGGR--LELTILVQDGGRRNATVRLGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTGL-------------IVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELDEKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGE---ITTQAALDREATDSYMLTVLSRDGGPREAIAVLTNKPGAYVYVNVTDENDNSPEFEAGSATL-----VEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYIL-IIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDKLSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGSAIVRVLVDDVNDERPAFLAPVQTVSVLESLSVGSFVAT-VKATENYK---GHNT------KYTYKIAGIGKNAFTVHATSGLVTSTRLLKSYE-RFNLTAVATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPN------GTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFL----HAGGVGSRDWESF-RINATSGIIS 2227          

HSP 8 Score: 99.3673 bits (246), Expect = 4.148e-21
Identity = 160/677 (23.63%), Postives = 280/677 (41.36%), Query Frame = 3
Query:  639 AMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII---VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD-----SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID-ALSVTFKKDYADVEI-EIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-----IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEIL--QLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPE-HKFIMSIDASDKDKG----AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTI---QEGLSFYSKLST---RIEA---KDADKDEINHSIIFRLLHT-YNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNIT--------ITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMS-TESHYQGEQFLTLNETSGILSIHQHPLSYGR-----TLLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
            A D+D S +N +  Y   D     +  +   D D+    V R +  + +   F  L +  K        S +   V+V+D +DN+P+F+       + E+  +   + +V A DA+     ++L   +   F    N +  F  + ++G++ + + L   + + Y  T+   D   + ++ +  +D+ I  I D NDN P+ S +       Y   I EN+P  T+ +     I+ SD D G+NA +  SL +       +I  D     +   +  D E +    +E  IL  D G      R  + + ++DVN+  P+     +     EN P     ++ + A D+D G      +RYS+   G   F I+  TG +I++   +D E        V  TD     HTA+  + V++ ++ D        L F++   Q  LS  +   T   R+ A   K   K  +  +I+ +  H    +K +         + +GEI T   +DRE   +Y LT+L++D G  P+     +T        + V D NDNSP +        +       + + AA G+++  L A D+D    G +S    + T +    +  L +   SG+  +      +        L +I A D G PP      L + V   NDN+
Sbjct: 1306 ASDQD-SGLNGELEYSIIDGDPRNEFVISPADGDL---RVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLPANASLSEAAAVLAIVSRVRASDANEGRNCAALLQHSPTSF---CNGERAFYADSQTGLVYVNRPLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDNSPVFSQVT------YEAEIPENSPNGTVLTVLNGPIYASDADFGVNATLAYSL-LGGSSAYFLIDRDRGNVSMALGQGLDREGIPGGRLELTILVQDGGRRNATVR--LGVTVLDVNDNTPTFNVTSQTAHVLENSPAVGTSVIVVKAMDRDLGVCDAGTVRYSIASGGNDTFGIDESTG-LIVTVAPIDYETRPEYLLMVVATDQAPPFHTASCELRVSLQNELD------EKLSFSLAAYQAALSEAAVPGTVVVRVAAPQMKAPPKLPLPLAILVQKWHEDKRHKQQESDNAELIAALQGEITTQAALDREATDSYMLTVLSRDGG--PREAIAVLTNKPGAYVYVNVTDENDNSPEF-------EAGSATLVEVRESAAPGTLLTVLHATDRDAGSNGTVSARAHTHTGTRIPPQYILIIQNESGVTIVDVAKADFVEKTSQFILFRIVALDGGSPPRSTTFNLSVIVLDVNDNV 1950          

HSP 9 Score: 73.9442 bits (180), Expect = 1.960e-13
Identity = 121/533 (22.70%), Postives = 223/533 (41.84%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVE-KKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSR--YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEP--SIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI------YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINP--HTATMFVTVTILDQNDNAPQFVHTLP--------FTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTN-------------ITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMS 2342
            V V+D NDN PIF+    Y V + E    G  +  V A DAD+    +  +  +S    K   +I    G+I +    +I++++R  Y   V A+D  +       A V + ++DVND  P       ++     + + E+    +  + +  ++   G N      +    K+   +      +   R ++S  YE   L     +  D G P L  +  + + ++DVN+  P   +  N   ++  E +P    I+ + A D D+G    +RYS    G +       F IN+ +G II +   LD+E + +V   + +      P  + +T  + V + D +DN P F+  LP        F+I E     + +     A DAD     ++I++  +   N   +      F++S  G +  +  +DRE    Y + + A    N   + +T              + + + D+ND  PV+        +  E    ++ +A +GS + QL+A+D+D  +   + Y I+S
Sbjct: 1941 VIVLDVNDNVPIFLSPGGYAVSVVELGAPGTLVASVWATDADAGPNGQVTFRIESGGGDK--LSIGPSDGIIRVAPGANIDRETRAAYTLMVVAVDRGNPPLSGS-AIVRVLVDDVNDERP------AFLAPVQTVSVLESLSVGSFVATVKATENYKGHNTKYTYKIAGIGKNAFTVHATSGLVTSTRLLKS--YERFNLTA---VATDHGRPPLWGQAGLYVEVLDVNDHRPVFVLPPNGTVVNITEVMPVVIRIVEVLAVDGDEGQNGAVRYSFLHAGGVGSRDWESFRINATSG-IISTARALDRE-SQAVYSLILLASDQGQPVSYESTQPLQVVLDDIDDNEPVFI-VLPDGGAPYQSFSIPEHSPPGTAVGNVSGAVDADVGA--NAIVYYFIAAGNEGNK------FNLSRWGLLVVLSDLDREVSPYYAIIVKASSNPNWTPAVTTGPEFDPSKDRTLREVRVYLEDINDQWPVF--------TNHEYTAGVAVDAKVGSELLQLEAVDRDVGNNSIVLYRILS 2440          

HSP 10 Score: 66.6254 bits (161), Expect = 3.762e-11
Identity = 96/380 (25.26%), Postives = 175/380 (46.05%), Query Frame = 3
Query: 1461 LCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKF-IMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNV-TLDKEMNDSVKFKVFI-TDSLINPH---TATMFVTVTILDQNDNAPQFVHTL--PFTIQEGLSFYSKLSTRIE---AKDADKD---EINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIM--STESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPP---LKNYATLIINVQQPNDN 2528
            +C+ + +PA  +  ++ I I D N+  P+      E+   E        + ++ ASD D+G  A + Y++   G    T     G  +++ V  LD E++  +   V   TD   +P    T+T  V+V + D ND  P F+ +   P  + EG     +   RI    A D D     E+ +SII       + + E +   I        +   V +DRE  + Y LTI+A+D G PP +++  + + V+DV+DN PV+++ P        A  ++S+ AA+ +IV++++A      + G+    ++  S  S   GE+    +  +G++ +++ PL   R     L ++  D+   P    K+   +I+ +   NDN
Sbjct: 1145 ICL-TATPAQAT-TSVLIRITDENDNAPAFGAATYEVLLTEGPSTAGVAVANVTASDPDEGDNARVVYAIVS-GNTAATFGIDNGTGVLTAVKALDFEVSAGLYLLVVTATDQPRDPARRLTSTATVSVHVADVNDVTPWFLRSYEGPIDVSEG-----QPGPRIATFMASDQDSGLNGELEYSII-----DGDPRNEFV---ISPADGDLRVRRYVELDRETQAFYNLTIMAKDMGTPPLNSTLTVGVRVLDVHDNDPVFLNLP--------ANASLSEAAAVLAIVSRVRA---SDANEGRNCAALLQHSPTSFCNGERAFYADSQTGLVYVNR-PLDRERVAEYRLTLTVRDNPDNPSYARKDSDIMIVTILDENDN 1496          

HSP 11 Score: 58.151 bits (139), Expect = 1.289e-8
Identity = 66/252 (26.19%), Postives = 121/252 (48.02%), Query Frame = 3
Query: 1797 HTATMFVTVTILDQNDNAPQFVHTLPF---TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY-----GRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            H  +  V +T++++NDN P F  +LP    ++ E  +  + +  ++ A D D       +  ++ + +++      +K     + G I     +D E    +T+T++A+D G   + T+  + I ++DVNDN+PV+      +S    AR N +        V +++A D+D     +I+Y I+ T S Y     +T++   G++++ +  L Y     G   L I A D G PPL +  T I+ V   NDN
Sbjct:   10 HWGSARVHITLINENDNRPIF--SLPLYNVSVWENATLGTSV-VQVLATDLDA-----GVFGQVSYHFSDD----SDKFSLDPASGLISVAAALDFEATPRFTVTVMARDGGG--QETAGRVRINLLDVNDNTPVF----QRDSYVGTARENDNSLTP----VVRVRATDEDSPPNNQITYSILPT-SAYSSYFSITVSGGYGVVTLARA-LDYEKIPGGTISLTIMALDGGSPPLNSTVTAIVEVFDENDN 237          
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008517.1 (pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 gene:ENSPMAG00000007697.1 transcript:ENSPMAT00000008517.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 145.591 bits (366), Expect = 2.743e-35
Identity = 128/501 (25.55%), Postives = 222/501 (44.31%), Query Frame = 3
Query:  744 LSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYA--IRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRV------RRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIV-DVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            L +     L+ E    Y   ++  D  + +   R  + V V D NDN P F +  Y   + E  P+G  +           L ++        ++ K+        G++S +Q L    + +Y  ++ A D  +       A   I++ DVNDN P I  +  Y+P P A    +DE+  P T+ + + V+D D+      N  L V       R   +        +  ++     D E + +    IL  D+G P   S  A  ++ V DVN+  P    +    +  E  P   ++  + A D D G  A LRYS+   +++G  +F+++  TG ++ ++  +D+E+  SV   +   D    P TA   +TVT+LD ND  P F  T         S        + A D+D  E N ++ +     ++  M   + ++F + S  G++ T+ ++DRE+   Y L + AQD+G+PP  ++  +T+ V D+NDN PV+
Sbjct:   86 LHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAFEKPAYRASVAEDSPVGAAL---------RDLLHRGRGPLAVPFDPKT--------GMVSTRQPLDFEARRQYTLSLRAADGGNPPLSG-RATAVIQLLDVNDNDPAIRFV--YLP-PAARSASVDESAAPGTVAALVTVTDADS---PTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDLG--WFSVDESTG-LVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGE-NGTVRY----NFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVF 554          

HSP 2 Score: 134.035 bits (336), Expect = 9.770e-32
Identity = 134/492 (27.24%), Postives = 214/492 (43.50%), Query Frame = 3
Query:  795 FCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEIL--QLIEAE----ILCIDSGSP-ALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEI---GRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRI-------EAKDAD---KDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWV 2198
            F +L+V   +       S+ V V D N++ P+F    Y V I E  P+  +   V A D DS    +  Y      N    F I  + G + ++  L    +  Y  TV A+D   V        V + + DVNDN P+      +    Y     E     +L  ++  +D D G N  V  S    + +     + D E  +I ++R FD E L  Q   A     ++  D G P  L  R  +++ + DVN+  P    +  + S  E+      ++ + ASD D+G    LRY+++E    G+  FT+++ TG+I +   +LD+E   S    V  TDS  +P  A+  V V +LD+NDN P+F  +L       LS  +  STR+        A D D     ++ ++I+    H             F +  S G +     +D E    Y L + A+D G PP+S++T + + V D NDN P ++
Sbjct:  726 FYQLRVVANSGGVAGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEG-NGGEKFGIFPD-GQLYVRYELDRETREEYSLTVSAMDT-GVEPLSSSVTVNVTVLDVNDNKPL------FNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNF----ELDSETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQLLRVTASDVDEGVNGALRYAINEGNEGGK--FTVDASTGQITLLG-SLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRFTESL-------LSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTHA-----------TFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFL 1183          

HSP 3 Score: 127.872 bits (320), Expect = 7.235e-30
Identity = 143/581 (24.61%), Postives = 248/581 (42.69%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP------KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQI----RTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH---TATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLL--HTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPND 2525
            + V D NDN P+F   +  +++ E+   G+ I  ++A DAD        Y   S    +  F ++  SGV+   + L   +++ YL TV A D    T  +    + + + D NDN P  S  H Y  D     + E+  P        + ++   D D+G    V  +L        +       ++ +       R  D E            D G  A  +R  + + ++D N+  PS++N+       E+ P    ++ I A+D D+G  A L +S+   D  GR  F + +  G++ ++   LD+E        V ++D   +P    ++ + V++ + D NDNAP F         E     + ++T ++A D D    N  + + L                 F +++  GE+  V  +DRE   +Y LT+LA DKG PP +++  + +TV D NDN+P +           E    I+++   G+ V +L A D D+   G++ Y I S +          L+   G L++ + PL   RT    L + A D G P   + A++ + +   ND
Sbjct: 1504 ISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGS--EGAFVVDAASGVLRASRRLDREERASYLLTVRASDGTHATDAR----LSVAVRDANDNSPRFSR-HAYSFD-----VAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDS--DWADGAFGLHPVTGALNVTRPLDRESRACYVLRARATDGGGLAATAR--LYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSGDPEGR--FAVGN-DGQLSVARA-LDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPEDSPVGAVVAT-VQAVDPDSGR-NSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRF--------PRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD----FRLDPVLGTLAVAR-PLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVND 2049          

HSP 4 Score: 125.176 bits (313), Expect = 4.966e-29
Identity = 161/656 (24.54%), Postives = 275/656 (41.92%), Query Frame = 3
Query:  639 AMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQ-NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNV--KSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVS-DKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIR-------SFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSI-RNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY---SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKL-STRIEAKDADKD-EINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI----HQHPLSYGRTL---LKISAHDHGHP-PLKNYATLIINVQQPNDN 2528
            AMD D S +N K  Y     +    L  +  D     +     ++ E+       +   D+  Q      S+ V ++D ND  P+F + KY+    E+   G  ++ V+A D+D        Y F  +     + +F ++  +G ++  +SL   +   Y   V A D  S       A V + + D+NDN+P+      + P  Y   I EN P  T  +   + D D G N  V            ++   D   +Q+  +        S D E   + + ++  +D G     S   + I + D  +  P+  R+++  + F EN+     + S+ AS  D  A + Y   S D+ G   F+I    G I  +N  +D+E     + +V      +        V+V + D N++AP F   +   +I E     S+  S R   KD+ K+ E+ + I            E    + F +   G++     +DRE    Y+LT+ A D G  P S+S  + +TV+DVNDN P++      NSS     F+  +E  +GS+V  ++A D D    G ++Y     + +++ +     +ET  I S+     +  +  G        + A D G P PL++ AT+ + VQ  NDN
Sbjct:  365 AMDAD-SGLNAKLRYSIVSGN---DLGWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQGAQPKTAYTSLTVTLLDVNDEPPLFTQTKYVATAVENSLPGLFVVSVSAADSDLGENGTVRYNFDPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGS-TAKVTVVVGDLNDNHPV------FYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVR----------YQLTAGDAARFQVNAVTGAVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVF-ENVAPGTLVGSVSASTLDLNANVTYLIVSGDQRGS--FSIEWSGGRIFTANA-IDREEQAFYQLRVVANSGGV---AGEASVSVLVHDVNNHAPVFDRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEI-----------GEGNGGEKFGIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLF------NSS--SYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSFEKPQVNFELD-----SETGRIASLRVFDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDN 968          

HSP 5 Score: 124.79 bits (312), Expect = 5.406e-29
Identity = 148/602 (24.58%), Postives = 255/602 (42.36%), Query Frame = 3
Query:  765 SLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIR-SFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEM------NDSVKFKVFITDS-LINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL-LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            SL+ E + +Y  ++   D  +      +I+ + V D  D  P F    Y   + E+   G  +  V+A   D    N        + + +  F+IE   G I    ++   +++ Y   V A ++  V  +   A V + + DVN++ P+           Y + I E+ P  +  FS+  +DKD+G N  V   +          I  D ++Y    +R   D E  +     +  +D+G   L S   + + ++DVN+ +P   ++     F E       + ++ A+D D G    + YS  E  ++ F ++S TG I    V  D+E         S  F V  TD     P      V V + D NDN PQF  ++   ++ E  S  ++L  R+ A D D+  +N +    L +  N   E    K    +S G+I  + ++DRE+ ++YTL + A D G  P + S  + + V+D NDN P +        +E     +  +   +G ++  L A D+D    G + Y I++  +H     F     T  +    +      R   L +SA D G PP  +   L+++V+  NDN
Sbjct:  615 SLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVAPGTLVGSVSASTLD---LNANVTYLIVSGDQRGSFSIEWSGGRIFTANAIDREEQAFYQLRVVA-NSGGVAGE---ASVSVLVHDVNNHAPVFDRAS------YEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNGGEKFGIFPDGQLY----VRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDNKPLFNSSSYVFHFCEEQEVGSLVGAVQATDADAGSNGGVTYSF-EKPQVNFELDSETGRIASLRV-FDREALIRQGGAASFSFSVVATDGGRPKPLQDRATVQVFVQDVNDNPPQFAKSVYQASVSESASNLTQL-LRVTASDVDEG-VNGA----LRYAINEGNE--GGKFTVDASTGQITLLGSLDREETASYTLVVSATDSGTSPLAASCTVAVQVLDENDNPPRF--------TESLLSVDALESTRVGELLITLTASDEDTGPSGDVRYAIVAGNTH---ATFAIDRSTGSVFLARRLDFETQRLYRLNVSAEDGGRPPRSSATILVVHVRDFNDN 1178          

HSP 6 Score: 118.242 bits (295), Expect = 6.246e-27
Identity = 150/614 (24.43%), Postives = 260/614 (42.35%), Query Frame = 3
Query:  735 PDILSIMVMRSLNYELKQIYFCKLKVCD--KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDL----LEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY-------GRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            P +  + V   L+ E   +Y   +   D  K        S++V V D ND+ P F    Y   + E  P G  +  VTA DADS L  K  Y   S  ++   F++++ +G+++    +     S  +  + A D      K  Y  + + + DVND  P+ +    Y+    A  ++ + P   + S+  +D D G N  V  +      D+     EM + D    ++ T++S D E L+     +   D GSP L S   + +++ D+N+  P         S  EN P    + ++ A+D D+GA   +RY L       F +N+ TG  + + V+LD+E     + +V   D       +   VT+T+ D  D  P F      F + E ++      T + +  A   ++N ++ + L+ + + +     E      S G I T   IDRE+ + Y L ++A   G    +   ++++ V DVN+++PV+               +I+++  + S    ++A D+D    G++ Y I        GE+F       GI    Q  + Y           L +SA D G  PL +  T+ + V   NDN
Sbjct:  287 PGLRVLKVASQLDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRFALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL-GWFSVDESTGLVTTDGKVDREVASSVVLNISAQDQ-GAQPKTAYTSLTVTLLDVNDEPPLFTQTK-YV----ATAVENSLPGLFVVSVSAADSDLGENGTVRYNF---DPDMPAQYREMFRLDSLTGKVTTLKSLDREELEEYPLVVQAQDRGSPPLGSTAKVTVVVGDLNDNHPVFYPVQYFASILENEPGGTAVTTVTATDPDRGANGTVRYQLTAGDAARFQVNAVTG-AVSTRVSLDREERAVYQLQVTALDGGHLRARSPAIVTITVADAQDTPPTFARDDYSFVVFENVA----PGTLVGSVSASTLDLNANVTY-LIVSGDQRGSFSIEW-----SGGRIFTANAIDREEQAFYQLRVVANSGG---VAGEASVSVLVHDVNNHAPVF--------DRASYEVSIAEDEPVNSRFFSVRATDKDSGKNGEVKYEIGEGNG---GEKF-------GIFPDGQLYVRYELDRETREEYSLTVSAMDTGVEPLSSSVTVNVTVLDVNDN 858          

HSP 7 Score: 107.457 bits (267), Expect = 1.019e-23
Identity = 114/478 (23.85%), Postives = 197/478 (41.21%), Query Frame = 3
Query:  735 PDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEI--EDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIY-------QIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRY---SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTI--QEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQD 2117
            P   ++ V R L+ E +  Y  + +  D        + + V V+D NDN P         ++PE  P G  +L+++A D D  +  +  +   S  + +  F +  + G +S+ ++L   ++S Y   V   D       +  + V + +   DVNDN P  +        P +    E++P   + + +   D D+G N+ V  +L    ++      A    +       ++R +R  D E  Q     +L +D G P L S   + + + D N+  P       E +  E+ P    ++ + A D D+GA   LRY   S D  G   F ++   G + ++   LD+E   S +  V   D      + T  V VT+ D ND +P F    P+T+  +E       L  ++ A+D   D++  S       TY           F VS  G +  + ++DRE    + L I A D
Sbjct: 1678 PVTGALNVTRPLDRESRACYVLRARATDGGGLAATAR-LYVNVLDANDNAPSVQNDSLAAEVPEDAPPGTSLLRISATDDDEGVNAELEFSISSG-DPEGRFAVGND-GQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFT-------SPRSALAPEDSPVGAVVATVQAVDPDSGRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAVDKGRPPLTSTATLAVTVGDANDNAPRFPRREYEAAIAEDEPPGTEVLRLSAWDPDEGANGELRYDIASGDPTGD--FRLDPVLGTLAVAR-PLDRERTASYELAVRARDGGGPARSDTASVRVTLSDVNDCSPAF-QLSPYTVHARENTQGPPVLILQVVARD---DDLGSSGQV----TYAAAGG-NDGGAFSVSPDGHVHLLRSLDREAQPQHVLIITATD 2133          

