TNF receptor-associated factor 4-like

Overview
NameTNF receptor-associated factor 4-like
Smed IDSMED30016228
Length (bp)1506
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor 4-like (SMED30016228) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor 4-like (SMED30016228) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016228

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016228h1SMcG0001981 SmedASXL_010826SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016228h1SMcG0001981 dd_Smed_v4_103782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016228h1SMcG0001981 dd_Smed_v4_103782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016228h1SMcG0001981 dd_Smed_v4_103782_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 151.754 bits (382), Expect = 8.950e-40
Identity = 132/444 (29.73%), Postives = 212/444 (47.75%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRT-CQWRPVTCPR-ECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGEL------NEH----------ENMFCP-EVPIS-----CRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKR-KAIPHLVLMAEALTKNSLTLENSV----QCLLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKV 1496
            E+K+ C  C+ +L +P Q E CGHR C  C  +   +  +P+C    E I +D+VF D   ++E+  L+IYC   +       GC+ Q +LG  + H +  C +  + C R +C   +  +++RDH+ + C+     C+ CK QV +  L      NE            N  C  E+ I       RNN   +  L R ++         L+    PF     +    ++ +E+   R   +  +   A  + +N+  LE+ +    Q L    ++ + ++ R  V E   +   LIWK+  + ++  +A  G T + +S PF++ ++GYK+   +   GDG+ KG  LSLF  I RGEYD LL WPF  KVT  L+DQ    R   D   +F P+    +F    +PTGE N   G   F++  +++E GTY  + TIF KV
Sbjct:   48 EDKYKCEKCHLVLCSPKQTE-CGHRFCESCMAALLSS-SSPKCTACQESIVKDKVFKDNCCKREILALQIYCRNES------RGCAEQLMLGHLLVHLKNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQVSLLQNESVEKNKSIQSLHNQICSFEIEIERQKEMLRNNESKILHLQR-VIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMDQGSSRRHLGD---AFKPDPNSSSFK---KPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKV 475          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Match: TRAF4 (TNF receptor associated factor 4 [Source:HGNC Symbol;Acc:HGNC:12034])

HSP 1 Score: 147.902 bits (372), Expect = 1.486e-38
Identity = 126/485 (25.98%), Postives = 206/485 (42.47%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSW-------QGVL----------------------------------------------GE-FIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ--LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTG---ERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + + +C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   + ++  L I C  +      +EGC W       QG L                                              GE +  H   C    V C  +CG  +  + +  H   +C    + C +C  + +   +  H+   CP +P++C N CG V T+ R+ +  H  + C      CPF   GCK +  +  +  H++    PHL +M   +++    L+                E R  + E   GS   LIWK+  + ++  +AK+      FSP F++  YGYKL +     G+G  +G  LSL++ +  G +DNLL+WPF  +VTFSLLDQ+ P   K + V  +F P+    NF   G   G   E +  FG  KFIS   + +   Y  +  +F +  ++
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHS------EEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQ-CPRLPVACPNQCG-VGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQ----------------ELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRAAVE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 143.28 bits (360), Expect = 2.571e-36
Identity = 89/277 (32.13%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG--IVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEA----------LTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWG 1046
            EE++ C  C+++LHNP Q   CGHR C  C  S RE    P CP D E+I    VF D   ++E+ NL +YC  NA       GC+ + +LG + DH + C ++PV C  E C   +  +++++H++  C+    +C +CK  V+V  L  HE   CPE P+ C NNC   I+KT   + + +     CP   ++CPF  +GC +      ++ H       H+ L+ E           L K+    E+ +Q L +   K   LE     F +L+G
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCS-NA------PGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAV-----CPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKK---LEKEFKQFAQLFG 300          

HSP 2 Score: 89.3521 bits (220), Expect = 3.007e-18
Identity = 62/173 (35.84%), Postives = 92/173 (53.18%), Query Frame = 3
Query:  990 KLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEY-GTYTLNQTIFFKVDI 1502
            K + S  E R  + E   +  +LIWKV  +  K  +A  G