HSP 8 Score: 103.219 bits (256), Expect = 2.113e-22
Identity = 131/489 (26.79%), Postives = 211/489 (43.15%), Query Frame = 3
Query: 1170 VEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENI-PEHK----FIMSIDASDKDKGAI--LRYSL-----DEIGRIYFTINSRTGEIIMSNVT--LDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQ-----FVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKG-NPPKSTSTNITITVI--DVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYV--IMSTESHYQGEQF------LTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            VEI +EDVNDN P+ ++          + ++ENT   + +F++  +D D G NA+V  S+    +    +   D     +R  R  D E        +   D G+ A  +R  + + + D N+  P    +       E+  P+ K     I ++ A D D G    + Y+L      +     F ++  TG +   NVT  LD+E       +   TD      TA ++V V  LD NDNAP          +P     G S       RI A D D + +N  + F +            E  F V + G++     +DRE+ S Y L +   D+  +PP   S+ + +++I  DVNDN+P + SP S  + E         ++ +G++VA ++A+D D    G+ SYV   ++T+    G           LN  +G + +      +   SY  T+L +   D G PPL + ATL + V   NDN
Sbjct: 1502 VEISVEDVNDNPPVFAVPE------MELEVEENTGEGEVIFTLSATDADQGQNALVTYSVLSGSEGAFVV---DAASGVLRASRRLDREERASYLLTVRASD-GTHATDAR--LSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAGDADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGAL---NVTRPLDRESRACYVLRARATDGGGLAATARLYVNV--LDANDNAPSVQNDSLAAEVPEDAPPGTSLL-----RISATD-DDEGVNAELEFSISSGD-------PEGRFAVGNDGQLSVARALDRERQSFYNLVVRVSDRARHPPARLSSAVRVSLILTDVNDNAPAFTSPRSALAPE---------DSPVGAVVATVQAVDPDS---GRNSYVEYALATDGEEGGGGAGAGPGPFALNTVTGEVRLVRELDREARQSYALTVLAV---DKGRPPLTSTATLAVTVGDANDN 1945          

HSP 9 Score: 103.219 bits (256), Expect = 2.131e-22
Identity = 154/633 (24.33%), Postives = 266/633 (42.02%), Query Frame = 3
Query:  747 SIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKS---IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLF--TVYAID-ALSV-TFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRID--ENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQ---LIEAEILCIDSGSPALLSRKAIKIIIVDVNEFE---PSIRNNFEE----------------LSFKENI---PEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPP-SLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPL---SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            S+ + R L++E +++Y  +L V  +      R S   ++V V D NDN P F+       I E+ PIG +++ VTA+D D+ +  +  Y     +   + F I+ ESG I     +   + +  LF  TV A D A+ V T +    +V + + D NDN P           P AI +D         + ++  SD D   NA V  +  V   D   + + D     I T    D E       +E   +   + +P   +++A   II +   F    P    ++E                 L  + ++   PE + +         +G  +   LD   R+ F + +R   I+ S++      N +  F       +  P ++   V +++ D NDN P F V  +   ++E       + T + A DAD+ + N  + + +L             + D +S G +     +DRE+ ++Y LT+ A D  +   +T   +++ V D NDNSP +     S + +E  A    +  A IG+++A     D D   FG+++Y +  +E     +    L+  +G L++ + PL   S    +L+  A D G   L   A L +NV   NDN
Sbjct: 1133 SVFLARRLDFETQRLY--RLNVSAEDGGRPPRSSATILVVHVRDFNDNPPAFLPGDVFASIMENIPIGTRVITVTARDPDADVNGELHYSIARQFPPGAHFTIDPESGEICTAAEID-REVTGGLFEVTVRATDKAIPVHTRRSALKNVTVLVTDENDNAPRFVT-------PTAILVDGLRAAAGSVVGTLQASDPDEAENAAVRYA--VTGGDAAILFRLDRRTGIIETSTELDRESGHGAFTLEVVAVEAKAAAP--RTQRAENTIIANSMTFNHPLPRFPQDYESPINLLQGQTIPMPSSYLFLRHHLDWEPEGQLVFFTLLLGVTRGHGVINPLDAPWRVSFDLTARCMFIVFSSLLSSLRDNGAGSF-------IRPPMSSFNQVEISVEDVNDNPPVFAVPEMELEVEENTGEGEVIFT-LSATDADQGQ-NALVTYSVLSGSEGAF------VVDAAS-GVLRASRRLDREERASYLLTVRASDGTH---ATDARLSVAVRDANDNSPRFSRHAYSFDVAEDAAPDGKTTRAVIGTVLAG----DADSGPFGEVTYALAPSEDSDWADGAFGLHPVTGALNVTR-PLDRESRACYVLRARATDGGG--LAATARLYVNVLDANDN 1725          

HSP 10 Score: 76.6406 bits (187), Expect = 3.198e-14
Identity = 108/479 (22.55%), Postives = 193/479 (40.29%), Query Frame = 3
Query: 1167 DVEIEIEDVNDNYPIISLLHGYMPDP----YAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQ-----IRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEI-GRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAP--QFVHTLPFTIQEGL---SFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHE------KIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNP-PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILS----IHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPND 2525
            +V + + DVNDN P         P+P     A + D     + L    V D+D G N V + + ++   +    +     + +     + T    D E        +   D GSP    R  + + + D N+  P+    FE+ +++ ++          A D   GA LR  L    G +    + +TG ++ +   LD E        +   D    P +      + +LD NDN P  +FV+  P      +   +    ++  +   DAD    N  +   ++        +LH       ++  V+S+        +DRE+   Y LTILA D G P  +S + ++ + V DVND++P +        +       +S+ A  GS V  + A+D D     K+ Y I+S         + +++E++G+++    + +   S    +L ISA D G  P   Y +L + +   ND
Sbjct:    8 EVRVVVGDVNDNAP-------SFPEPGVMEVAFKEDAAVGRQVLLDTAV-DRDVGPNGVNHHAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPA----FEKPAYRASV----------AEDSPVGAALRDLLHRGRGPLAVPFDPKTG-MVSTRQPLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDNDPAIRFVYLPPAARSASVDESAAPGTVAALVTVTDADSPTANGELSVSIVGGNERGHFVLHAPGVPGLRVLKVASQ--------LDRERIPMYNLTILASDNGKPVARSATASLVVYVNDVNDHAPRF--------ALSAYAAALSEGAPAGSYVKDVTAMDADSGLNAKLRYSIVSGNDL----GWFSVDESTGLVTTDGKVDREVAS--SVVLNISAQDQGAQPKTAYTSLTVTLLDVND 441          

HSP 11 Score: 67.3958 bits (163), Expect = 2.066e-11
Identity = 60/250 (24.00%), Postives = 105/250 (42.00%), Query Frame = 3
Query: 1815 VTVTILDQNDNAPQF----VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTY-----NNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            V V + D NDNAP F    V  + F     +     L T ++ +D   + +NH       H Y     N +  L+  +     +   + T   +DRE + +Y L + A+D G+P +     + +TV D NDN P +         +P  R ++++++ +G+ +  L                        +G   +  +  +G++S  Q PL +    +  L + A D G+PPL   AT +I +   NDN
Sbjct:    9 VRVVVGDVNDNAPSFPEPGVMEVAFKEDAAVGRQVLLDTAVD-RDVGPNGVNH-------HAYKIVSGNEEGRLVPPRPVTKRAFLHLATTGPLDREANPSYALAVQAEDGGSPRRYGRLQVNVTVQDANDNPPAF--------EKPAYRASVAEDSPVGAALRDLL--------------------HRGRGPLAVPFDPKTGMVSTRQ-PLDFEARRQYTLSLRAADGGNPPLSGRATAVIQLLDVNDN 221          
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Match: pcdh11 (protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-21])

HSP 1 Score: 142.895 bits (359), Expect = 7.694e-35
Identity = 153/622 (24.60%), Postives = 271/622 (43.57%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDES----MTFQLFVYQY--DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNV-------KSIFNIEKESGVISLKQSLSINKKSRYLFTVYAID-----------ALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEH----KFIMSIDASDKD--KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESH 2354
            + + E         I  A D D S+ N  + Y+           F+L V +      +  ++V +SL+ E +Q+Y   L+  D         +++ + V D NDN P+F + +  V+IPE+ P+G  ++++ A D D+    +  Y   ++          K +F +++ SG++++   L+  +   Y   + A D                   +     IEI D      I++ ++G +   Y         P  L  I VSD D G N  V C +                 Y + T  + DYE       +I   D+G+ +L    ++ I ++D N+  P     F E ++K ++PE+    K ++++ A+D+D  K A + Y L       F ++  TG II     LD+E   +  F +   D  I        V V +LD NDN P+F +    F + E +  +S +   +   D+D+ E N  +   +L T N ++       F +  + G I + V  DRE+   Y L + A D G P +S++  + I V+D+NDNSP+ + PPS  +     +F + +    G+IV ++ A+D D +   ++ Y I+    H
Sbjct:  160 VSVPENAPAGKRFPIQPANDPD-SEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSGLVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRD------IVAPVNGVI---YISEASHVNLPVAL--ITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNEYVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPV----FTEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGPDAPTMFHMDPETG-IISLTEQLDREKKANYSFTILAKDQGIPVLEGNATVIVNVLDVNDNRPRFSLAEFDFYVNENVPKHSTVGM-VTVADSDEGE-NGRVRLSILGTDNRQL-------FSIDPESGMIRSNVGFDREQRHYYVLEVQATDGGEPVRSSTVKVVIHVMDINDNSPIVLMPPSNTTY----KFVVPRTLP-GTIVTEVSAVDNDAEINAELRYHIVGGNPH 750          

HSP 2 Score: 71.633 bits (174), Expect = 8.545e-13
Identity = 125/500 (25.00%), Postives = 203/500 (40.60%), Query Frame = 3
Query: 1167 DVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIH-VSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTI--------------RSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---------DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLS------TRIEAKDADKDE--------INHSIIFRLLH-TYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +V I +ED+NDN P       +      + + EN P    F I   +D D+  N        VRR +LL    A +  +++                 +S D E  QL E  +  +D GSP       ++I + D N+  P        +   EN P    ++ + ASD+D G  A + Y L          + G+  F ++  +G ++  N  L++E +   +  +  TD    P  AT  VTVT+ D NDN+P            G+ + S+ S        I   D D            N  + F+L   TY N+  L   +  D  +K E              Y + I A D G    S + ++TI ++D NDN+PV+        +EP  + ++ +   IG  +  + A D+D D   ++ Y +              ++  +GI+S+      +   +Y  T+L   A D G P L+  AT+I+NV   NDN
Sbjct:  138 EVRINVEDINDNAP------AFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANG-------VRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVFDQAEVNVEIPENSPVGTHVVQLHASDRDAGSNAEVVYRLGTSTGGAGSGQGGKRLFRLDQNSG-LVTVNGLLNREESPVYRIIILATDKGPEPVPATATVTVTVTDVNDNSPTIEIRDIVAPVNGVIYISEASHVNLPVALITVSDPDIGANGAVTCYIYNPEVPFQLKKLTYPNQYLLETRETLDYETKNE--------------YVVQIKAADAGATSLSRTMSVTIKLLDSNDNAPVF--------TEPTYKVSVPENNVIGKHLITVSATDRDMDKNAEMVYFLGP-----DAPTMFHMDPETGIISLTEQLDREKKANYSFTIL---AKDQGIPVLEGNATVIVNVLDVNDN 593          

HSP 3 Score: 60.8474 bits (146), Expect = 1.742e-9
Identity = 56/214 (26.17%), Postives = 93/214 (43.46%), Query Frame = 3
Query: 1689 INSRTGEIIMSNVTLDKEM-------NDS--VKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVV---TIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKA 2291
            +N RTGE+  +   +D+E         D   V  +V +      P    + V + + D NDNAP F    L  ++ E      +   +  A D D  E N    + LL +    +      + + ++  ++  +V   ++DRE+   Y + + A D G+PP S S  + I V D NDNSPV+         + E    I + + +G+ V QL A
Sbjct:   88 VNPRTGELFAAGRKMDREALCGGQDPGDECHVDVQVGVLPVQPGPFFKLIEVRINVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQ-PANDPDS-EANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGSAVLRINVTDTNDNSPVF--------DQAEVNVEIPENSPVGTHVVQLHA 291          

HSP 4 Score: 53.9138 bits (128), Expect = 1.936e-7
Identity = 48/169 (28.40%), Postives = 73/169 (43.20%), Query Frame = 3
Query:  855 VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFN-KTFYGFQSNYNVKSIFNI---EKESG----VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVV 1334
            + V D NDN P F      V +PE+ P GK+     A D DS     + +    S+    S F +   E  +G     + +++SL   ++  Y   + A+D  S       A + I + D NDN P+             + I EN+P  T +  +H SD+D G NA V
Sbjct:  141 INVEDINDNAPAFAAPVLTVSVPENAPAGKRFPIQPANDPDSEANGVRRYELLPSDPATVSAFELSVTETANGEKVPYLVVRKSLDREERQLYEMNLRAVDGGSPPHSGS-AVLRINVTDTNDNSPVFDQAE------VNVEIPENSPVGTHVVQLHASDRDAGSNAEV 302          
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004042.1 (pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 gene:ENSPMAG00000003698.1 transcript:ENSPMAT00000004042.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 139.043 bits (349), Expect = 2.840e-33
Identity = 117/459 (25.49%), Postives = 193/459 (42.05%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRI--YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKD------ADKDE-INHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP 2189
            ++ V V DENDN P F   +    +PE  PIG  +  V A DAD+ L     Y  +        F++   +G I    SL    +  Y+  V A+D          A + + + DVND+ P       ++  PY      + P  T +F++   D D G N  +  SL         +      I+  R ++    ++   +       D G+P   +   + +   D  EF P         SF+E+ P    I  + A    +   + Y L   G +   F ++ ++GE+ +    LD E     +  V   DS   P +A + + V +LD NDNAP+F  +          F++K+      +        DKD  IN  + + ++             +F V+ + GEI +V T+DRE  ++Y LT+ A D+G+P +  +  + I+V D NDNSP
Sbjct:   11 TVTVLVEDENDNLPRFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRLRGG---DGHFSVNPSTGQIITTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVTDVNDHTPR------FLNAPYVAYAPSSAPAGTAVFAVTARDADAGPNGDLRFSLSGSASAGFSVDPRRGVIHAARALQGPRDDLTLTVRVS----DGGAPPRSAVTTVTVRFRDAGEF-PRFAPGPRSFSFREDQPPGTTITVVAARSSRRAGPVSYHLASGGNLGDVFAVDPQSGEVSVHRA-LDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSS---------RFWAKVPENTPPRTIVVLTAVDKDSGINGQVDYSIIDGNIGN-------VFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPTQHCTVKVLISVTDENDNSP 438          

HSP 2 Score: 138.272 bits (347), Expect = 4.197e-33
Identity = 159/618 (25.73%), Postives = 262/618 (42.39%), Query Frame = 3
Query:  726 QYDPDILSIMVMR-SLNYELKQIYFCKLKVCDKTYQN-CVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG---AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFI--TDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKAL-XXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI------HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++D D    + +R SL  +   I+   ++  D+       R + I+ V +EN   P F      + +PE++P G  + +VTA D D+ +     Y   S  +   +F+I + SG + L   L    +  Y  +V A D      K + + V I + DVNDN P+++       D Y + I EN P  T +  +   D D+  NAV   SL     DL  +   + +   + T    DYE  Q  E  +   +       S   + + I  VNE+ P            E+ P    + S+ A+D+D G    +      E     F++N  TGEII+S+  LD+E   S   +V      S+       + V V I D ND  P F   L    + E  S  + +   + A D D      +  F L+ + N        + F +++  G I     +DRE    Y LT++A D G PP + +T + + + DVNDN P       L SS       +++    G  V  L+A       + G  ++ ++ ++  ++G  + +L+ +SG+L         Q P  +    L ++  D G PPL +  TL ++V   NDN
Sbjct:  698 RFDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASG-DGSGLFDISRASGDVLLVGELDYETEKLYNLSVCAADG-GWQAKTECSGVSISVTDVNDNPPMLN-----ASDYYPV-IPENAPSGTTVLVMDAVDADSPSNAVTMYSLDDGEADLFVL---NQKTGVLTTQGFLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFVQREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFGESRSKGFSVNEHTGEIIVSS-QLDREREASATLRVIAKNAGSIRGFDVDEVLVNVAITDAND-PPVFSSALYHGRVSEAASVGTHV-VGVSAHDFDSPPGWRTFSF-LIQSGNAG------RAFSINAHTGLIVVASPLDRESVPLYNLTVVAVDMGEPPATGTTVVVVALEDVNDNGPFL-----LTSSA-----KVTENQPAGMTVLNLEAGDPDLPPNKGPYTFQLLGSDPAWRG--YFSLS-SSGLLKTARPIDREQKPEFH----LPVAIADAGSPPLTSTVTLHLSVLDQNDN 1277          

HSP 3 Score: 114.005 bits (284), Expect = 1.348e-25
Identity = 156/634 (24.61%), Postives = 255/634 (40.22%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQN-CVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRT---------GEI-------------IMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRI---EAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSG-ILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            V+  DP    + V R+L++E +  Y   ++  D  +        + V V+D NDN P F   ++  K+PE+ P  + I+ +TA D DS +  +  Y      N+ ++F +   SG I    +L     + Y  TV A D  S T +     V I + D NDN P  + +       ++  + E+      +  +   D D G NA +  SL     D            +I   R  + E       ++   D   PA      + I++ DVN+  P        + F E       +  + ASD D GA         G+++F + S+T         GEI               S   L+K       F V   D    P ++   VT+ I+  N NAP+F+     T    ++   +  TRI    A D D+D +N  I + ++    ++        FDV + G +    ++  +  S +++T+ A+D+G PP S+     I+V + N  +P +  PP L  S PE           GS +A++ A D D    G I Y I S +    G     ++  SG +L + +  L Y       L + A D G       + + I+V   NDN
Sbjct:  278 VFAVDPQSGEVSVHRALDHEYQHHYELVVEARDSGFPPFSAYLKLEVDVLDINDNAPEFSSSRFWAKVPENTPP-RTIVVLTAVDKDSGINGQVDYSIIDG-NIGNVFRVNPNSGEIRSVSTLDRENVASYELTVKATDRGSPT-QHCTVKVLISVTDENDNSPRFTQI-------FSAHVREDAAVGFPVLRVSTLDADEGPNAAITFSL----LDPSLPFSIHPSTGEITVSRRLNREDRSGYAVKVRASD---PAWTVSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGAN--------GQVFFFMRSQTENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNK-----YSFVVTAMDRGRPPLSSDATVTINIVVPNANAPRFLRERYSTP---VAATVRAGTRILDMSAVDPDRD-VNGQIAYSVVGGNASRR-------FDVDAGGFLHLRASLAGDAGSIFSVTVEARDRGRPPLSSRATAIISVTEENQYAPRFAHPP-LELSLPE-------NHPAGSSLARVTATDTDAGVNGAIVYSIASGD----GSGLFDISRASGDVLLVGE--LDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDN 856          

HSP 4 Score: 102.064 bits (253), Expect = 4.860e-22
Identity = 140/600 (23.33%), Postives = 237/600 (39.50%), Query Frame = 3
Query:  666 NQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKS---------RYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSL----RVRRKDLLEMIKADMEIYQIRTIRSFDYEILQL-IEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDK---GAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQ-----FVHTLPFTIQEGLSFYSKLSTRIEAKDA-DKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSG 2396
            N    +   D S+ F +      P    I V R LN E +  Y  K++  D  +   V   + + V D NDN P F +  Y ++ PE       + +V+A DAD     + F+  +S       F + ++SG I   + L     +         +Y F V A+D        D A V I I   N N P    L      P A  +   T    +  +   D D  +N  +  S+      RR D    + A   ++   ++      I  + +EA     D G P L SR    I + + N++ P   +   ELS  EN P    +  + A+D D    GAI+       G   F I+  +G++++    LD E        V   D      T    V++++ D NDN P      +   +P     G        T +   DA D D  ++++    L      + +L++K   ++++G       +D E    Y LT+ A +  +    ++  + + +  VN+  P +V        + E  F +S+ A +G+ V  + A D+D    G + Y++   ES  +G    ++NE +G
Sbjct:  471 NAAITFSLLDPSLPFSIH-----PSTGEITVSRRLNREDRSGYAVKVRASDPAWT--VSTDVTIVVDDVNDNAPRFGQTAYYIEFPEPSEGEALVARVSASDADDGANGQVFFFMRSQ---TENFRVGRDSGEIHSVRPLRYRDPAGGGSGANLNKYSFVVTAMDRGRPPLSSD-ATVTINIVVPNANAP--RFLRERYSTPVAATVRAGT---RILDMSAVDPDRDVNGQIAYSVVGGNASRRFD----VDAGGFLHLRASLAGDAGSIFSVTVEAR----DRGRPPLSSRATAIISVTEENQYAPRFAHPPLELSLPENHPAGSSLARVTATDTDAGVNGAIVYSIASGDGSGLFDISRASGDVLLVG-ELDYETEKLYNLSVCAADGGWQAKTECSGVSISVTDVNDNPPMLNASDYYPVIPENAPSG--------TTVLVMDAVDADSPSNAVTMYSLDDGEADLFVLNQKTGVLTTQG------FLDYETKQTYELTVRAFNYPDTFHYSTAQVHVQITGVNEYFPRFV--------QREYNFVVSESAPVGAPVGSVFATDRDAGIDGTVFYMLFG-ESRSKG---FSVNEHTG 1019          

HSP 5 Score: 87.0409 bits (214), Expect = 2.068e-17
Identity = 94/369 (25.47%), Postives = 161/369 (43.63%), Query Frame = 3
Query: 1473 SGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMS----IDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH---TATMFVTVTILDQNDNAPQFVHT-----LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ---HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +G P L     + +++ D N+  P     F     +  +PE   I S    ++A+D D G  AI+ Y L   G  +F++N  TG+II +  +LD+E  +S   +V   D    P    +AT+ V VT  D ND+ P+F++       P +   G + ++     + A+DAD    N  + F L  + +    +   +       G I     +   +D + TLT+   D G PP+S  T +T+   D  +       P S         F+  ++   G+ +  + A    +   G +SY + S  +   G+ F  ++  SG +S+H+   H   +   L+ + A D G PP   Y  L ++V   NDN
Sbjct:    1 AGEPRLTGTGTVTVLVEDENDNLP----RFGAAELRAAVPEDAPIGSDVALVNATDADAGLNAIISYRL-RGGDGHFSVNPSTGQII-TTASLDREGRESYVLEVTALDGGPTPGLSSSATLVVAVT--DVNDHTPRFLNAPYVAYAPSSAPAGTAVFA-----VTARDADAGP-NGDLRFSLSGSASAGFSVDPRR-------GVIHAARALQGPRD-DLTLTVRVSDGGAPPRSAVTTVTVRFRDAGEFPRFAPGPRS---------FSFREDQPPGTTITVVAARSSRRA--GPVSYHLASGGN--LGDVF-AVDPQSGEVSVHRALDHEYQHHYELV-VEARDSGFPPFSAYLKLEVDVLDINDN 332          
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Match: EDO35412 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLK9])

HSP 1 Score: 186.422 bits (472), Expect = 9.831e-48
Identity = 180/682 (26.39%), Postives = 318/682 (46.63%), Query Frame = 3
Query:  213 YLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFF--DESMTFQLFVYQY-DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-----QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPY----AIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKAD-MEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL---DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            +  S+ +    TFH+ EE   G  +G ++             + F  S K F  ++ T  +   + ID +T                +  + ++  +      S++V+V D++DN P F      +++ E + +NT+  I+ A D D    N   +Y     D + TF L          L ++  + L+ E    Y   +   D+     +   +I + ++DEND+ P+F +  YL  I E+   G  IL+V+A D DS       Y       QSN    SIF+++  +GVI  KQ+L    K+ Y F V A D   V  K D A V I + D NDN P + +   Y+P P+    AIR + +     +  I V+DKD+  N+     L++   D     K + +  Y I+  +  D E++      +   D G P+  +   + I + DVN+  P+  +N    +  E      +++ ++A+D D+G    + YS+   +++G  +F ++ ++G ++ +   LD+E   SV   +   D    P T +  VTVTI+D NDN P+F+ +    TI EG S  + +  ++ A D D  + N  I + +     +  +     +F+++++ G + T   +DRE  S Y+ T+LA+D G+P   +S  + +T+ D+NDN+PV+
Sbjct:    2 FAASVSAGSSYTFHVQEEQPPGTYVGKVD-----------GASAFEGSPKQFGFNSNTGVISTTARIDRETTT--------------QISLQLRTLNPSNQPISVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGN-NGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMGYCLINITILDENDHAPVFTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSN----SIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDG-GVPSKNDLATVTINVLDTNDNSPQLKIT--YLP-PHNGDKAIRSENSLINTNIAYILVTDKDSNTNS--QTELKITNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGGNDLG--WFQVDFQSG-LVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATV-LQVSATDVDSGD-NGRITYEI-----SSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVF 637          

HSP 2 Score: 148.288 bits (373), Expect = 5.839e-36
Identity = 120/449 (26.73%), Postives = 198/449 (44.10%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQS-NYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYAD--------VEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITV 2165
            ++ V +ID NDN+P F++  Y   I E   IG  +L+V+A D DS    +  Y   S +  V  +F +  ++GV+  K  L    KS Y FTV A         KD+ D        VE+ I D+NDN P+      + P  Y   I EN PP  L  +  +D D G NAV++  +     +    I +   +  I T+ S D+E+ +     I   D G+        + + +++  +  P         +  EN+P+   +  + A+ KDK   + Y++         +   TG II  N  +D+E        V      + P +A   V + +LD+NDNAPQF  +      +G     ++     A D D  + N  + ++L    +N   LL       S+ G I+    +    ++ YT+ +LA D G+PP+ ++  I IT+
Sbjct:  515 TVTVTIIDGNDNKPRFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLA---------KDHGDPQLMSSVKVELTISDINDNAPV------FYPVEYFASIMENEPPGKLLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTGV--ISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVPKGTLVGRVYATTKDKNGSISYAIVSGDPTNLFLVDSTGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQFSTSSVIVDIDGTWLVGQVVYNAAAVDLDAGK-NGLVRYQLT---SNAEGLLWIN----STSGVIKLARKLTDGDETQYTVQVLASDSGSPPQHSTMTIHITL 938          

HSP 3 Score: 137.502 bits (345), Expect = 1.100e-32
Identity = 152/595 (25.55%), Postives = 249/595 (41.85%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT--LLKISAHDHGHPPLKNYATLIINV 2510
            I + + L+ EL   Y   L V DK          +++ V D NDN P F    Y   I E    G  +L++ A D D        Y      N    F ++ +SG+++  + L   + S    T+ A D  S   K     V + I D NDN P       +M   Y   I E      T+  +  +D D+G N  +   +      +  + + + +   + T    D E   L    +L  D G P L+S   +++ I D+N+  P         S  EN P  K ++ + A+D D+G     S D IG      F+I+S TG +I +  +LD E+ +     +   D        T  V VT+L++ DN P F++ +  FT+ E +     L  R+ A   DK   N SI + ++      + L+       S+ G I+    +DRE+ + Y L ++A+     P S    + I V+D NDN+P +        S      +I     +G +V    A+D D    G + Y + S       E  L +N TSG++ + +       T   +++ A D G PP   ++T+ I++
Sbjct:  377 IQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYSITGG-NDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAP-KTGSTTVTVTIIDGNDNKPR------FMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGK-LLQVTATDADEGTNAVISYDIIGGNNNGNFSIDSSTG-VISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFLYEMYNFTVYENVP-KGTLVGRVYATTKDK---NGSISYAIVSGDPTNLFLVD------STGGIIKINGDMDREEKAQYLLAVIARVGTVKPLSAQATVNIEVLDRNDNAPQF--------STSSVIVDIDGTWLVGQVVYNAAAVDLDAGKNGLVRYQLTS-----NAEGLLWINSTSGVIKLARKLTDGDETQYTVQVLASDSGSPP--QHSTMTIHI 936          

HSP 4 Score: 137.502 bits (345), Expect = 1.167e-32
Identity = 182/645 (28.22%), Postives = 285/645 (44.19%), Query Frame = 3
Query:  669 QKKNYQFF-------DESMTFQLF--VYQYDPDIL-------SIMVMRSLNYELKQIYFCKLKVCDK---TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFT-VYAIDALSV----TFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDE-NTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSI----DASDKDKG--AILRYSLDEIGRI--YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDRE-----KDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSI--VAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILS-IHQHPLSYGRTLLKISAHDHGHP 2474
            Q  +YQFF       D     QLF  + Q + + L        + + +SL   LK  Y   ++  D    ++   V  +I +Q  D ND+  +FV   +   + E+   G  +  + A   D S      Y   S+   +S F ++  SG I+ +  L   +  +   + VY + A ++    T K+D A V + + D+NDN P+ S         YAI + E + P   +F I   D D G NA    SL       ++    +    ++   ++ D E        +   D+ +  L S   I+I + D N+  P     F E  +  NI E   I S+    +ASDKD G   +++YS+   G +   F + S TG +I++  +LD E     +  +   D  + P ++T+ VTV +LD NDNAP F    +  T++E ++    +  R  A D D     H I F +             K F V S+  EI T+  ID E     +DS + L ++A D+G+P  ST  +IT+ V D NDNSP +VSPP+               AA GS   V  + A D D++  GK++Y I+S  + Y       L+ ++G L  IHQ P +     L I A D G P
Sbjct:  959 QPLSYQFFYVVAVDQDSGKNGQLFYSIPQGNEEGLFGIFPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVPVTIYIQ--DSNDHRSLFVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISS---ESHFAVDVRSGQITTRVRLDREELIKNTGSNVYIMQAEAMYNDTTIKRDKAIVIVTVTDLNDNAPVFSRAV------YAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTG--MDKFFINSSTGELHLSKTLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPV----FPESDYTVNITEDALIGSLVINLNASDKDIGQNGLIKYSISN-GNLAAMFDVESATGRLIVAK-SLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLTVRENVNTGFPVG-RCTASDRDTGTNAH-IAFSMYSQ-------TPSKTFSVNSATCEITTIAAIDLETMPAGRDS-FQLVVMATDQGSPKLSTRKSITVQVTDENDNSPGFVSPPA---------------AAAGSSLNVMTITAEDPDRNSNGKVTYSIISGNNGY-----FNLHPSTGQLQMIHQIPDNPTIYQLTIQASDGGQP 1554          

HSP 5 Score: 129.413 bits (324), Expect = 3.998e-30
Identity = 150/580 (25.86%), Postives = 248/580 (42.76%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVK--SIFNIEKESG---VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR------NNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL-----DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            S+ VQV D NDNEP F    Y ++I ES  +       TA D D+       Y   S  N    S+      +G    +  K+ L       Y   + A D  +      Y  + I I D ND+ P+      +  + Y   I ENT P  ++  +  +D+D+G N  +  ++         +   D     IRT ++ D+E+       ++  D G P+      + I ++D N+  P ++      +N ++    EN   +  I  I  +DKD     +  L     D+ G   F +       I     LD+E+       + +TD  +   +   FV + + D NDN+P F           L+       ++ A D D+ + N ++ + +  T  N +        D  S G + T   +DRE+ S+ T+TI AQD G+ PK+ ST +T+T+ID NDN P ++        +   +  IS+ A+IG+ V Q+ A D D  D G+I+Y I S+++   G     LN  +G+L          ++L    + A DHG P L +   + + +   NDN
Sbjct:   80 SVQVQVDDINDNEPRFPTLYYTLRIRESMDVNTTNPINTATDPDAGNNGTVDYTIASGDNTATFSLGTTACPTGSTLCVITKKPLDRETTDFYQLNITATDRGTPALMG-YCLINITILDENDHAPV------FTQNSYLGSIAENTKPGVSILRVSAADRDSGSNGDIKYAIDWDAIQSNSIFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDLATVTINVLDTNDNSPQLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKITNGDDEG--CFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDKGVPSRSTLGFVLIDVTDVNDNSPAFTSNAYTANISELAQNGSYVLQLNATDPDEGD-NGTVSYSI--TGGNDLGWFQ---VDFQS-GLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKPRFM--------KSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNG--LFELNTQTGVLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDN 633          

HSP 6 Score: 102.834 bits (255), Expect = 4.791e-22
Identity = 151/570 (26.49%), Postives = 242/570 (42.46%), Query Frame = 3
Query:  885 PIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSI-------HVSDKD---TGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIV-DVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLN----ETSGILSIHQHPLSYGRT--LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            P F    Y+  +  S P+  +   V A D DS    + FY      N + +F I    G + +++SL    K  Y   V A D    +F      V I I+D ND+  +      ++ + +   + EN+ P TL          H   KD   + I++  + ++ VR   +   ++ D E   I+   S  Y    +++AE +  D+    +   KAI I+ V D+N+  P        ++  E       +  I A D D+G  A   YSL    G   F INS TGE+ +S  TLD+E   S    V  TD+      +T  + +T+ D ND  P F  +     I E  +    L   + A D D   I  + + +   +  N   +     FDV S+ G +    ++D E    Y LTI AQD G  P S++ N+T+ V+DVNDN+P++ + P   +     R N++    +G   A  +       D G  +++  S  S    + F ++N    E + I +I    +  GR    L + A D G P L    ++ + V   NDN
Sbjct:  944 PKFTLSSYVTHVLASQPLSYQFFYVVAVDQDSGKNGQLFYSIPQG-NEEGLFGI-FPGGKLYIRKSLLQALKGSYDLIVRATDGGVPSFSASVP-VTIYIQDSNDHRSL------FVNNTFRFAVAENSSPGTLVGTLVAHALDHSRTKDIVYSLISSESHFAVDVRSGQITTRVRLDREEL-IKNTGSNVY----IMQAEAMYNDT---TIKRDKAIVIVTVTDLNDNAPVFSRAVYAITVSELSLPGSPVFRIKAMDADEGDNAKFFYSLVSGTGMDKFFINSSTGELHLSK-TLDRETTSSYNLVVKATDASNANLYSTAKIEITVGDSNDQRPVFPESDYTVNITED-ALIGSLVINLNASDKD---IGQNGLIKYSISNGNLAAM-----FDVESATGRLIVAKSLDFETTQLYELTITAQDHGLIPLSSTVNVTVNVLDVNDNAPLFPTQPVTLT----VRENVNTGFPVGRCTASDR-------DTGTNAHIAFSMYSQTPSKTF-SVNSATCEITTIAAIDLETMPAGRDSFQLVVMATDQGSPKLSTRKSITVQVTDENDN 1474          

HSP 7 Score: 91.2781 bits (225), Expect = 1.734e-18
Identity = 155/633 (24.49%), Postives = 265/633 (41.86%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTY--QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIP----------ESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG-VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFI----MSIDASDKDKGAILRY-----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPF-TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIH-----QHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++  D     I   ++L++E+K  Y   +   D     +N +  ++ + V+D NDN P    +  +  +P          E+  I   I  +   D DS+  ++T     +N + +  F +E      I L++ L       Y  T+   D   V  +     V I++ DVNDN P       +  + Y   I E     + +  ++ +D D G N  V+ S  +   + L   + D +   + T +  D E +  +   I   D GS        + + I+D N+ +P     F + S+K  I E   I    + + A+D D G   R      S D      F +N++TG ++ +   LD+E      F V   D       +++ V +TI D NDNAP F     F +I E       L  ++ A DAD+   N  I + ++   NN         F + SS G I T+ ++D E +  ++L I A+D GN   + +  + +TV++  DN PV++             F + +    G++V ++ A  +D++  G ISY I+S +          ++ T GI+ I+     +    Y   LL + A      PL   AT+ I V   NDN
Sbjct:  255 IFDLDSSTGVIRTKQNLDFEVKNSYTFNVIASDGGVPSKNDL-ATVTINVLDTNDNSP----QLKITYLPPHNGDKAIRSENSLINTNIAYILVTDKDSNTNSQTELKI-TNGDDEGCFKVEFLGFYFIQLQKPLDRELVPFYNLTLNVTDK-GVPSRSTLGFVLIDVTDVNDNSP------AFTSNAYTANISELAQNGSYVLQLNATDPDEGDNGTVSYS--ITGGNDLGWFQVDFQSGLVTTAKPLDREQVSSVTITITAQDHGSAPKTGSTTVTVTIIDGNDNKP----RFMKSSYKGTISEGASIGATVLQVSATDVDSGDNGRITYEISSSDAQVNGLFELNTQTG-VLWTKSQLDRETKSLYSFTVLAKDHGDPQLMSSVKVELTISDINDNAPVFYPVEYFASIMENEPPGKLL--QVTATDADEG-TNAVISYDIIGGNNNGN-------FSIDSSTGVISTLASLDHEVEEFFSLIISAKDGGNKYAAKTAVVNVTVLNKADNLPVFL--------YEMYNFTVYENVPKGTLVGRVYATTKDKN--GSISYAIVSGDP----TNLFLVDSTGGIIKINGDMDREEKAQY---LLAVIARVGTVKPLSAQATVNIEVLDRNDN 840          
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Match: EDO40470 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S751])

HSP 1 Score: 178.333 bits (451), Expect = 3.907e-45
Identity = 169/573 (29.49%), Postives = 280/573 (48.87%), Query Frame = 3
Query:  849 IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSR-YLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRS-FDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLD-EIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFV-HTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVT-IDREKDSNYTLTILAQDKG-NPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDHGHPPLK-NYATLIINVQQPNDN 2528
            + + VID NDN P F     LV++PE  PIG     V+  DADS +  +  +   SN    ++FN++  +G +SL + +     +R Y   V A D  S   +   A +E+++ DVND  P+           Y   + E TPP + +  +  +D D+G N  ++ +   +       ++   +I+    I+S  D E ++    +++ ID G+P   S   +K+I+ DVN+  P  +        KEN P   ++ ++ ASD D+G    + Y  D ++ +  F ++ +TG+I  S V LD+E   S  F +  TD   +P      VTV + D ND +P+F  +    T+ E L   S L T I A D D+   N  I +         M +   K F ++    + T+V+ +DRE    + L ++A DKG N    T T I I V+DVNDN PV+++  +  +        + ++  IGS+VA + A+D DQ D GK+ Y I++  +    +    +NET+G++S  +  L +    R +L++SA D G    K +Y  + I V+  NDN
Sbjct:  793 VTIAVIDINDNSPQFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG--TLFNLDSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPP-RSSTAMLELKVVDVNDYSPVFGNWS------YTAHVLETTPPDSNIIEVVATDVDSGENGRISYAFDSKVDTSKFGLRNGGKIF----IKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGAVSASDSDEGSNGHVTYRFDTQVAQ--FIVDKQTGKITTSQV-LDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKFSKNKYSVTVNEDLPVGSSLLTLI-ATDDDQQGPNSDITY---------MIVAGPKAFSLNQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKT--------VPEKLPIGSVVAAVLAVDSDQGDNGKVRYKIVNGNT----DGTFKINETTGVISTLRA-LDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDN 1326          

HSP 2 Score: 142.124 bits (357), Expect = 5.139e-34
Identity = 149/561 (26.56%), Postives = 240/561 (42.78%), Query Frame = 3
Query:  885 PIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF------VHTLPFTIQEGLSFYSKLSTRIEAKDADKDE-INHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-HQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            P F    ++  + E+ P G  ++KVTA D DS    +  Y   S   +   F+I+K SG+I     L   KK  Y  TV+A   +S  F+     V I + D NDN P       ++     +++ EN+P + ++++ V D D G N  V  S+     D    I       ++ T    D E     +  +   D   P   +   I I I D N+  P  + +    +  E  P    I+++ ASDKD G    + Y+L       ++I+SRTG I+ S    +  +     F     D   +P  A + V + I D+N++APQF      VH  P T        S L T + A DAD D+  N  + +RL  + N+    + E     S+ G + T           + L I+A+D G+PP      + I + ++ D+      PP   +  P AR +I + + +GS +  ++A         +++Y I+S     +G  F  ++  +G++S+     L Y  T    L + A   G   L  Y  L INV   NDN
Sbjct: 1539 PEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDK-FSIDKHSGLIVTNSILDREKKDTYFLTVHAT-GVSYPFRVSSTSVRINVMDRNDNPP------KFISPVVTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNTDGAFTIG--RSTGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSNDTYGVYSIDSRTG-IVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPYEVHIFPNTSA------SALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVE-----SNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDD------PPRFLNQTP-ARVSIPENSKVGSYITTVRARASSD---AQVTYSIISGN---KGRAFY-VDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDN 2063          

HSP 3 Score: 133.265 bits (334), Expect = 2.993e-31
Identity = 179/655 (27.33%), Postives = 286/655 (43.66%), Query Frame = 3
Query:  639 AMDKDFSKINQKKNYQFFDESM--TFQLFVYQ-YDPDILSIMVMRS----LNYELKQIYFCKLKVCDK---TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISL---LHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADM--EIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI-----YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPND 2525
            A+D DF   N  ++Y     ++   F+L   +  D D+ + +V+ +    ++ E    Y   +   D         +R SI V+  D NDN+P F    Y   IPE+  +G  IL+V+A D D     +  Y  +++ + ++IF I   +GVI     L    K  YL  V A D  S       A V IE+ DVNDN P+I +   L G      + ++ EN    T +  + VSD D+G N  VN +L     D    +K D+  +   I   +S D E       + +CID G P   + K+ +I + DVN+  P    +  E    EN   +  +  ++A D+D G  + L Y++           +F I+  +G +I +   LD+E    V   V + D    P +    V V + D NDN P F   +   ++ E     S +  ++ A+D D  E N  I++ +L          +   F    KG +    T+D E  S+YT  + A D G   +S +  + +++ D+NDN PV+   PS  S E        +   IG  + QLKA+D+D   F    ++I   E     E F    + SG++++ +     +    LL + A D G     N A + I V   ND
Sbjct:   81 AVDSDFGS-NSTQSYTIVSGNVGNVFKLISKRDTDGDLYADLVVNASSIGVDRERLDSYVLNISASDGGNPANHGFLRLSITVE--DTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTGVIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGG------SYQVTENATIGTQVARVSVSDADSGKNGEVNVTL--EGGDGYFSMKFDVLNDESIIAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSG-MITTATDLDREQIPQVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDNDPYFNQSSYNASLFENSPSGSPV-VQLLAQDPDIGE-NSLILYSILTP--------NTPFFLDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGG--RSCNATVHVSLTDLNDNQPVF--DPSSYSVE------YFENTRIGQSICQLKAIDRDSPKFAITRFII---EQGNADEVFSV--DGSGLITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVND 698          

HSP 4 Score: 129.798 bits (325), Expect = 3.059e-30
Identity = 144/539 (26.72%), Postives = 246/539 (45.64%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCD--KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDY--ADVEIEIEDVNDNYPII---SLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVI 2336
            I  +R+L++E+   Y  ++   D  K  Q    + + + V D NDN P F +   +  I E+ PI   +  + A D DS L ++ +Y   S  + ++ F I  E+G+I     +   + S Y   V A D       + Y  A ++I I+D+NDN P     +L +    +P+  ++          SI   D DTG     N   R+   D  +    D++   ++ I S DYE +      I   D GSP L S +   +++VDVN+  P    +    +  EN P    ++ + A D+D G  A L YS+   +    F+I+  +G +I++N  LD+E  D+    V  T        ++  V + ++D+NDN P+F+  +  T++   +  ++L   +  +D D    N  +++ ++    +    +        S GE+ T   +DRE  ++Y L++ A+D   P  +   NITI + D NDN PV+    SL SS       IS+    G+ +  L A D+D    G I Y +
Sbjct: 1281 ISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPTFDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYTIDSQ-SPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVSRNLTYVMEDEPFNFQVT---------SITALDPDTGQGG--NVEYRIVSPDTGKF-SLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSIPSGVEMDKFSIDKHSG-LIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV-VTLKVPENSPARLIYTLTVQDLDYGN-NTKVLYSIMSGNTDGAFTIGR------STGELSTTTKLDRETKASYQLSVQAKDITPPYYTAFANITIFIEDQNDNPPVFQQ--SLYSS------TISELTPPGTSILNLTASDKDSGSNGNIVYTL 1789          

HSP 5 Score: 126.716 bits (317), Expect = 3.203e-29
Identity = 162/611 (26.51%), Postives = 262/611 (42.88%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDY-EILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINS---------RTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGK-ISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSY---GRTLLKISAHDH-GHPPLKNYATLIINVQQPNDN 2528
            I + + L+ E +  Y   +K  D   Q+ V K+I+ + V+D ND  PIF + +Y   I E       I  V A   D     +  Y   S  N  +I  I   +G + L+  +   K      TV A D  +      YA+V I + D+NDN P       +      +R+ E+TP   T +++ V D D+G+   V+ SL      L  +   D     +   +  DY    +     +   D GSP   S   +++ +VDVN++ P   N        E  P    I+ + A+D D G        E GRI +  +S         R G  I     LD+E  +    KV   D      +++  V V + D NDN P F   +  F ++E     + L   + A D+D+    H + +R           + + I D    G+I T   +DRE  ++Y  +I+A D G+ P+   T +T+ V DVND SP +        S+ +    ++++  +GS +  L A D DQ      I+Y+I++      G +  +LN+ +G+L++   PL      R +L + A D  G+  L+    + INV   NDN
Sbjct:  655 ITLAKLLDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIGHVHAISRDKGTNAEVVYSI-SKGNTDNIVLI-NSTGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFG-YANVTIAVIDINDNSP------QFNSSSILVRLPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPGTLFNL---DSNTGALSLTKLIDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVNDYSPVFGNWSYTAHVLETTPPDSNIIEVVATDVDSG--------ENGRISYAFDSKVDTSKFGLRNGGKIFIKSKLDREDIEEYNLKVIAIDHGTPRRSSSADVKVIVDDVNDNNPHFQQASYAFFVKENEPVATYLGA-VSASDSDEGSNGH-VTYRF-------DTQVAQFIVD-KQTGKITTSQVLDREAKASYVFSIVATDGGSSPRVDKTQVTVIVRDVNDCSPKF--------SKNKYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVA------GPKAFSLNQVTGVLTL-VSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDN 1220          

HSP 6 Score: 120.553 bits (301), Expect = 2.496e-27
Identity = 147/628 (23.41%), Postives = 262/628 (41.72%), Query Frame = 3
Query:  741 ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKK--ILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLH-----------GYMPDPYAIRIDE-----------NTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEM-IKADMEIYQIRTIRSFDYEIL-QLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKF----IMSIDASDKDKGAIL-RYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT-IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL-----LKISAHDHGHPPLKNYATLIINV 2510
            ++S+    +L+YE  + +   L    + + +     I+ + VID NDN P F     L ++ E     K   ++KVTA D DS    K  Y   +  N   +F I+  +G I+  + L     + +   +   D+  +  K     V++ + D+NDN P+   L              +    A   D+           +TP   +  +  +D+D+G NA +  S  +   D ++  I AD  +   R  R+ D  I    I+  +  +D G P   +   ++III      EP     FE  S+   +PE+      ++++  +D   G  L R S +     YF I  R+G +I  N  LD E        V   D         + V + + D ND  P F  +       EG+   + +   +    ADKD   +  ++  + + ++K     ++       G I T   +D E    + +++ A D+G+PP  T  ++TI V+D+NDN PV+  P   +         + +   + S + ++ A D+D     ++S+ ++       G+    +++ SG L+ +     Y  T      L I A D G+PPL +  T+I+NV
Sbjct: 2016 VISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTG-NEAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDS-GIPPKSTNCQVKVVVTDLNDNPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISAR--RTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITR----EPK----FELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNYFRIGQRSG-VISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIV---VNVSAADKDSGANGRVWFAIQSGDDKGSFAIDR-----KTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPND-------VQVLENLPLNSRLYEINATDRDSGANARLSFTVIGG----TGQGLFLIDKFSGWLTTNIT-FDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNV 2610          

HSP 7 Score: 119.013 bits (297), Expect = 5.775e-27
Identity = 91/335 (27.16%), Postives = 165/335 (49.25%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQN-CVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIE--AEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHK----FIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVT 1730
            I V + L+YE K+ +   +   D T  +  VR  + + V D ND +P+F +  Y+ +  E  P+G  ++ V+A D DS    + ++  QS  + K  F I++++GVI  +++L       +  +V A D  S     D + V I + D+NDN P+  +     P P  +++ EN P  + L+ I+ +D+D+G NA ++ ++       L +I  D     + T  +FDYE   + +    I   D+G+P L S   I + + D +E++PS    F  + +K ++P +     F+  + A+D+D G        + GR++F   + T   +  N T
Sbjct: 2359 ISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD-KGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVS-VTIRVLDLNDNPPVFRV-----PGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLI--DKFSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPS----FNRMDYKFDVPGNAKIGDFVGQVTATDRDSG--------DQGRVFFVFYNPTSNALKMNAT 2672          

HSP 8 Score: 119.013 bits (297), Expect = 6.958e-27
Identity = 129/520 (24.81%), Postives = 221/520 (42.50%), Query Frame = 3
Query:  768 LNYELKQIYFCKLKVCDKT---YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVR-RKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNF-EELSFKENIPEHKFIMSIDASDKDKGAILRYSL--DEIGRIYFTINSRTGEI-IMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF--VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKA 2291
            L+ E K  Y   ++  D T   Y      +I ++  D+NDN P+F +  Y   I E  P G  IL +TA D DS       Y   ++     +++I+  +G++        + K  Y F   A D      K     V I+IED N++ P       +   PY + I  NT    L + +  +D DT  +     + R+   K+   +   +     +RT   F           I+  D GSP L     ++I+I ++ +  P   N     +S  EN     +I ++ A      A + YS+     GR ++ ++  TG I + S   LD E   + +  +  T          M + + ++D+NDN+P F   + L    ++  +F  +   ++ A D D    N  + + +  T N         +F + S+ GEI T   +DRE  +++ L I   D G PPKST+  + + V D+NDN P++         +P +  NI ++   G++V  + A
Sbjct: 1708 LDRETKASYQLSVQAKDITPPYYTAFANITIFIE--DQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGSNGNIVYTLSND--TYGVYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQ-GQDPKMAIVPVRIKIEDKNNHAP------QFTKTPYEVHIFPNTSASALVTMVTATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRAR-ASSDAQVTYSIISGNKGRAFY-VDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSPAFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSG-TNGKVTYSIW-TGN------EAGVFTIDSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLNDNPPLF---------DPLSEVNIREDTRTGAVVTSVVA 2197          

HSP 9 Score: 115.546 bits (288), Expect = 7.205e-26
Identity = 152/609 (24.96%), Postives = 251/609 (41.22%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKT-YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKS---IFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRY-----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL----LKISAHDHGHPPLKNYATLIINVQQPND 2525
            I V +SL+ E    +F K    DK        KS  + V D ND  P F    Y  ++ E+  +   +  V A D D    ++  Y   +    +S    F I+  SG+I+    L   +  + + TV   D  S     D   V + + D NDN P       +    Y   + EN+P  + +  +   D D G N+++  S+             D     +   R+ D+E+      ++   D G  +      + + + D+N+ +P    +   + + EN    + I  + A D+D  K AI R+     + DE+    F+++  +G I ++ + LD+E  D+    V   D           V +T+LD ND  P F      FTIQE     S +   + A   DK   N  +++ +     + + L++       S G +     +D EK  +  LT+ A+DKG PP     N+TI VID+NDNS      P  NSS    R  + ++  IG     +   D D    G++S+ ++S            L+  +G LS+ +  + YG +     L + A D G PP  + A L + V   ND
Sbjct:  341 IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCAPKFDRHTYETRVWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIPQVVLTVLVHDRGSPPLS-DNCSVIVNLTDSNDNDPY------FNQSSYNASLFENSPSGSPVVQLLAQDPDIGENSLILYSILTPNTPFF----LDPRKGLVTNSRTLDHEVQSSYTFQVAATDGGGRSC--NATVHVSLTDLNDNQPVFDPSSYSVEYFENTRIGQSICQLKAIDRDSPKFAITRFIIEQGNADEV----FSVDG-SGLITLAKL-LDRETQDNYLLTVKAVDGGGQDSVNKAIVNITVLDVNDEPPIFSKAEYNFTIQEHSQALSVIG-HVHAISRDKG-TNAEVVYSISKGNTDNIVLIN-------STGTLYLQSEVDHEKIPSLYLTVQAKDKGTPPLFGYANVTIAVIDINDNS------PQFNSSSILVR--LPEDTPIGHTFYTVSVFDADSGVLGRVSFSLLSNPG-----TLFNLDSNTGALSLTKL-IDYGNSARSYTLPVQAQDGGSPPRSSTAMLELKVVDVND 907          

HSP 10 Score: 112.079 bits (279), Expect = 7.977e-25
Identity = 105/389 (26.99%), Postives = 181/389 (46.53%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYF-CKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSL-FNKTFYGFQ-SNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIR-NNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEI---GRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFI--TDSLINPHTATMFVTVTILDQNDNAPQF 1859
            Y+ D D   I   R+++  ++  +    ++  D+      R  + V++I     EP F    Y  K+PE+  +G  +L V   D  + L   +  Y  + SNY     F I + SGVIS+ + L    K R+L  V AID  + + K     V I + DVND  P+     GYM      +  E  P  T+  ++  +DKD+G N  V     ++  D       D +   IRT R+ D+E ++     +   D GSP + +  ++ I ++D+N+  P  R     ++   EN+P +  +  I+A+D+D GA  R S   I   G+  F I+  +G  + +N+T D E     ++ + I  TD+   P ++ + + V + D+++  P F
Sbjct: 2250 YKIDADTGVISARRTIDVRIRDSFIQIPVQAMDQGVP-PQRALVYVRIIITR--EPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGLPLGRISYNIENSNY-----FRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPS-KPVRVPVYINVSDVNDEKPVFG-QSGYM-----AQWSEGIPVGTIVVNVSAADKDSGANGRV--WFAIQSGDDKGSFAIDRKTGVIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLYEINATDRDSGANARLSFTVIGGTGQGLFLIDKFSG-WLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF 2620          

HSP 11 Score: 106.301 bits (264), Expect = 4.405e-23
Identity = 129/498 (25.90%), Postives = 219/498 (43.98%), Query Frame = 3
Query:  939 GKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRY-----SLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQ--EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDS--NYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL 2402
            G  IL+V+A D DS    +  Y F    + +  + I+ ++GVIS ++++ +  + R  F    + A+        A V + I        II+    +    Y  ++ EN    T + ++ V+D   G+  +   S  +   +   + +       I   +  DYE  +     +  ID  +P+   R  + I + DVN+ +P    +     + E IP    ++++ A+DKD GA  R      S D+ G   F I+ +TG +I +   LD E   +    V  TD    P    + VT+ +LD NDN P F    P  +Q  E L   S+L   I A D D    N  + F ++      + L+ +        G + T +T D E  +   Y+LTI A D GNPP S++  I + V D ++  P +        +  + +F++   A IG  V Q+ A D+D  D G++ +V  +  S+      L +N T+GI+
Sbjct: 2217 GIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTGVISARRTIDV--RIRDSFIQIPVQAMDQGVPPQRALVYVRI--------IITREPKFELPSYFGKVPENAMMGTSVLTVRVTDNAAGL-PLGRISYNIENSNYFRIGQRSG---VISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVFGQSGYMAQWSEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDDKGS--FAIDRKTG-VIRTQRALDHETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDNPPVFRVPGPNDVQVLENLPLNSRLY-EINATDRDSGA-NARLSFTVIGGTGQGLFLIDK------FSGWLTTNITFDYENTAVYQYSLTIKATDAGNPPLSSNITIIVNVADEDEYDPSF--------NRMDYKFDVPGNAKIGDFVGQVTATDRDSGDQGRVFFVFYNPTSNA-----LKMNATTGII 2676          

HSP 12 Score: 105.531 bits (262), Expect = 7.764e-23
Identity = 166/669 (24.81%), Postives = 279/669 (41.70%), Query Frame = 3
Query:  579 KQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRS-LNYELKQIYFCKLKVCDKTYQNCVRK--SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSG---SPALLSRKAIKIIIVDVNEFEPSIRNNFEELSF-KENIPEHKFIMSIDASDKD--KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPF-TIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFG---KISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            K  + ++E + + +S+    A D D    N    Y        F L        +  ++ + S L+ E+   +   +   DK     +     I + V+D NDN P+F+ +     +PE  PIG  +  V A D+D     K  Y    N N    F I + +GVIS  ++L     +RY+  V A D      K  Y  V I +ED NDN P       +  +P    I EN P  T + +I   D D+G+N+ +  +  +  +      K + E   I+T    D E +     ++   D        L +   +KIII D+N+  P   +    L++  E+ P +  + SI A D D  +G  + Y +       F+++ +TG + +   +LD E        +  TD    P T+     V ++D NDN P+F   L   T+ E     + +   ++    D+D  +++    L ++  + +E+  +K       G I T   +DREK   Y LT+ A     P + +ST++ I V+D NDN P ++SP             ++ +    S    +  L     D+G   K+ Y IMS  +    +   T+  ++G LS       +   SY    L + A D   P    +A + I ++  NDN
Sbjct: 1123 KYSVTVNEDLPVGSSLLTLIATDDDQQGPNSDITYMIVAGPKAFSL------NQVTGVLTLVSPLDREVTHRHILHVVASDKGGNQSLETITYIEINVLDVNDNYPVFINETTFKTVPEKLPIGSVVAAVLAVDSDQGDNGKVRYKI-VNGNTDGTFKINETTGVISTLRALDFEVTNRYVLRVSATDMGKKQQKTSYQLVTIYVEDANDNRPT------FDKNPIITWIYENVPINTNVTTIKAHDDDSGLNSRIWYT--IDSQSPRAHFKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQDLNDNAPKFVS--RNLTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGKFSLDLKTGVLKLIG-SLDYEDVPQYTLHISATDLGSPPLTSYQLFNVVVVDVNDNPPEFTRDLFIGTVSENKPTGTSV---VKVTAYDRDSGSNA---ELTYSIPSGVEM--DKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPV------------VTLKVPENSPARLIYTLTVQDLDYGNNTKVLYSIMSGNT----DGAFTIGRSTGELSTTTKLDRETKASY---QLSVQAKDITPPYYTAFANITIFIEDQNDN 1746          

HSP 13 Score: 98.5969 bits (244), Expect = 1.048e-20
Identity = 136/524 (25.95%), Postives = 236/524 (45.04%), Query Frame = 3
Query: 1041 NIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINA----------VVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIG--RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPH-TATMFVTVTILDQNDNAP--QFVHTL--PFTIQEGLSFYSKLSTRIEAKDADK---DEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI------HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            ++E  +GVI+ K  L   K S Y  T+        T  K Y  V + ++D+NDN P  S + G          D++   K +      D D G N+          V N    + ++D    + AD+ +    +I   D E L      I   D G+PA      + I + D N+ +P   N     +  ENI     I+ + ASDKD G  A ++YS++     +  F I+  TG +I++NV LD E   S    V   D   +   +++  V + +LD NDN P     +TL   + + E  +  ++++ R+   DAD     E+N ++     + ++ K ++L+++         I    ++DRE   ++ L  +  DKG+PP++T  +  I V DVND +      P  +    E R  + + A + ++VA + A+DQD     ++ Y I +T        +  ++ +SG+++        Q P    + +L +  HD G PPL +  ++I+N+   NDN
Sbjct:    6 DLEYNAGVITTKTVLDREKVSAYNLTIVEFS----TPPKSYT-VLVYVQDLNDNSP--SFVRGTSAKLVVFENDKDFRQKLI----AVDSDFGSNSTQSYTIVSGNVGNVFKLISKRDTDGDLYADL-VVNASSI-GVDRERLDSYVLNISASDGGNPANHGFLRLSITVEDTNDNKPEFSNVSYSGTIPENIDVGTSILQVSASDKDIGTNAEIQYSIETHSDPQAIFGIHPTTG-VIVNNVRLDYEAKRSYLIVVKAEDKGSSHQLSSSAIVRIEVLDVNDNNPVIHVSYTLGGSYQVTENATIGTQVA-RVSVSDADSGKNGEVNVTLEGGDGY-FSMKFDVLNDESI-------IAVGQSLDRETHDHFFLKAVCIDKGDPPRTTEKSFRINVGDVNDCA------PKFDRHTYETR--VWENATVNTLVAIVNAVDQDFGSNSELVYTIANTTESRSYLHWFAIDPSSGMITTATDLDREQIP----QVVLTVLVHDRGSPPLSDNCSVIVNLTDSNDN 494          

HSP 14 Score: 85.1149 bits (209), Expect = 1.484e-16
Identity = 164/661 (24.81%), Postives = 268/661 (40.54%), Query Frame = 3
Query:  585 IIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQ------NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQ--IRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG-------AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTIL--DQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLH-TYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGI-LSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLII 2504
            I  + E + INT+++   A D D S +N +  Y    +S       ++ + +   I     ++ E    Y  K++  D+ +       N     II+Q  D NDN P FV +  L  + E  P   ++  +TA D D+       Y   S    K  F+++ ++GV+ L  SL      +Y   + A D  S      Y    + + DVNDN P       +  D +   + EN P  T +  +   D+D+G NA +  S+       +EM K  ++ +   I T    D E        +       P  +S  +++I ++D N+  P   +    L   EN P  + I ++   D D G       +I+  + D      FTI   TGE+  +   LD+E   S +  V   D  I P   T F  +TI   DQNDN P F  +L  +    L+        + A D D    N +I++ L + TY          ++ + S+ G + +    +      Y    +A+D+G  PK     + I + D N+++P +   P     E     N S  A +  + A     D D+   GK++Y +   +S      F+  + T  +  S        GR  L I A DHG PPL+ Y  + I
Sbjct: 1336 ITWIYENVPINTNVTTIKAHDDD-SGLNSRIWYTIDSQSPRAH---FKINSETGLIQTTHPIDREEISEYSLKVRATDQAFTEQDRLYNTATLKIIIQ--DLNDNAPKFVSRN-LTYVMEDEPFNFQVTSITALDPDTGQGGNVEYRIVSPDTGK--FSLDLKTGVLKLIGSLDYEDVPQYTLHISATDLGSPPLTS-YQLFNVVVVDVNDNPP------EFTRDLFIGTVSENKPTGTSVVKVTAYDRDSGSNAELTYSI----PSGVEMDKFSIDKHSGLIVTNSILDREKKDTYFLTVHATGVSYPFRVSSTSVRINVMDRNDNPPKFISPVVTLKVPENSPA-RLIYTLTVQDLDYGNNTKVLYSIMSGNTDGA----FTIGRSTGEL-STTTKLDRETKASYQLSVQAKD--ITPPYYTAFANITIFIEDQNDNPPVFQQSLYSSTISELTPPGTSILNLTASDKDSGS-NGNIVYTLSNDTYG---------VYSIDSRTGIVYSAARFETSIKQEYNFFCIAKDQGQDPKMAIVPVRIKIEDKNNHAPQFTKTPY----EVHIFPNTSASALVTMVTA--TDADTDKSTNGKVTYRL--DDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYIIAEDHGSPPLRGYGIVQI 1950          

HSP 15 Score: 83.1889 bits (204), Expect = 5.051e-16
Identity = 149/677 (22.01%), Postives = 274/677 (40.47%), Query Frame = 3
Query:  639 AMDKDFSK-INQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDEN--DNEPIFV-EKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFK-KDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP---PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG--------------------------------RIYFTINSRTGEIIMSNVTLDKEMNDS-VKFKVFITDSLINPHTATMFVTVTILDQND-NAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSK-GEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL----LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            A D D  K  N K  Y+  D   +  LFV + +   +      S   + +   +    + +      +R   IVQ++  N  D+ P F+ +    V IPE+  +G  I  V A+ +  +   +  Y   S  N    F ++  +GVIS+  + +++ +S   F ++ +           Y  ++I + D NDN P       + P     ++ E+T    P+ +  +  +D D+G N  V  S+    +  +  I  D    +I T +  D E     +  I   DSG P   +   +K+++ D+N+  P + +   E++ +E+      + S+ A+D DK + L Y+L                                    +I + I++ TG +I +  T+D  + DS ++  V   D  + P  A ++V + I  +     P +   +P     G S    L+ R+       D      + R+  +YN    + +   F +  + G I     +D E    + L + A D   P K     + I V DVND  PV+        S   A++  S+   +G+IV  + A D+D    G++ + I S +     +    ++  +G++   Q  L +  T+    + + A D G PP+    ++ I V   NDN
Sbjct: 1878 ATDADTDKSTNGKVTYRLDDSKNSTSLFVVESNTGSVRTSAGFSNPPQGRHALYI---IAEDHGSPPLRGYGIVQIVIGNIQDDPPRFLNQTPARVSIPENSKVGSYITTVRARASSDA---QVTYSIISG-NKGRAFYVDPFTGVISVASADALDYESTKNFRLHLVATPQGWVSLNGYMILDINVIDRNDNSP------AFHPSNMLAQLAEDTGAFKPRFVVKVTATDVDSGTNGKVTYSIWTGNEAGVFTI--DSTTGEITTAKLLDRETTASFDLVIRGTDSGIPPKSTNCQVKVVVTDLND-NPPLFDPLSEVNIREDTRTGAVVTSVVATDTDKESRLTYNLKSASTPGIAILRVSATDQDSGSNAQIKYSFPITNSDQIDYKIDADTG-VISARRTIDVRIRDSFIQIPVQAMDQGVPPQRALVYVRIIITREPKFELPSYFGKVPENAMMGTSV---LTVRV------TDNAAGLPLGRI--SYN----IENSNYFRIGQRSGVISVNKPLDYETKRRFLLVVSAIDDTAPSKPVRVPVYINVSDVNDEKPVF------GQSGYMAQW--SEGIPVGTIVVNVSAADKDSGANGRVWFAIQSGDD----KGSFAIDRKTGVIRT-QRALDH-ETIKTHHVSVRATDEGSPPMHTDVSVTIRVLDLNDN 2508          
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Match: EDO46189 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQM0])

HSP 1 Score: 169.088 bits (427), Expect = 2.480e-42
Identity = 169/611 (27.66%), Postives = 280/611 (45.83%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIG---RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
             ++ D     I V+  ++ E    Y   +   D      V  + + + V DENDN PIF   +    I E   IG ++  VTA D D     + FY         S F I   +GV+++K+ ++      Y  T+ A D  S     D  ++ + + DVNDN P+      +    Y   + EN+   T + ++   D D G NAV+  S+     +    I +   +  I T    D+E       E+   DS      ++  + I ++++N+  P+        S +EN P    ++ + ASD+D    L YS+  +G      F+I+ R+G I  ++V LD+E+      +V +TD+   P +   +VT+ ILD+NDN+P+F  +   +     S  S  S ++ A DAD+   N  I + L           ++     +S G I     +DRE  S Y L I A+D G PP+++S  I +TVID+ND+ P+ ++  SL  S    R N  KE  +  I+A     D D     ++++ ++S E H   +   TL+ T+G +S  + PL   +     L+I   D G+P L + A +II+V   +DN
Sbjct: 1250 AFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGD--TSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSD-KELTVVVNDVNDNPPV------FNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKRFKINSTSGV--IMTTTPLDFEEKSQYGLEVTATDS---KYTAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDSFGSLSYSI--VGGKDSDKFSIDQRSGIISTADV-LDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEG-TNARITYNLSR---------NDAFMIGASSGVITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPL-INSSSLRGS---VRENQPKETHVMRILAS----DADTGLNAELTFSLLSNE-H---KSVFTLDNTTGDIST-KVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDN 1820          

HSP 2 Score: 169.088 bits (427), Expect = 2.611e-42
Identity = 172/618 (27.83%), Postives = 271/618 (43.85%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQ---NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPK-TLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYS---LDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEI--NHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDNLFS 2537
            V+  D     I + +S +YE K  Y   ++  D+      +  + +I ++  D ND+ P+F    Y  +IPES  IG  ++ VTA D DS    +  Y   S  NVK  FNI+  SG I +   L       Y   V A D  S +       V I ++D+NDN PI     G    PY  R+ E++ P   +  +  +D D   N  V  +L     D  ++   +     I      DYE        +   D G+P+  S   +K+++ DVN+  P    +    +  EN+     +  + A+D D GA  + S   L     + F ++  TGEI  + V LD+E   S    +   D  +    A   V ++I D+NDN P F     F I E     S   TR+    A   +I  N ++ + ++         L  +       G +    T+DRE   +YTL + A D G+P +S + +I ++V+DVNDN+P +    SL S E      I ++A++ S V Q+K  D+D+   G I+  +       +G    T++ T  +LS  + PL Y  T    L ++A D G P     A + I +   NDN+ S
Sbjct:  420 VFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIE--DVNDHSPVFSPSNYSKQIPESTVIGSTVVTVTATDLDSGPRGRLEYRLISG-NVKGAFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTR-VTIALQDINDNSPI---FQG----PYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYAL----SDNTDVFSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPSRSSLTVVKVMVDDVNDNPPQFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENMAFAMDRFTGEI-TTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTFTGPSRFNISED----SPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPR------SGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRF--EKSLFSGE------IREDASVHSTVLQVKVEDKDEGSNGAITLSLSG-----EGSDNFTIDSTGFVLS--KTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPS 996          

HSP 3 Score: 146.747 bits (369), Expect = 1.593e-35
Identity = 158/633 (24.96%), Postives = 277/633 (43.76%), Query Frame = 3
Query:  720 VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKS-IIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD---KGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPS----------------LNSSEPEA--------------RFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGE--------QFLTLNETSGIL-------SIHQHPLSYGRTLLKISAHDH 2465
             +  D +  SI V   L+ E    Y  +++  D    +    + + + + D NDN PIF +  Y+ ++ ES   G +I +V A DAD S      Y    N +V   F+I   +G+I+LK  L   KK++Y+ TV A D  + + +     V++ ++DVNDN P       +    Y   + EN         +  +D D+G N  ++ S+    +++      D    +I T    D E +      I   D      ++   + I I D N+ +P+        +  E+ P    +  + A+D+D    GA+    +       F ++ R+G I+    TLD+E   S    V  +D+     + T  + V++LD NDNAP+F  +L    I+E  S +S   T ++ K  DKDE ++  I   L    +         F + S G + +   +D E  + Y LT+ A+D G+P KS +  + IT+I+VNDN P +VSP                  LN+++ +                F I + + + S+  +L      ++     + V+ +TE+  QGE        + L +N+ + +        S+H++ L  G+T+ K++A D 
Sbjct:  525 AFNIDANSGSIRVSSELDRETTPSYSLQVEARDGGSTSRSSSTRVTIALQDINDNSPIF-QGPYVFRVSESSSPGHQIGQVAATDADDSSNGDVRYALSDNTDV---FSINTSTGLITLKTQLDYEKKTQYMVTVTAKDGGTPS-RSSLTVVKVMVDDVNDNPP------QFAKSLYTCTVGENLAAGVAVCYVTATDADSGANGKISYSILSGNENM--AFAMDRFTGEITTRVPLDRETIASYSLTINADDGSLVRFMAATTVNISIADENDNQPTF-TGPSRFNISEDSPTGTRVGQLTATDRDIGPNGAVTYAIISGNQGNSFQLDPRSG-ILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHS---TVLQVKVEDKDEGSNGAITLSLSGEGSDN-------FTIDSTGFVLSKTPLDYETTAAYQLTVTARDGGSPSKSATAQVKITIINVNDNVPSFVSPAQVTSIPEDVAINTHVVKLNATDSDGTPLTFDIVEGNAGSSFKIDQSSGLISVAKRLD-----RETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHEN-LPIGQTVAKVTATDR 1126          

HSP 4 Score: 141.354 bits (355), Expect = 8.071e-34
Identity = 161/585 (27.52%), Postives = 256/585 (43.76%), Query Frame = 3
Query:  840 RKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLF-SIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQ------IRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIY-FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN--LFSG 2540
            R  +++ V DENDN P F    Y+  I E+ P   ++  VTA D DS       Y   S  N    F +  ++G I     L    K  Y   + A D    TF        I ++DVNDN P  +L        Y   + E+    ++   +   D D GINA ++ SL          +  D   +       IRT  +FD E     +  +   D GSP+   +  ++I I+DVN+  P   +     S  E++     ++++ ASDKD G  A LRYS       + FT+++ TG + +S  +LD E   S    + +TD    P T T  + + + D NDN P F    P   Q  +   +   T++ A D D    N +++F ++   +       + +F +  S G I    + D E  + Y LT+ A+D+G P K  +  +TI + DVND+SPV+ SP + +   PE+         IGS V  + A D D    G++ Y ++S   + +G     ++  SG + +      +   SY    L++ A D G     +   + I +Q  NDN  +F G
Sbjct:   53 RTVVVIDVKDENDNAPEFPLNSYVFNIRENTP-AAQVAIVTATDRDSGTNAAITYSLFSGENK---FMMNSKTGEIRTVTPLDHETKDSYTMRISAFDGKHTTFVP-----LITVDDVNDNAPFFAL------SVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSL----------VSGDTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVFSSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHAFTLDAVTGVVTVSR-SLDFEQRSSYALGLSVTDRGSPPLTDTSHLLINVNDINDNPPVFS---PSAYQSRVKENTPAGTQVSATDRDS-STNGALVFGIIKGND-------DGVFTIDGSTGIISIAKSPDYENKTRYDLTVQARDRGVPVKYDTAQVTIFIEDVNDHSPVF-SPSNYSKQIPES-------TVIGSTVVTVTATDLDSGPRGRLEYRLIS--GNVKGA--FNIDANSGSIRVSSELDRETTPSYS---LQVEARDGGSTSRSSSTRVTIALQDINDNSPIFQG 585          

HSP 5 Score: 139.428 bits (350), Expect = 3.044e-33
Identity = 161/613 (26.26%), Postives = 262/613 (42.74%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD---SSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +Q DP    + V  +L+ E    Y   +K  D  + Q  +  SI V V+D NDN P F +  +  +I E   +   +L+V  +D D   +     +  G  S+      F I+    V+S K  L     + Y  TV A D  S + K   A V+I I +VNDN P       ++       I E+    T +  ++ +D D         +  +   +     K D     I   +  D E        +   ++GS          I ++DVN+  P         S  EN+P  + +  + A+D+D+G  A + Y L       F +N  TG ++ +   LD+E   S   +V   D      +A   +T+TI D NDN+PQF  +    T+ E  +  S +  R+ A D D    N  + + ++          H   F + S+ G I  V  +DRE  ++Y LTI A+D G PP  ++  + ITV D NDNSP++ S         E  + I +  +IGS VA + A D+D+    ++ Y I+  ++         +N  +G+L++ +  +  +     L I A D G P + +   L + V   NDN
Sbjct:  837 FQLDPRSGILSVRSTLDRETIPSYTLVVKASDAGSPQQSITASIHVSVLDVNDNAPRFEKSLFSGEIREDASVHSTVLQVKVEDKDEGSNGAITLSLSGEGSDN-----FTIDSTGFVLS-KTPLDYETTAAYQLTVTARDGGSPS-KSATAQVKITIINVNDNVP------SFVSPAQVTSIPEDVAINTHVVKLNATDSDG-----TPLTFDIVEGNAGSSFKIDQSSGLISVAKRLDRETTANYTLVVRATETGSQGESVYNNATIRVLDVNDNAPVFNPGSYAKSLHENLPIGQTVAKVTATDRDEGENAKVTYELSVGDTSKFEVNPATG-LVTTKRPLDREDQASYSLRVTAMDHGKPSQSAVAAITLTINDLNDNSPQFSQSKYTLTVTENTANGSNI-LRVLASDPDAGA-NGRVTYSIISGN-------HGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGVPPWVSTAFVAITVADENDNSPIFAS--------NETSYGIDEGVSIGSRVAVVTATDRDEGSNAQVFYSIVRGDTSA-----FAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDN 1408          

HSP 6 Score: 136.346 bits (342), Expect = 2.901e-32
Identity = 161/637 (25.27%), Postives = 276/637 (43.33%), Query Frame = 3
Query:  318 LKTDP------RITEFHVSSKY---FEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVR-KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDV-SSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSP 2189
            L +DP      R+T   +S  +   F ID+ T  + +V  +D + + S +     K+  V            + S+  + + V D +DN P+F  ++    + E +SI + +++  A D+D     +  N Q F   +      +  +     + V + +N E    Y   ++  D+        K + V V D NDN P+F  + Y+  + E+      +L V A D+D        Y   S  + K  F I   SGVI     L   +KS+Y   V A D+   T K    +V I + ++ND  P       +    Y   + EN+P  T +  +  SD+D    +  + S  +      +    D     I T    D E++ L   ++   D+G+P L +   + I I+D N+  P   ++    S  EN     F   + A+D D+G   R + +      F I + +G I ++   LD+E   +    +   D    P  +++ + VT++D ND+ P     +L  +++E     + +  RI A DAD   +N  + F LL          H+ +F + ++ G+I T V +DRE+ + YTL I   DKGNP  S+  ++ I VID +DN P
Sbjct: 1226 LASDPDAGANGRVTYSIISGNHGNAFRIDSTTGRITVVGVVDREALASYNLTISAKDSGV----------PPWVSTAFVAITVADENDNSPIFASNETSYGIDEGVSIGSRVAVVTATDRD-----EGSNAQVFYSIVRGDTSAFAINAMNGVLTVKKEINRETVPTYTLTIRASDRGSPMMTSDKELTVVVNDVNDNPPVFNSQSYIGSVRENSAQSTSVLTVAADDSDVGANAVLRYSIISGNDEKR-FKINSTSGVIMTTTPLDFEEKSQYGLEVTATDS-KYTAK---TNVTIRVINLNDITP------AFTQQNYTASVRENSPTSTSVVKVSASDRD----SFGSLSYSIVGGKDSDKFSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLSNLTWVTIKILDENDNSPKFDSSSYSSSILENSAPSSFSFKLAATDADEGTNARITYNLSRNDAFMIGASSGVITLAQ-PLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHV-MRILASDADTG-LNAELTFSLLSNE-------HKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCP 1822          

HSP 7 Score: 119.783 bits (299), Expect = 3.673e-27
Identity = 116/404 (28.71%), Postives = 188/404 (46.53%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSL-DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMF-VTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDAD 1943
            IM    L++E K  Y  ++   D  Y    + ++ ++VI+ ND  P F ++ Y   + E+ P    ++KV+A D DS  F    Y      +    F+I++ SG+IS    L     S Y   V   DA +     +   V I+I D NDN P            Y+  I EN+ P +  F +  +D D G NA +  +L   R D   MI A   +  I   +  D E     +  I   D G+P   S   I++ ++D+N+  P I ++    S +EN P+   +M I ASD D G  A L +SL     +  FT+++ TG+I  + V LD+E       ++ + D   NP  +++  V + ++D++DN P+F  T    TI E L   + +  ++ A+D D
Sbjct: 1469 IMTTTPLDFEEKSQYGLEVTATDSKY--TAKTNVTIRVINLNDITPAFTQQNYTASVRENSPTSTSVVKVSASDRDS--FGSLSYSIVGGKDSDK-FSIDQRSGIISTADVLDRELVSLYAIQVRVTDAGNPPLS-NLTWVTIKILDENDNSPKFDSSS------YSSSILENSAPSSFSFKLAATDADEGTNARITYNLS--RNDAF-MIGASSGV--ITLAQPLDRENKSTYDLAIQARDHGTPPQASSITIRVTVIDINDHRPLINSSSLRGSVRENQPKETHVMRILASDADTGLNAELTFSLLSNEHKSVFTLDNTTGDI-STKVPLDREQQAVYTLRIGVADKG-NPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASI-VQVTARDID 1852          

HSP 8 Score: 110.538 bits (275), Expect = 2.165e-24
Identity = 110/381 (28.87%), Postives = 178/381 (46.72%), Query Frame = 3
Query: 1410 TIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT-IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIH-----QHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            T R FD E        +L  D+ +     R  + I + D N+  P    N    + +EN P  +  + + A+D+D G  A + YSL   G   F +NS+TGEI  +   LD E  DS   ++   D     HT T    +T+ D NDNAP F  ++  T + E ++  S +  ++ A D D   IN  + + L+              F V S+G I T    DRE  ++Y + + AQD G+P +S    + I ++DVNDN PV+        S  +   ++ ++ AIG+ +  + A D+D  +   + Y   S  +++      TL+  +G++++      +   SY    L +S  D G PPL + + L+INV   NDN
Sbjct:   24 TGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTPAAQVAI-VTATDRDSGTNAAITYSLFS-GENKFMMNSKTGEI-RTVTPLDHETKDSYTMRISAFDG---KHT-TFVPLITVDDVNDNAPFFALSVYKTGVYEDVAVGS-IVRQLTAVDLDVG-INARLSYSLVSG--------DTSYFTVDSQGVIRTKGAFDRETKASYQVALRAQDGGSPSRSGQATVEIEILDVNDNRPVF--------SSAQYTASVDEDVAIGAAMVTVTASDKDNGNNADLRYSFTSGNTNHA----FTLDAVTGVVTVSRSLDFEQRSSYA---LGLSVTDRGSPPLTDTSHLLINVNDINDN 372          

HSP 9 Score: 83.1889 bits (204), Expect = 5.870e-16
Identity = 83/283 (29.33%), Postives = 125/283 (44.17%), Query Frame = 3
Query: 1683 FTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            FTI+S TG I  +    D+E     +  V   D+    H     V + + D+NDNAP+F +++  F I+E     +     + A D D    N +I + L    N        K    S  GEI TV  +D E   +YT+ I A D     K T+    ITV DVNDN+P +        +    +  + ++ A+GSIV QL A+D D     ++SY ++S ++ Y       +  T G     +   SY    + + A D G P     AT+ I +   NDN
Sbjct:   12 FTIDSSTGSITTTGRKFDRESESRYRLTVLAQDAANRCHKGRTVVVIDVKDENDNAPEFPLNSYVFNIRENTP--AAQVAIVTATDRDSG-TNAAITYSLFSGEN--------KFMMNSKTGEIRTVTPLDHETKDSYTMRISAFDG----KHTTFVPLITVDDVNDNAPFF--------ALSVYKTGVYEDVAVGSIVRQLTAVDLDVGINARLSYSLVSGDTSYFTVDSQGVIRTKGAFD-RETKASY---QVALRAQDGGSPSRSGQATVEIEILDVNDN 267          

HSP 10 Score: 53.9138 bits (128), Expect = 4.750e-7
Identity = 34/99 (34.34%), Postives = 49/99 (49.49%), Query Frame = 3
Query:  702 MTFQLF------VYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVR-KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDAD 977
            +TF L       V+  D     I     L+ E + +Y  ++ V DK   +      +I+ VIDE+DN P F   +Y V I ES P G  I++VTA+D D
Sbjct: 1754 LTFSLLSNEHKSVFTLDNTTGDISTKVPLDREQQAVYTLRIGVADKGNPSLSSVADVIIDVIDEDDNCPRFQPTEYNVTISESLPRGASIVQVTARDID 1852          
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Match: EDO34815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN97])

HSP 1 Score: 160.229 bits (404), Expect = 3.697e-40
Identity = 158/601 (26.29%), Postives = 258/601 (42.93%), Query Frame = 3
Query:  765 SLNYELKQIYFCKLKVCDKTYQNCVR-KSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVT-----VTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ--HPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            SL++E    Y   +   D+          +++ V+D NDN P F+       I E+  IG+ + +VTA D DS L  + F+   S    K  F I +  GV+ +  SL    K+ Y+  V AID  S + ++ Y  V + ++DVNDN P       +    + + + E       + +   +D D G NA +  S+             +     +   R  D E  Q     +   D G   L S  A+ + I D N+  P       +    +  P    +++++A D+D G    + Y+   I  + F I   TG I  S+  LD+E         ++ +  +  H  T F +     +++ D NDN PQF  +    T+ E +   +K+ T + A+D D   IN  I++ L            + +F +  S G+I     I+RE   NY +TI A D+G P  S+   + + V+DVNDN PV+       +S    R      AA G  V Q+ A D D +  G ++Y IM     +      T+NET+G++      +  S     L + A D G  P  ++ T+ ++V   NDN
Sbjct:  291 SLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSGLNGRIFFSINSGSEGK--FEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDG-SYSPREGYGTVTVTLQDVNDNTP------KFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMS------YPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGG--GLESNVAVNVEIGDENDNSPQFPTVQYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYA---ILILPFIIVPDTGNINTSS-KLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKV-TMVTARDEDSG-INSQIMYSLTG---------GDGVFSIEPSTGQIRLQKAINREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVF-------TSRVYERTMSEGNAAAGEFVVQVNATDADVERNGHVTYTIM-----HGALGMFTINETTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDN 847          

HSP 2 Score: 121.324 bits (303), Expect = 5.685e-28
Identity = 126/496 (25.40%), Postives = 213/496 (42.94%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQ-NCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSS-----LFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEA-----EILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPV 2192
            + V  SL+ E K +Y   +   D +Y       ++ V + D NDN P F +  + V + E   +G  I+  TA D D        ++ ++ GF  N N          +G +++ + L    K  Y FTV+A D   +   +    V +EI D NDN P    +       Y   + + TP  T+  +++  D+D G N  V  ++ +    L  +I  D     I T    D E   L         +   D G     S   + I + D N+ +P    +    +  EN+P    +  + A D+D G  + + YSL   G   F+I   TG+I +    +++E  ++    +  +D      ++   V V +LD NDN P F   +   T+ EG +   +   ++ A DAD +   H + + ++H     M  ++E      + G I T   ++RE    YTL ++A+D+G  P      I + VID NDN+P+
Sbjct:  390 VRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVIVNATATDPDQGSNAAITYSMSYPGFAINSN----------TGSVTITRPLDRETKQAYSFTVHARDGGGL---ESNVAVNVEIGDENDNSPQFPTVQ------YQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILI----LPFIIVPDTG--NINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDNQPQFNQSEYSATVLENMPVGTKVTMVTARDEDSGINSQIMYSLTG-GDGVFSIEPSTGQIRLQKA-INREAKENYHVTITASDRGTPVLSSDAKVHVHVLDVNDNPPVFTSRVYERTMSEGNAAAGEFVVQVNATDADVERNGH-VTYTIMHGALG-MFTINE------TTGVIRTQGVLNRESKDFYTLIVMARDQGAVPYMDFGTIDVHVIDKNDNTPI 850          

HSP 3 Score: 114.775 bits (286), Expect = 7.109e-26
Identity = 154/630 (24.44%), Postives = 257/630 (40.79%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCD---KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKES--GVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPP----KTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMI---KADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINS---------RTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGI-----LSIHQHPL-SYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            +  DP+   I   R+L  +    Y   +   D    ++    R SI+V   D NDN P+F    Y   + E+ P+G  +L VTA DADS       Y   +  +      + K S  G I +  +L       Y  T+ A D      +   A   + I D NDN P  S         Y   I EN+ P    +   SI  +D+D   NA  +   R+   D ++     +  +   ++    S D+E        ++  D       S   + I ++D N+  P    +  + +  E     + +  + A+D D G      L+  GRI+F+INS         R+  ++  + +LD+E        V   D   +P      VTVT+ D NDN P+F        + EG++  S +   + A   D D+ +++ I     TY     + +      S+ G +     +DRE    Y+ T+ A+D G    + + N+ I   D NDNSP +   P++     + + ++     +G+IV  + A D+D  + G ++Y I+          F+ + +T  I     L   Q  L +    +L +S  DHG     ++A L I+V   NDN
Sbjct:   57 FTLDPNTGMIKTARNLERQQTFSYNLTIGAADHGLPSFSATTRVSIVVG--DLNDNNPVFNPTNYSTTVFENSPVGTSLLDVTATDADSGQNAYVTYSVTAGDSHGLFRAVTKVSNHGTIEVAGNLDREVNDFYNLTITATDGGVPISRTAIAIALVRILDRNDNVPKFSHAR------YTGSIQENSGPGVPVQMASSIMATDRDIESNA--DVRYRLNGSDSIQFAVNPRTGVITTRVSPPPSLDHERTTNYTFHVIAADQAGTGHESLAEVVIHVLDANDNTPRFIPSSIQSTISEAASIGQSVARVTANDPDSG------LN--GRIFFSINSGSEGKFEIGRSDGVVRVSGSLDREAKAVYVLNVSAIDGSYSPREGYGTVTVTLQDVNDNTPKFTKPAFNVDVSEGVAVGSVI---VNATATDPDQGSNAAI-----TY----SMSYPGFAINSNTGSVTITRPLDRETKQAYSFTVHARDGGGLESNVAVNVEIG--DENDNSPQF---PTV-----QYQTDVIDRTPVGTIVLAVNAEDRDVGNNGHVTYAILILP-------FIIVPDTGNINTSSKLDREQQSLYTLVHYVLNLSVTDHGVTQFTSFALLNISVTDFNDN 639          
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Match: EDO30364 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T100])

HSP 1 Score: 155.992 bits (393), Expect = 3.119e-38
Identity = 172/603 (28.52%), Postives = 277/603 (45.94%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCD--KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVS-SKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL---LKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            I+V   L+ E K +Y   +   +     Q+   + + + V D  D++P F      VK+ E+  IG  + K+TA D D      T     +N +   +F I+  +G I     L     ++Y   V A D  SV    D   V +++EDVNDN P+ S     MP  Y I   E +P  T +  +   D D G NA V  S+     D +  + A   +  + +    D E+ +     I   DSG P+  S  ++ I +VD+N+  P   N       +EN P    ++ + ASDKD G  A L Y L  +    F I+  TG  I +   L++E   S    +   DS I     T  V +T+ D ND+ PQF  +   F+++E +     +  R+   D D   IN +   R   +  N        +F V+ + G I T  T+DRE++++YTL I A+D G P   ++T++ IT+ DVNDN P++ S    N +  E+ F       + + V Q+ A D D+   G+ +Y I + ++    +    ++  +G+++I +  L Y +T    L +SA D G PPL     + I+V   +DN
Sbjct: 1144 IIVDSPLDREFKNVYILNVTAANIVAGAQDTTTQ-VHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKD---IGDTISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKD--SVNLVSDLLKVVVQVEDVNDNPPVFS-----MPG-YTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYV-TVNAITGVISLGS-SQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTRFAIDPDTGN-ITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVG-RVATTDED---INDNARVRYYISSGNT-----SLMFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLF-SKSVYNVTLRESVF-------LKTQVVQVIATDPDEGANGQFTYKITAGDT----DDVFYIDANTGLITI-KAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDN 1709          

HSP 2 Score: 149.443 bits (376), Expect = 3.081e-36
Identity = 160/560 (28.57%), Postives = 240/560 (42.86%), Query Frame = 3
Query:  777 ELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFY---GFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTL-FSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHK-----FIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-------VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREK---------DSNYTLTILAQDKGNP---PKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGE 2366
            E K++   +    +K   N    S+ + +I+ NDN+P+F +  Y   + E    G  I  +TA DAD   F    Y   G Q+ Y     F++  ++G IS  Q L  +   +Y F++   D      +   A V + ++DVNDN P  + +      PY   I EN P  T+ F +  +DKD+G N  ++ ++          I        + T R  D E +      +   D G  +      + + ++D N+  P I +    L+   NI E        + SI A D D G    L YS+   G   FT+NS TG + +S   LD+E+ DS    + +TD+   P+T +  V VTILD NDN P F       + T   T+ EG    +K    I A D D D  N  + + L    +    L           GE+     +DRE          D  + L I A D+  P    KS +  ++ITV D NDNS      P   S   E R  +S+ A  GS V Q+ A DQD +  GK+ Y I   + + + E
Sbjct:  354 EEKKVVATETDTSEKFSANA---SVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIADITATDADLGTFGALTYELRGGQAAY-----FSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGM------PYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDDGGHFSINGSG---LVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDG---LTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSG-GDSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADA-NGKVAYSLSGDEHGFFRLD-------PVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNS------PQFQSQNYETR--LSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENRKCE 876          

HSP 3 Score: 131.724 bits (330), Expect = 8.002e-31
Identity = 153/589 (25.98%), Postives = 256/589 (43.46%), Query Frame = 3
Query:  723 YQYDPDILSIMVMRSLNYELKQIYFCKLKVCD---KTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRT-------GE---IIMSNVT----LDKEMNDSVKFKVF-ITDSLINPHTATMFVTVTILDQNDNAPQF----------VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGIL 2402
            +  DPD  +I     LN E    Y   L+  D   +  +   R  +I+ V D ND+ P F +  Y   + E   +G  + +V   D D +   +  Y + S+ N   +F++ + +G+IS   +L   + + Y   + A D   +   +    V I IEDVNDN P+ S         Y + + E+   KT +  +  +D D G N      +     D +  I A+  +  I+     DYE   L    +   D G+P L     ++I + DV++  P            EN+     +++++A+D D  A  +       R+Y+ I S         GE   +I  N T    L++E +   + +V  I+   +    + +   +T+LD NDNAP+F            T P T    L+        ++A+D D+ E +  IIF ++    N +  +  K       G +     +DRE  S Y+L ++A+DKG P  S+S  + ITV+D+NDN P+  +P  +   E    F++ +    G  V  + A D D  +   I Y I +TE     +++  LNETSG L
Sbjct: 1446 FAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTR--VIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRY-YISSGNTSLMFSVNETTGIISTTSTLDREQNASYTLIITAKDH-GIPALESNTSVMITIEDVNDNKPLFS------KSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDVFYIDANTGLITIKA--KLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKPRYSAELYENVTRGHHVITVNATDIDAEASHK-------RVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRFDSESYVRSVLEDTGPITDATILT--------VKAQDGDEGE-SGEIIFTIVSGNENGVFQMDNK------TGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGVVAAQDLDTKNL--IYYYITNTEE----QKYFILNETSGEL 1994          

HSP 4 Score: 120.168 bits (300), Expect = 2.985e-27
Identity = 156/547 (28.52%), Postives = 237/547 (43.33%), Query Frame = 3
Query:  588 IKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRK--SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYL-FTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKD--KGAILRYSLDEIG-RIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL-PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSP 2204
            +KLSE  SI T+++   A+DKD   I    +Y   +    + LF    D     I  +  L+ E    Y  +L V  K   N V     ++VQV D NDN P+F    Y ++  E  P G  IL+V A DAD        Y      NV     +   +GVISL  S    +   Y  FT+ A D+  V  K   A V I++ D+NDN P+ +       D YA  + EN P  T +  +  SDKD G NA ++  L      L      D +   I T    + E        +  +DS   A      + I + D N+  P    +    S +E++     +  +  +D+D    A +RY +      + F++N  T  II +  TLD+E N S    +   D  I    +   V +TI D NDN P F  ++   T++E + F      ++ A D D+   N    +++     + +  +       ++ G I     +D EK S Y LT+ AQD G PP + +  + I V DV+DN+PV+  P
Sbjct: 1199 VKLSENASIGTNVTKITALDKD---IGDTISYSIANGD-PYGLFTI--DNVTGEIRTVAELDRENVTQY--ELFVQAKDSVNLVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVE--NVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDS-GVPSKSSTASVAIKLVDINDNSPVFN-----NTDYYAY-VRENQPAGTPVLVVTASDKDVGTNAKLSYVL---SGVLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQFTQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSLMFSVNETT-GIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESV-FLKTQVVQVIATDPDEGA-NGQFTYKITAGDTDDVFYID------ANTGLITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVFHKP 1716          

HSP 5 Score: 119.013 bits (297), Expect = 6.738e-27
Identity = 148/568 (26.06%), Postives = 258/568 (45.42%), Query Frame = 3
Query:  873 NDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIV--DVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFT-IQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSI-----HQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN--LFS 2537
            ND  P+F +  Y V + ES   G  I +VTA D D  +    FY   S+   ++ F + + +G I +   L    K+ Y+  V A + ++   +     V I + DV D+ P       +      +++ EN    T +  I   DKD G       S  +   D   +   D    +IRT+   D E +   E  +   DS +   L    +K+++   DVN+  P        + + E  PE   I+ + A D D G  A + YS+ E    Y T+N+ TG I + +  LD+E+ +   F +  TDS +   ++T  V + ++D NDN+P F +T  +  ++E     + +   +    +DKD   ++ +  +L        +L+ +       G I T   ++RE+  +YTLT+ A D     +  +T + ITV D ND+ P +        ++    F++ ++  +G  V ++   D+D +D  ++ Y I S  +        ++NET+GI+S       +   SY    L I+A DHG P L++  +++I ++  NDN  LFS
Sbjct: 1083 NDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFY---SSNGAEAKFYVSRSTGDIIVDSPLDREFKNVYILNVTAANIVAGA-QDTTTQVHITVTDVIDDKPY------FNSSSLTVKLSENASIGTNVTKITALDKDIGDT----ISYSIANGDPYGLFTIDNVTGEIRTVAELDRENVTQYELFVQAKDSVN---LVSDLLKVVVQVEDVNDNPPVFSMPGYTIEYWEESPEGTSILQVKAIDADIGDNAAVLYSIVENVTDYVTVNAITGVISLGSSQLDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPV---LVVTASDKDVGTNAKLSYVLSG------VLYTRFAIDPDTGNITTREPLNREETGSYTLTLRAVDSAIRAREGTTRVIITVTDANDHVPQF--------TQSGYAFSVREDVKVGHTVGRVATTDEDINDNARVRYYISSGNTSL----MFSVNETTGIISTTSTLDREQNASY---TLIITAKDHGIPALESNTSVMITIEDVNDNKPLFS 1609          

HSP 6 Score: 118.242 bits (295), Expect = 9.299e-27
Identity = 146/552 (26.45%), Postives = 247/552 (44.75%), Query Frame = 3
Query:  756 VMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGY----------------MPD----------------PYAIR----------IDENTP--PKTLFSIHVS---------------DKDTGINAVV-NCSLRVRRKDLLEMIKADMEIYQIRTIRSF-DYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIY--FTINSRTGEIIMSNVTLDKEMNDSVKFKVFIT--DSLINPHTATMFVTVTILDQNDNAPQFVHTLP-FTIQ------EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVW 2195
            ++R  N+  K    CK   C     +  R  +++ V D NDN+P+F + KY   + E+ P G  +L+V A D D     K  Y   +N N    F+I   +G I++   +       ++ TV A D    + +K +A+V I ++D NDN+P  S   GY                +PD                P A+           I++ +P   K+++ ++VS               D+D GINA++   S     K  +     D+ I      R F +  IL +  A I+       A  +   + I + DV + +P   ++   +   EN      +  I A DKD G  + YS+   G  Y  FTI++ TGEI  +   LD+E  +  ++++F+   DS +N  +  + V V + D NDN P F  ++P +TI+      EG S       +++A DAD  + N ++++ ++    + + +    I  V S G  +    +DRE +  +  TI A D G P KS++ ++ I ++D+NDNSPV+
Sbjct:  880 LVRHYNWHKKNCVLCKESKC-----SVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKL-TNGNKDDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQFSFT-GYEGEIAENSPVGSTITMVPDQKISSSTLRPRSSPRAPAALLTAREKRPITLINDESPLFEKSMYYVNVSESASRGIVIGRVTATDRDEGINAIIFYSSNGAEAKFYVSRSTGDI-IVDSPLDREFKNVYILNVTAANIVA-----GAQDTTTQVHITVTDVIDDKPYFNSSSLTVKLSENASIGTNVTKITALDKDIGDTISYSIAN-GDPYGLFTIDNVTGEI-RTVAELDRE--NVTQYELFVQAKDS-VNLVSDLLKVVVQVEDVNDNPPVF--SMPGYTIEYWEESPEGTSIL-----QVKAIDADIGD-NAAVLYSIVENVTDYVTV--NAITGVISLGSSQ----LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVF 1399          

HSP 7 Score: 113.62 bits (283), Expect = 2.412e-25
Identity = 151/607 (24.88%), Postives = 263/607 (43.33%), Query Frame = 3
Query:  768 LNYELKQIYFCKLKVCDKTY-QNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA-------ILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQ--EGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEK----IFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTS-TNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRT---LLKISAHDHGHPPLKNYATLIINVQQPNDNL 2531
            L+ E+++ +   ++  D          S+ ++++D NDN P+F    Y   + E+ P G  +L VTA D D     K  Y        +  F I+ ++G I+ ++ L+  +   Y  T+ A+D+ ++  ++    V I + D ND+ P  +   GY    +++R D      T+  +  +D+D   NA V   +      L  M   +     I T  + D E        I   D G PAL S  ++ I I DVN+ +P    +   ++ +E++     ++ + A+D D+GA       I     D++    F I++ TG +I     LD E        V   D    P T   FV + + D +DNAP F H   ++ +  E ++    + T + A D D +  +  + +R+     + M L+ E+      + +  G       ++RE  + Y L + A  + N  +  S     ITV+DVNDN+P +        SE   R  +     I  + +  +KA D D+ + G+I + I+S   +        ++  +G+L+    PL    T    L + A D G P L +  T+ I V   NDNL
Sbjct: 1357 LDREVEEYFNFTIRATDSGVPSKSSTASVAIKLVDINDNSPVFNNTDYYAYVRENQPAGTPVLVVTASDKDVGTNAKLSYVLSGVLYTR--FAIDPDTGNITTREPLNREETGSYTLTLRAVDS-AIRAREGTTRVIITVTDANDHVPQFT-QSGYA---FSVREDVKV-GHTVGRVATTDEDINDNARVRYYISSGNTSL--MFSVNETTGIISTTSTLDREQNASYTLIITAKDHGIPALESNTSVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAGDTDDV----FYIDANTG-LITIKAKLDYEKTSLYNLTVSAQDLGTPPLTGACFVEIHVSDVDDNAPVF-HKPRYSAELYENVTRGHHVIT-VNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSG------CLNRETHARYELQVAAISRVNLTEQKSLVPAVITVLDVNDNAPRF-------DSESYVRSVLEDTGPITDATILTVKAQDGDEGESGEIIFTIVSGNEN----GVFQMDNKTGVLT-RTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNL 1928          

HSP 8 Score: 98.9821 bits (245), Expect = 8.565e-21
Identity = 148/592 (25.00%), Postives = 261/592 (44.09%), Query Frame = 3
Query:  861 VIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKS-IFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTP-PKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMS--IDASDKDKGAILR---YSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKF-----------------------KVFITDSLINPH-TATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTS-TNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQH--PLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDN 2528
            V D NDN P+F E+ Y+ KI E+  +G  ILK++A DADS   ++  Y F +    ++  F++   +G ++L   L       Y+  V A D L V   +    V IE+ D++D  P    L  +    Y   I+ENTP   T+ ++   D D GIN  +   +     D +  I ++  +  +    S D E   +    +   +   P   +   + + +VDVN+  P+   +      +E++     ++S  +  +D DK  + R   Y L       F I+  +G + + N TLD E   +  F                       KV  T++  +   +A   VT+T+++ NDN P F   +  +T+ E ++  + ++  I A DAD         F  L TY  ++       F V++  G I     +D +    Y  +++ +D G   +  +   +T+T+ DVNDN P +   P  +        +I++    G+IV Q+ A D+D  + G++S+ I + +    G  F ++N  SG+++  +     +     L +SA+DHG      +  L +NV   NDN
Sbjct:   36 VDDYNDNAPVFTEQPYMAKIAENARVGTTILKISAIDADSGTNSQVQYKFSNATATQTPFFSLNSVNGELTLGGPLDFEVARSYMLVVIAED-LGVPKLESRTTVIIEVTDISDMPP--RFLQSF----YLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISGNSDGVFTIDSNTGVITVNG--SIDAEKTDVFRITVKASEVPDPNSNTTVTVVVTVVDVNDNRPAFLQSVYIFDVREDVALPGRVVSDQLQVTDGDKNPVFRRVLYHLVGADSDKFAIDPTSGTLYI-NKTLDYEKQINFTFDWERGCGSGGGSGWDWTGRGEEKKVVATETDTSEKFSANASVTLTLINVNDNKPMFAKSSYNYTMDEEITPGTHIA-DITATDADLG------TFGAL-TY--ELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTS--------DIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGD---DGGHF-SIN-GSGLVTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDN 594          

HSP 9 Score: 92.4337 bits (228), Expect = 8.060e-19
Identity = 169/696 (24.28%), Postives = 296/696 (42.53%), Query Frame = 3
Query:  594 LSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQL-----FVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKT--YQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAI--RIDENTPPKT--LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEE--LSFKENIPE-----HKFIMSIDASDKDKGA--ILRYSL--DEIGRIYFTINSRTGEIIMSNVTLDKE-------MNDSVKFKVFITDS-----LINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTR-------IEAKDADKD-EINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQ-------HPLSYGRTLLKISAHDHGHP-PLKNYATLIINVQQPNDNL 2531
            + E+I+  T I+   A D D               ++T++L       +  + D  +I   + L+Y+  + Y   L V D    YQ     ++ V + D NDN+P F    Y   I E+ P G  + +VTA D DS    +  +   +  +    F+I   SG+++  + L     + Y  TV A D   V+ +  +  + + + D NDN P I+       D   I   I E     T  L SI   D D G N  +  S+     D    + +     QI +    D E+    +  I   D+GSP   +   + + I+DVN+  P+   N  +   ++   + E     +K ++ I+A+D D  A   + YSL  DE G  +F ++  TGE+ +    LD+E            +F + IT +     + +  +AT+ V++T+ D NDN+PQF         +  ++ ++LS         I+    D+D E    +I+ +     N+             K E+E +V   R  + +    +L ++     + T   + I V DVNDN PV+      N S+  A  ++ + +  G+ V ++ A D+DQ   GKI+Y +    ++   +   ++N  +G +++         H       +L + A D G P   K +A ++I V+  NDN 
Sbjct:  398 MDEEITPGTHIADITATDADLGTFG----------ALTYELRGGQAAYFSVNADNGTISAAQILDYDTLRQYQFSLVVKDGGGFYQEIAIATVTVTLQDVNDNDPEFTGMPYTSDIAENLPAGTIVFQVTATDKDSGENGRLSFNISAGDD-GGHFSING-SGLVTTARELDRETIATYTLTVSAYDH-GVSSRHKHVQLTVNVLDENDNTPQIT-------DGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSM--SGGDSRFTLNSATGRLQI-SPTGLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEHG--FFRLDPVTGELSVRK-ELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSPQF---------QSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNITDGDENR-------------KCEVEKLV---RHYNWHKKNCVLCKESKCSVERTY--VVIYVDDVNDNDPVF------NQSKYAA--DVLENSPTGTPVLRVHASDRDQGANGKITYKL----TNGNKDDAFSINNVTGEITVAGVIDREAVHTF-----VLTVQAEDQGEPSSRKTFAEVVITVKDENDNF 1023          

HSP 10 Score: 74.3294 bits (181), Expect = 2.552e-13
Identity = 110/456 (24.12%), Postives = 195/456 (42.76%), Query Frame = 3
Query:  846 SIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDEN-TPPKTLFSIHVSDKDT-GINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRS--FDYEILQLIEAEILCIDSGSPALLSRKAIK---IIIVDVNEFEPSIRNNFEELSFKENIPEH------KFIMSIDASDKDKGAILRYSLDEIGRIYFTI--NSRTGEIIMSNVT--------LDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTL---------PFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQD 2117
            S+++ + D NDN+P+F +  Y V + ES  +  ++++V A D D     +  Y   +  +   +F I+  +G+I++K  L   K S Y  TV A D L          VEI + DV+DN P+      +    Y+  + EN T    + +++ +D D    +  V   +     D + +I     +  +    S   + E     E ++  I   +  L  +K++    I ++DVN+  P     F+  S+  ++ E         I+++ A D D+G        E G I FTI   +  G   M N T        LD+E        V   D      ++++ V +T+LD NDN P     +          F+++E L     +   + A+D D   +   I + + +T   K  +L+E      + GE+ T +T+DRE  S + L + A +
Sbjct: 1593 SVMITIEDVNDNKPLFSKSVYNVTLRESVFLKTQVVQVIATDPDEGANGQFTYKITAG-DTDDVFYIDANTGLITIKAKLDYEKTSLYNLTVSAQD-LGTPPLTGACFVEIHVSDVDDNAPV------FHKPRYSAELYENVTRGHHVITVNATDIDAEASHKRVYYRIESGNTDSMFLIGEQSGVITLNCTPSGCLNRETHARYELQVAAISRVN--LTEQKSLVPAVITVLDVNDNAP----RFDSESYVRSVLEDTGPITDATILTVKAQDGDEG--------ESGEIIFTIVSGNENGVFQMDNKTGVLTRTRPLDREDTSFYSLVVMAEDKGEPALSSSVTVNITVLDMNDNLPILQTPMDVLIPERRTTFSVKENLDAGVPVGV-VAAQDLDTKNL---IYYYITNTEEQKYFILNE------TSGELRTRITLDREDSSVHYLYVKASN 2016          

HSP 11 Score: 74.3294 bits (181), Expect = 2.574e-13
Identity = 99/401 (24.69%), Postives = 170/401 (42.39%), Query Frame = 3
Query:  765 SLNYELKQIYFCKLKVCDK-TYQNCVRKSIIVQVIDENDNEPIFVE------KKYLVKIPES-YPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSL---------SINKKSRYLFTVYAIDALSVTFKKDYADVEIEI--EDVNDNYPIISLLHGYMPDPYAIRIDENTPPKT-LFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGA--ILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMF--VTVTILDQNDNAPQFVHTLPFTIQEG 1892
             L+ ELK  Y   + V D  +  N    ++ V ++D NDN P F          Y++ + E    I K ++ + A D D+    K  Y    + +    F ++  +G +S+++ L         +     R+L  + A D  +    +  A V + I   D NDN P       +    Y  R+ E   P + +  +  +D+D      V  ++     D  E  K ++E    + +R +++     +    LC +S     + R  + I + DVN+ +P    +       EN P    ++ + ASD+D+GA   + Y L    +   F+IN+ TGEI ++ V +D+E   +    V   D    P +   F  V +T+ D+NDN PQF     FT  EG
Sbjct:  661 GLDRELKDSYDLIINVTDNGSPPNTNSTTVHVTILDVNDNTPAFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLSGDEH--GFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATPISDRKSATVRVSITVRDTNDNSP------QFQSQNYETRLSEAARPGSNVIQVSATDQDLEYKGKVIYNI----TDGDENRKCEVE----KLVRHYNWHKKNCV----LCKES--KCSVERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGANGKITYKLTNGNKDDAFSINNVTGEITVAGV-IDREAVHTFVLTVQAEDQG-EPSSRKTFAEVVITVKDENDNFPQF----SFTGYEG 1033          

HSP 12 Score: 65.0846 bits (157), Expect = 2.003e-10
Identity = 49/182 (26.92%), Postives = 88/182 (48.35%), Query Frame = 3
Query:  585 IIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNC-VRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYA 1127
            + K++E   + T+I    A+D D S  N +  Y+F + + T   F +  +     + +   L++E+ + Y   +   D        R ++I++V D +D  P F++  YL +I E+ PIG  ++ V A+D D  + N   Y   S  N   +F I+  +GVI++  S+   K   +  TV A
Sbjct:   52 MAKIAENARVGTTILKISAIDAD-SGTNSQVQYKFSNATATQTPF-FSLNSVNGELTLGGPLDFEVARSYMLVVIAEDLGVPKLESRTTVIIEVTDISDMPPRFLQSFYLKEIEENTPIGSTVVTVEARDGDVGINNPILYEIISG-NSDGVFTIDSNTGVITVNGSIDAEKTDVFRITVKA 230          

HSP 13 Score: 64.6994 bits (156), Expect = 2.125e-10
Identity = 129/539 (23.93%), Postives = 205/539 (38.03%), Query Frame = 3
Query:  750 IMVMRSLNYELKQIYFCKLKVCDKTYQNCVRK-SIIVQVIDENDNEPIFVEKKYLV-KIPESYPIGKKILK-VTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQS-LSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDP------YAIRIDEN--TPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIE---------AEILCIDSGSPALLSRKA----IKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSS-KGEIETVVTIDREKDSNYTLTILAQDKGNPP-KSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQL 2285
            +   R L+ E    Y   +   D    +  +   + V V+DENDN P   +   +   I E    G  +L  + A D D+    +  Y         S F +   +G + +  + L    K  Y   +   D  S     +   V + I DVNDN P       + P+P      Y I +DE   T  KTL  I+ +D D   N  V  SL     D     + D    ++   +  D E  Q+            +I   D  +P +  RK+    + I + D N+  P  ++   E    E       ++ + A+D+D    L Y     G++ + I             L +  N   K  V   +S  +      +V + + D NDN P F  +         S       R+ A D D+   N  I ++L  T  NK     +  F +++  GEI     IDRE    + LT+ A+D+G P  + T   + ITV D NDN P +    S    E E    I++ + +GS +  +
Sbjct:  550 VTTARELDRETIATYTLTVSAYDHGVSSRHKHVQLTVNVLDENDNTPQITDGLTITTNISEGAGGGTVLLSSIAAVDPDAGSNGQLTYSMSGG---DSRFTLNSATGRLQISPTGLDRELKDSYDLIINVTDNGSPP-NTNSTTVHVTILDVNDNTP------AFDPNPAQSLATYVITVDEGPGTINKTLIDINATDPDADANGKVAYSLS---GDEHGFFRLDPVTGELSVRKELDRESPQMSRNAQGDGRFLLDITATDQATP-ISDRKSATVRVSITVRDTNDNSPQFQSQNYETRLSEAARPGSNVIQVSATDQD----LEYK----GKVIYNITDGDENRKCEVEKLVRHYNWHKKNCVLCKESKCS--VERTYVVIYVDDVNDNDPVFNQSKYAADVLENSPTGTPVLRVHASDRDQGA-NGKITYKL--TNGNK-----DDAFSINNVTGEITVAGVIDREAVHTFVLTVQAEDQGEPSSRKTFAEVVITVKDENDNFPQF----SFTGYEGE----IAENSPVGSTITMV 1048          
BLAST of Protocadherin 11 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 229.18 bits (583), Expect = 2.172e-61
Identity = 240/802 (29.93%), Postives = 382/802 (47.63%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFY--GFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            L C +L PSI  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VVV   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN+P+F E +  V IPE+ PIG  ++++ A DAD     +  Y  G Q +   K +F +   SG+I++++ L   + + +  +V A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT IN  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ ++ A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  D   F V   D+   P  A   V VT+LD+NDN P+F H    F + E L  YS +   I   D+D  E N +I   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G PP S++  +TI VIDVNDN+P+ + PPS  S      F +   ++I GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 LACIWLDPSI--AQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNR---------IDREKLCPGSS--FEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGV-ITVTDSDAGE-NAAISLSILNDNENF-------ILDPFS-GVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 229.95 bits (585), Expect = 3.290e-61
Identity = 240/802 (29.93%), Postives = 382/802 (47.63%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFY--GFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            L C +L PSI  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VVV   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN+P+F E +  V IPE+ PIG  ++++ A DAD     +  Y  G Q +   K +F +   SG+I++++ L   + + +  +V A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT IN  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ ++ A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  D   F V   D+   P  A   V VT+LD+NDN P+F H    F + E L  YS +   I   D+D  E N +I   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G PP S++  +TI VIDVNDN+P+ + PPS  S      F +   ++I GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 LACIWLDPSI--AQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNR---------IDREKLCPGSS--FEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGV-ITVTDSDAGE-NAAISLSILNDNENF-------ILDPFS-GVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Medaka
Match: pcdh9 (protocadherin 9 [Source:NCBI gene;Acc:101156238])

HSP 1 Score: 229.95 bits (585), Expect = 3.305e-61
Identity = 240/802 (29.93%), Postives = 382/802 (47.63%), Query Frame = 3
Query:  201 LLCGYL-PSIISSQEITFHLVEENKRGLILGN-------------------LNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPD---ILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFY--GFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNCSLRVRRKDLLEMIKADME-IYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHT-LPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAI-GSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLS--YGRTLLKISAHDHGHPPLKNYATLII 2504
            L C +L PSI  +QE+ + + EE +  +++GN                   L Y + SK    P +     + + F   N+         ID + +C   S   +  +C  E +VVV   + Y     +K+ VKD +DN P+F      I + E   IN+  +I  A D D +  N    Y+  +    F L + +  P+      ++V ++L+ E K  Y  K+KV D         +I+ V V D NDN+P+F E +  V IPE+ PIG  ++++ A DAD     +  Y  G Q +   K +F +   SG+I++++ L   + + +  +V A D  S   +   A V I + DVNDN P I L +   P    + + E  P  T  + I VSDKDT IN  V C +    KD+   +KA  +  Y + T    DYE  +    +I+  DSG P+L     +++ + D N+  P       EL+  EN     F+ ++ A+D+D G  A + Y L      +F ++ +TG +  S V  D+E  D   F V   D+   P  A   V VT+LD+NDN P+F H    F + E L  YS +   I   D+D  E N +I   +L+   N        I D  S G I++ V+ DRE+ S+YT  + A D G PP S++  +TI VIDVNDN+P+ + PPS  S      F +   ++I GS+VA++ A+D D     ++ Y I+S  +    +    ++  +G +++ + P     G   L ++  D G+P  K+  TL++
Sbjct:   13 LACIWLDPSI--AQELIYPIREELQENVLIGNIPKDLNISHTSAATGASANLVYRLVSKAGDSPLVRVLGNTGEIFTTSNR---------IDREKLCPGSS--FEDAECSFEIEVVVLP-NDYFRLIKIKIIVKDTNDNAPMFPSPVINISIPENTLINSRFAIPSATDPD-TGPNSVHKYELINGQSAFGLDIVET-PEGEKWPQLIVQQNLDREQKDTYVMKIKVEDGGSPQKSSTAILQVTVTDVNDNKPVFRENQIEVHIPENSPIGTSVVQLQATDADIGPNAEIHYVFGTQVSPATKRLFALNSTSGLITVQRPLDREETAIHKLSVLASDGSSSPAR---ATVIINVTDVNDNPPNIDLRYIISPINGTVFLSEKDPINTKIALITVSDKDTDINGKVICFIE---KDVPFHLKAVYDNQYLLETSALLDYEGTKEYNFKIVASDSGKPSLNQTALVRVRLEDENDNPPIFTQPVIELAVMENNKRDLFLTTLSATDEDSGKNAEIVYQLGPNAS-FFDLDRKTGVLTASRV-FDREDQDRFLFTVTARDNGTPPLQAQAAVIVTVLDENDNNPKFTHNHFQFFVSENLPKYSTVGV-ITVTDSDAGE-NAAISLSILNDNENF-------ILDPFS-GVIKSNVSFDREQQSSYTFDVRAIDSGRPPCSSAAKVTINVIDVNDNTPIVIYPPSNTS------FKLVPLSSIPGSVVAEVFAVDSDTGMNAELKYTIVSGNN----KGLFRIDPVTGNITLEEKPAPTDIGLHRLVVNISDLGYP--KSLHTLVL 768          
BLAST of Protocadherin 11 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 219.935 bits (559), Expect = 5.387e-58
Identity = 226/814 (27.76%), Postives = 373/814 (45.82%), Query Frame = 3
Query:  189 ILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVS-TIDLDTICSTDSEC---CDKEKCVIETKVVVQEYSQYKSSFSLKVE--VKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISL--LHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN--LFSGL 2543
            I+  + CG +PS        + L EE     ++G+L   +   L     + +  V S Y  +D++T  +      ID +T+    S+C    + +KC +E +V + +  +        +E  ++ LD N         I+ LS  E     T  SI  A+D+D S  N    Y         QLF  Q     D  I  ++V+ +L+ E K  Y   ++V D         +++ + V D+NDN P F + +Y  ++PE+ P G  +L+V A DAD+       Y   Q++  V+ +  I++ +G+I +K  +   + +   F V A D      K   A V I I+D NDN P I +  +   +   +   I E+ P  T  + + VSD+D G NAVV C     +  + +   E        Y ++T    DYE ++    EI+ +DSG+PAL S  ++K+ + D+N+  PS      E++F E+      ++ + A+D D G  A L YS+ E      F INS TGEI + N  LD+E  +  +F V   D  +   T T  V + + D+NDN P+F +    F++ E +   + +   +   DADK E +   +F         +E  + K    +  G I + ++ DREK+S YT  + A D G+PP+S+   +TI V+D NDN+P +V+ P+ NSS      ++   +   + V  +KA D D     ++ Y I     H        ++  SG + + Q      + L  L +   D G PP    A + + V +  +N  L  GL
Sbjct:   28 IVLMVPCGAVPS-----NNIYKLSEEQPPNTLIGSLAADL--GLPDSGHLYKLEVGSPYLRVDSKTGEIYTTEIPIDRETL----SDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDR-GPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRN-QLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGV-VTVSDADKGENSQVTLF---------VEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAP-YVTKPA-NSS----YTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPH----GLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGL 807          
BLAST of Protocadherin 11 vs. Ensembl Medaka
Match: pcdh1b (protocadherin-1 [Source:NCBI gene;Acc:101174755])

HSP 1 Score: 218.394 bits (555), Expect = 6.331e-58
Identity = 226/814 (27.76%), Postives = 373/814 (45.82%), Query Frame = 3
Query:  189 ILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVS-TIDLDTICSTDSEC---CDKEKCVIETKVVVQEYSQYKSSFSLKVE--VKXXXXXXXXXXXXKQIIKLS--EKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQY----DPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSII-VQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGF-QSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISL--LHGYMPDPYAIRIDENTPPKTLFS-IHVSDKDTGINAVVNC----SLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKG--AILRYSLDEIGRI-YFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQF-VHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTL--LKISAHDHGHPPLKNYATLIINVQQPNDN--LFSGL 2543
            I+  + CG +PS        + L EE     ++G+L   +   L     + +  V S Y  +D++T  +      ID +T+    S+C    + +KC +E +V + +  +        +E  ++ LD N         I+ LS  E     T  SI  A+D+D S  N    Y         QLF  Q     D  I  ++V+ +L+ E K  Y   ++V D         +++ + V D+NDN P F + +Y  ++PE+ P G  +L+V A DAD+       Y   Q++  V+ +  I++ +G+I +K  +   + +   F V A D      K   A V I I+D NDN P I +  +   +   +   I E+ P  T  + + VSD+D G NAVV C     +  + +   E        Y ++T    DYE ++    EI+ +DSG+PAL S  ++K+ + D+N+  PS      E++F E+      ++ + A+D D G  A L YS+ E      F INS TGEI + N  LD+E  +  +F V   D  +   T T  V + + D+NDN P+F +    F++ E +   + +   +   DADK E +   +F         +E  + K    +  G I + ++ DREK+S YT  + A D G+PP+S+   +TI V+D NDN+P +V+ P+ NSS      ++   +   + V  +KA D D     ++ Y I     H        ++  SG + + Q      + L  L +   D G PP    A + + V +  +N  L  GL
Sbjct:   28 IVLMVPCGAVPS-----NNIYKLSEEQPPNTLIGSLAADL--GLPDSGHLYKLEVGSPYLRVDSKTGEIYTTEIPIDRETL----SDCRNLFEDDKCFLEFEVSITDMVKGIGLGPRLIEGIIEVLDINDNTPQFSSPILTLSIPENTHTGTLFSIPVAVDRD-SGSNGVAEYALSAGPDANQLFGLQVAEDVDEKIPQVIVIGNLDREKKDSYDLNIRVVDGGKPPRASSALLRITVTDQNDNAPKFEKNQYEAELPENSPPGHSVLQVRANDADTGANGDIDYSLHQASDTVQRLLRIDRSTGIIYVKGLVDREEDNLLKFYVVARDR-GPNSKSSKAQVTISIKDQNDNAPAIEIRGIGLVIHQNFVANISEDMPIGTPVALVQVSDRDEGENAVVTCVVAGDVPFQLRPASESANDRKRKYFLQTTTLLDYERIKDYRIEIVAVDSGNPALSSTNSLKVQVTDINDNTPSFSPALLEVNFAEDNQPGDKVIDVVATDADSGVNAELVYSIIESSAASLFEINSNTGEIRVRN-QLDREDVERYEFGVAAADKGVPSKTGTAIVVINVEDRNDNDPKFMLSGYSFSVNENMPPLNPVGV-VTVSDADKGENSQVTLF---------VEPDNGKFIIQNGTGTILSSISFDREKESTYTFRLKAVDAGDPPRSSYVGVTINVLDENDNAP-YVTKPA-NSS----YTHLKPSSPPDTPVEVVKAEDIDAGVNAELYYTITGGNPH----GLFQISHNSGEIKLAQGFTGKHKGLHRLVVRVSDKGKPPRHTTALVHVYVNETTNNVTLIEGL 807          
BLAST of Protocadherin 11 vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 1970.28 bits (5103), Expect = 0.000e+0
Identity = 1010/1010 (100.00%), Postives = 1010/1010 (100.00%), Query Frame = 3
Query:  162 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMXXXXXXXXXXXXXXXXXXXXXPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 3191
            MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA
Sbjct:    1 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 1010          
BLAST of Protocadherin 11 vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 1967.59 bits (5096), Expect = 0.000e+0
Identity = 1009/1009 (100.00%), Postives = 1009/1009 (100.00%), Query Frame = 3
Query:  165 MKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMXXXXXXXXXXXXXXXXXXXXXPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 3191
            MKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA
Sbjct:    1 MKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 1009          
BLAST of Protocadherin 11 vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 1964.12 bits (5087), Expect = 0.000e+0
Identity = 1009/1013 (99.61%), Postives = 1010/1013 (99.70%), Query Frame = 3
Query:  162 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMXXXXXXXXXXXXXXXXXXXXXPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQST---SSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 3191
            MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQS+   SSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA
Sbjct:    1 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSSMKASSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 1013          
BLAST of Protocadherin 11 vs. Planmine SMEST
Match: SMESG000051413.1 (SMESG000051413.1)

HSP 1 Score: 1962.19 bits (5082), Expect = 0.000e+0
Identity = 1009/1017 (99.21%), Postives = 1010/1017 (99.31%), Query Frame = 3
Query:  162 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMXXXXXXXXXXXXXXXXXXXXXPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQST-------SSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 3191
            MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQS+       SSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA
Sbjct:    1 MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIIIGMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYKDLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRFATPGSYLHEMDGESADSGKGTSDLDVAHQSSMKVLYLASSTNLYGSIQLIPSSRINYFVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTLSFNSLPPYNA 1017          
BLAST of Protocadherin 11 vs. Planmine SMEST
Match: SMESG000033639.1 (SMESG000033639.1)

HSP 1 Score: 447.203 bits (1149), Expect = 1.159e-138
Identity = 279/787 (35.45%), Postives = 457/787 (58.07%), Query Frame = 3
Query:  213 YLPSIISSQEITFHLVEENKRGLILGNLNYFITSKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKEKCVIETKVVVQEYSQYKS-SFSLKVEVKXXXXXXXXXXXXKQIIKLSEKISINTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVMRSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYLVKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQ--SNYNVKSIFNIEKESGVISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPIISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRKDLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIKIIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSLDEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATMFVTVTILDQNDNAPQFVH-TLPFTIQEGLSFYSKLSTRIEAKDADKDEINHSIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILAQDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAAIGSIVAQLKALXXXXXXFGKISYVIMSTESHYQGEQFLTLNETSGILSIHQHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIII 2561
            YL    S Q +TF ++EE+   +++GN+ +   S  K       + + S + ++ ++  ++ + S IDL+TIC+    CC++ +C+++T ++ ++ S  +S S ++ V V D +DN+P F+  KQ + ++E   I   + +D A+D D +  N+   Y F + + TF L   +  P I  ++V + L+YE+K  YF  L+ CD T + C  +++ + V+D+NDN P F +++Y ++I E++P+G++I+ V A D DS LFNK  YGF   S+ N+++ F I + +G I L++ LS   + +Y F V+A D +++ F K  A++ I+++D+NDN P I+ L G       I I+E  PP+ LF++ V+D D G+NA V+C L  +  +   +     EIY + +IRSFDYE  + I+AEI C D GSP  ++ K++ + + D+NEF P    +F++L   EN  +   I+ + ASD+D  A+L+YS       YFTI+  TG+I      LD+EM + ++  + +TD++ NP T    V + +LD+NDN P F+  +  F I E LS YSK+  RI A D DKDEIN+ ++F+L HT++++   + E IF V+  GEI TV  +DRE + NYT+ I A D G P  S   N TI V D NDN P WV+P  L+S       NI+  +  G ++ +L+A D D  +   ++Y +M+       +    LN+ +G L + +  L  G+  L + A D+G PP  N  +L I +   N +  + LNM+III
Sbjct:   12 YLCHQGSCQTVTFKIMEESPIDMVIGNIVHLHPSFNKA-----SYFIKSPFLKLSDK-GDLMLSSRIDLETICAQHEMCCEEVECILKTTIMAKDKSSDQSESINIHVSVSDKNDNWPKFVKPKQTVNVAENEPIGFYLYLDRALDADATSANRVHQYIFKEPTGTFNLDQSRL-PSI-GLIVKKPLDYEVKSQYFATLEACD-TNKQCNTQALEIHVLDQNDNYPSFSQQEYQIEILENFPVGQQIIAVEAIDKDSDLFNKIIYGFHELSDNNIRNTFIITENTGSIKLQKKLSAKVRQKYKFKVFAADKMAMAFHKAVANIFIKVKDLNDNSPKITSLSGNS----KIEINETDPPRELFTLQVTDDDIGVNANVSCQLLQQYINDFRLDAVGNEIYSLSSIRSFDYENEREIKAEIECYDHGSPRNVAHKSLNVHVKDINEFAPRFEKDFQKLKLLENREQGHNILQVSASDRDGSAVLKYSFTGEPNDYFTIDPHTGQIKSGIRRLDREMVERIEINIIVTDAIENPKTGQCTVIIEVLDENDNPPTFIDISGVFNISENLSSYSKVRGRIAATDKDKDEINNKVLFQLQHTFDSQNRRISEPIFKVTESGEILTVKKLDREINHNYTVEIRAFDTGLPMLSAHKNFTIYVEDQNDNDPDWVTP--LSSHGGIHTVNITANSPPGYLIIKLQATDPDYGENSNVTYSVMN-----NNKLLFILNQVTGELRVARL-LPIGQFQLFLRASDNGRPPRHNETSLFIFI---NGDEVATLNMSIII 774          
The following BLAST results are available for this feature:
BLAST of Protocadherin 11 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PCDH93.183e-6329.49protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH94.685e-6329.49protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH94.848e-6329.49protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH95.109e-6329.49protocadherin 9 [Source:HGNC Symbol;Acc:HGNC:8661][more]
PCDH12.142e-5326.83protocadherin 1 [Source:HGNC Symbol;Acc:HGNC:8655][more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fmi-18.432e-3227.64FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-11.110e-2925.43CaDHerin family [Source:UniProtKB/TrEMBL;Acc:Q5F4... [more]
fmi-11.061e-2724.56FlaMIngo (Cadherin plus 7TM domain) homolog [Sour... [more]
cdh-42.871e-2023.25Cadherin-4 [Source:UniProtKB/TrEMBL;Acc:A0A1C3NSI... [more]
hmr-15.236e-1725.24Cadherin-related hmr-1 [Source:UniProtKB/Swiss-Pr... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ft3.635e-4826.76gene:FBgn0001075 transcript:FBtr0077478[more]
ds7.537e-3824.74gene:FBgn0284247 transcript:FBtr0078045[more]
ds7.537e-3824.74gene:FBgn0284247 transcript:FBtr0343249[more]
kug7.203e-3725.85gene:FBgn0261574 transcript:FBtr0346077[more]
kug7.203e-3725.85gene:FBgn0261574 transcript:FBtr0332721[more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh95.010e-6029.05protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh95.010e-6029.05protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh97.657e-6029.05protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
CR847522.11.457e-5928.96pep chromosome:GRCz11:CHR_ALT_CTG6_1_1:4874141:487... [more]
pcdh1a3.815e-5528.77protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vapa3.741e-6429.24VAMP associated protein A [Source:Xenbase;Acc:XB-G... [more]
pcdh174.131e-5927.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.577e-5927.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh174.827e-5927.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
pcdh175.458e-5927.49protocadherin 17 [Source:Xenbase;Acc:XB-GENE-48022... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pcdh95.781e-6229.37protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh91.610e-6129.24protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.361e-6129.12protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.639e-6129.24protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
Pcdh92.639e-6129.24protocadherin 9 [Source:MGI Symbol;Acc:MGI:1306801... [more]
back to top
BLAST of Protocadherin 11 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9HC56|PCDH9_HUMAN2.328e-6229.49Protocadherin-9 OS=Homo sapiens OX=9606 GN=PCDH9 P... [more]
sp|Q08174|PCDH1_HUMAN1.029e-5226.83Protocadherin-1 OS=Homo sapiens OX=9606 GN=PCDH1 P... [more]
sp|Q9BZA8|PC11Y_HUMAN2.600e-4927.73Protocadherin-11 Y-linked OS=Homo sapiens OX=9606 ... [more]
sp|Q6WXV7|PC11X_PONPY2.935e-4927.80Protocadherin-11 X-linked OS=Pongo pygmaeus OX=960... [more]
sp|Q6X862|PC11X_GORGO2.986e-4927.80Protocadherin-11 X-linked OS=Gorilla gorilla goril... [more]
back to top
BLAST of Protocadherin 11 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7DDS93.780e-8527.88Protocadherin-11 Y-linked (Fragment) OS=Clonorchis... [more]
A0A074ZRN87.473e-8528.37Uncharacterized protein OS=Opisthorchis viverrini ... [more]
G7YAD61.129e-8427.88Protocadherin-9 OS=Clonorchis sinensis OX=79923 GN... [more]
A0A4S2LLF47.964e-8428.06Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A074ZL435.500e-8326.91Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh92.170e-6029.05protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh92.392e-6029.05protocadherin 9 [Source:ZFIN;Acc:ZDB-GENE-091015-1... [more]
pcdh1b1.139e-5628.92protocadherin 1b [Source:ZFIN;Acc:ZDB-GENE-091015-... [more]
pcdh1a2.951e-5528.43protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
pcdh1a8.439e-5528.47protocadherin 1a [Source:ZFIN;Acc:ZDB-GENE-091116-... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010725.11.324e-4127.37pep scaffold:Pmarinus_7.0:GL479425:26296:30457:-1 ... [more]
ENSPMAT00000006996.12.482e-3829.42pep scaffold:Pmarinus_7.0:GL476780:2096:143714:1 g... [more]
ENSPMAT00000008517.12.743e-3525.55pep scaffold:Pmarinus_7.0:GL476786:43429:129410:1 ... [more]
pcdh117.694e-3524.60protocadherin 11 [Source:ZFIN;Acc:ZDB-GENE-140106-... [more]
ENSPMAT00000004042.12.840e-3325.49pep scaffold:Pmarinus_7.0:GL479143:9150:31231:-1 g... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protocadherin 11 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354129.831e-4826.39Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO404703.907e-4529.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461892.480e-4227.66Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348153.697e-4026.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303643.119e-3828.52Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protocadherin 11 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pcdh92.172e-6129.93protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh93.290e-6129.93protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh93.305e-6129.93protocadherin 9 [Source:NCBI gene;Acc:101156238][more]
pcdh1b5.387e-5827.76protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
pcdh1b6.331e-5827.76protocadherin-1 [Source:NCBI gene;Acc:101174755][more]
back to top
BLAST of Protocadherin 11 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000051413.10.000e+0100.00SMESG000051413.1[more]
SMESG000051413.10.000e+0100.00SMESG000051413.1[more]
SMESG000051413.10.000e+099.61SMESG000051413.1[more]
SMESG000051413.10.000e+099.21SMESG000051413.1[more]
SMESG000033639.11.159e-13835.45SMESG000033639.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016231 ID=SMED30016231|Name=Protocadherin 11|organism=Schmidtea mediterranea sexual|type=transcript|length=3374bp
ACTGAGATGTCCTAAATTTGCAAGCTTAGTTGATGTGTTGACCGATTTTT
TCACACATATCCAATGTTATCCAGAACAATTTTAGAACATTTTTTCATCG
AATAAAGGAGGAGACACTAAATTAGTCCAGAACTGTATTTTCTAAAACCA
AAATAAATCACATGATGAAAGAACTTGAGGGTAAAATTATATTATTTCAT
TTATTATGTGGATACCTGCCTTCAATTATTAGTTCTCAGGAAATAACATT
CCATTTGGTGGAAGAAAATAAAAGAGGACTAATTCTTGGAAATTTAAACT
ACTTCATCACCAGTAAATTGAAAACGGATCCGAGAATCACAGAATTCCAT
GTGAGTAGTAAATATTTTGAAATCGATAACCAAACAAAGAACGTCCAAAT
GGTCTCGACGATAGATCTTGACACGATTTGTTCCACAGATTCGGAATGTT
GTGACAAAGAGAAATGTGTGATTGAAACAAAAGTTGTCGTTCAGGAATAC
AGCCAATACAAGTCGTCATTTTCTCTGAAAGTCGAAGTGAAAGATCTCGA
CGATAATTTCCCTTTATTTCTAGACGATAAACAAATCATAAAACTATCGG
AAAAGATTTCAATAAACACATCAATTTCAATTGATGGAGCGATGGATAAA
GACTTTTCAAAGATAAATCAAAAGAAAAACTACCAGTTCTTCGACGAGAG
TATGACCTTTCAGCTGTTTGTCTATCAGTATGATCCTGACATTCTGTCGA
TTATGGTGATGCGAAGTTTGAATTATGAATTGAAACAAATCTATTTTTGT
AAGCTTAAGGTCTGCGATAAAACGTATCAGAATTGTGTTAGAAAATCGAT
AATAGTGCAAGTGATCGATGAAAATGATAATGAACCGATTTTTGTAGAGA
AGAAATATTTGGTTAAAATTCCCGAAAGTTATCCGATTGGAAAGAAAATT
CTCAAGGTTACAGCAAAAGACGCGGATAGTTCGTTGTTTAACAAAACCTT
TTACGGATTCCAAAGCAATTATAATGTTAAGTCAATTTTTAATATAGAAA
AAGAAAGTGGAGTGATAAGTCTAAAGCAAAGCCTTTCTATTAATAAAAAA
TCTCGGTATTTATTTACAGTTTATGCGATAGACGCCCTGTCGGTGACATT
CAAAAAAGACTATGCTGATGTCGAGATTGAGATTGAAGATGTGAATGATA
ATTATCCCATCATATCCCTTCTCCATGGATATATGCCGGACCCGTATGCA
ATTAGAATTGATGAAAACACTCCCCCTAAAACATTGTTCTCCATTCATGT
TTCCGATAAAGATACTGGCATAAATGCTGTTGTGAACTGTTCCCTTCGTG
TACGAAGAAAGGATCTCTTAGAGATGATTAAAGCCGACATGGAAATATAT
CAAATCCGTACAATTAGATCTTTTGATTATGAAATCCTTCAATTGATAGA
AGCGGAAATACTGTGCATTGATTCCGGAAGTCCGGCTCTTTTATCGAGAA
AAGCGATTAAAATTATTATAGTCGACGTAAACGAATTTGAACCATCTATA
AGAAATAATTTTGAGGAGTTGTCTTTTAAAGAGAATATACCGGAACATAA
ATTTATCATGAGTATTGACGCCTCGGACAAAGATAAAGGTGCAATTTTGA
GGTACTCACTGGATGAAATAGGAAGGATTTATTTCACGATAAACTCAAGA
ACCGGTGAGATTATTATGTCGAATGTGACTTTGGACAAGGAAATGAACGA
CAGTGTAAAATTCAAGGTCTTCATTACTGACAGTTTGATAAATCCCCATA
CAGCTACAATGTTTGTCACTGTTACAATTCTAGACCAAAATGACAATGCC
CCTCAGTTTGTTCATACATTACCGTTTACCATTCAAGAAGGCTTGTCTTT
TTATTCTAAATTATCAACAAGAATTGAAGCTAAAGACGCGGACAAAGACG
AGATAAATCATTCTATCATTTTTCGATTGCTCCACACGTATAATAACAAA
ATGGAACTACTTCACGAAAAGATTTTTGATGTTAGTTCAAAAGGTGAAAT
TGAAACTGTTGTAACGATAGATCGGGAAAAGGACAGTAATTACACTTTGA
CAATTTTAGCACAAGACAAAGGCAACCCCCCGAAATCAACTTCCACAAAT
ATAACCATAACTGTGATAGACGTGAATGACAACAGTCCTGTTTGGGTTTC
TCCGCCTTCATTGAATTCGTCAGAACCAGAAGCCAGATTTAACATCTCTA
AAGAGGCAGCAATTGGATCTATAGTAGCACAACTAAAAGCACTCGATCAA
GATCAAGATGATTTTGGAAAGATCAGTTATGTAATCATGTCCACTGAGTC
TCATTATCAAGGAGAACAATTCTTAACTTTAAACGAAACGTCTGGAATAT
TAAGCATCCATCAGCATCCATTATCATACGGTAGAACTCTCCTTAAAATA
AGTGCCCATGACCATGGTCATCCTCCATTAAAGAATTATGCTACTTTAAT
AATAAATGTCCAACAACCAAATGACAATCTTTTCAGTGGATTGAACATGG
CGATAATAATCGGAATGCTTTCCATCACTGCCCTTATCTCCATATTCCTT
ATAATTGCTATCTTTTTTATTCGACGTAGCCCAAATCCTCCCAGACATTA
TAGGCATTCTAATCAGAACATCAGAAAAGAGTGTGACAACAACTTGAAAT
CATCCTACAAAGATCTAGTAGATTATAATGATAAAAAAGAATCGGTCTTT
ACGGATAGTGACTGCCATCACGTATATTACCGTAATGGGAATTTAGATTC
CAATCTTGCAATGTATTCTCAATCTCCAGTAGAGGGTGTCTGCCCAACCT
ATGTTCGATTTGCAACCCCGGGCTCATATCTGCATGAAATGGACGGTGAA
AGCGCAGATTCCGGAAAAGGAACTAGTGACCTTGATGTGGCACATCAATC
AACTTCGTCAACAAACCTTTATGGTAGCATTCAGTTGATTCCGTCAAGTC
GGATTAATTATTTCGTTCCCAACAAACCGATTCGGAATTCCTATCAAGTT
ATCAATGAGGGGGAGCAAGCCTATAACCTTGAGACATTTCAACAGCAGTC
ATTTTCTAACACCTTACACAGTCCTGAAACCATTCCGAAGCTATGCTCAT
ATCAAACCTTATCCTTTAACTCTTTACCGCCTTATAATGCATAAATCTGA
TATACATAAAATCTCATTTGCCATTATCTGTAATTTTATAAGCACAAAAA
TCTGGCAGTCAAAAAAAAAGAAAAAAAATTACGGAAATTATTTTTTTTAT
TGATTGAAATTTTTACATAAAAATTCCTTCTGCATTGATTTTATTGTAAA
ATATTGAGCCAATTTGATCTCAAC
back to top

protein sequence of SMED30016231-orf-1

>SMED30016231-orf-1 ID=SMED30016231-orf-1|Name=SMED30016231-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1011bp
MMKELEGKIILFHLLCGYLPSIISSQEITFHLVEENKRGLILGNLNYFIT
SKLKTDPRITEFHVSSKYFEIDNQTKNVQMVSTIDLDTICSTDSECCDKE
KCVIETKVVVQEYSQYKSSFSLKVEVKDLDDNFPLFLDDKQIIKLSEKIS
INTSISIDGAMDKDFSKINQKKNYQFFDESMTFQLFVYQYDPDILSIMVM
RSLNYELKQIYFCKLKVCDKTYQNCVRKSIIVQVIDENDNEPIFVEKKYL
VKIPESYPIGKKILKVTAKDADSSLFNKTFYGFQSNYNVKSIFNIEKESG
VISLKQSLSINKKSRYLFTVYAIDALSVTFKKDYADVEIEIEDVNDNYPI
ISLLHGYMPDPYAIRIDENTPPKTLFSIHVSDKDTGINAVVNCSLRVRRK
DLLEMIKADMEIYQIRTIRSFDYEILQLIEAEILCIDSGSPALLSRKAIK
IIIVDVNEFEPSIRNNFEELSFKENIPEHKFIMSIDASDKDKGAILRYSL
DEIGRIYFTINSRTGEIIMSNVTLDKEMNDSVKFKVFITDSLINPHTATM
FVTVTILDQNDNAPQFVHTLPFTIQEGLSFYSKLSTRIEAKDADKDEINH
SIIFRLLHTYNNKMELLHEKIFDVSSKGEIETVVTIDREKDSNYTLTILA
QDKGNPPKSTSTNITITVIDVNDNSPVWVSPPSLNSSEPEARFNISKEAA
IGSIVAQLKALDQDQDDFGKISYVIMSTESHYQGEQFLTLNETSGILSIH
QHPLSYGRTLLKISAHDHGHPPLKNYATLIINVQQPNDNLFSGLNMAIII
GMLSITALISIFLIIAIFFIRRSPNPPRHYRHSNQNIRKECDNNLKSSYK
DLVDYNDKKESVFTDSDCHHVYYRNGNLDSNLAMYSQSPVEGVCPTYVRF
ATPGSYLHEMDGESADSGKGTSDLDVAHQSTSSTNLYGSIQLIPSSRINY
FVPNKPIRNSYQVINEGEQAYNLETFQQQSFSNTLHSPETIPKLCSYQTL
SFNSLPPYNA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR002126Cadherin-like_dom
IPR020894Cadherin_CS
IPR015919Cadherin-like_sf
Vocabulary: molecular function
TermDefinition
GO:0005509calcium ion binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0007156homophilic cell adhesion via plasma membrane adhesion molecules
GO:0007155cell adhesion
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002126Cadherin-likePRINTSPR00205CADHERINcoord: 626..652
score: 24.86
coord: 545..564
score: 41.49
coord: 244..273
score: 34.94
coord: 67..86
score: 21.1
coord: 660..677
score: 37.64
IPR002126Cadherin-likeSMARTSM00112CA_2coord: 266..349
e-value: 7.5E-11
score: 52.0
coord: 485..564
e-value: 1.1E-16
score: 71.4
coord: 158..242
e-value: 0.02
score: 21.1
coord: 378..461
e-value: 2.7E-7
score: 40.2
coord: 708..791
e-value: 2.0E-6
score: 37.4
coord: 588..676
e-value: 1.1E-19
score: 81.4
IPR002126Cadherin-likePFAMPF00028Cadherincoord: 586..668
e-value: 1.7E-11
score: 44.4
coord: 470..557
e-value: 3.5E-9
score: 37.0
coord: 249..341
e-value: 6.7E-11
score: 42.5
coord: 693..784
e-value: 1.2E-8
score: 35.3
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 27..129
e-value: 4.9E-8
score: 35.0
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 348..459
e-value: 1.7E-15
score: 59.4
coord: 565..678
e-value: 3.4E-20
score: 74.6
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 463..564
e-value: 4.6E-19
score: 70.8
NoneNo IPR availableGENE3DG3DSA:2.60.40.60coord: 131..239
e-value: 1.1E-8
score: 37.4
coord: 240..347
e-value: 2.2E-23
score: 84.9
coord: 680..791
e-value: 8.1E-15
score: 57.2
NoneNo IPR availablePANTHERPTHR24028FAMILY NOT NAMEDcoord: 25..597
coord: 545..790
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 43..136
score: 9.278
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 137..244
score: 13.049
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 245..351
score: 20.196
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 464..566
score: 19.297
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 566..678
score: 23.112
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 358..463
score: 13.334
NoneNo IPR availablePROSITEPS50268CADHERIN_2coord: 687..800
score: 13.093
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 249..347
e-value: 8.92459E-20
score: 83.1317
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 143..240
e-value: 0.00250889
score: 36.1374
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 586..674
e-value: 4.27272E-19
score: 81.2057
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 469..562
e-value: 1.10121E-17
score: 76.9685
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 361..458
e-value: 5.83156E-14
score: 66.5681
NoneNo IPR availableCDDcd11304Cadherin_repeatcoord: 692..789
e-value: 3.76653E-16
score: 72.7313
NoneNo IPR availableTMHMMTMhelixcoord: 798..820
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 666..676
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 339..349
IPR020894Cadherin conserved sitePROSITEPS00232CADHERIN_1coord: 232..242
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 130..244
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 451..572
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 671..783
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 358..455
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 554..680
IPR015919Cadherin-like superfamilySUPERFAMILYSSF49313Cadherin-likecoord: 232..353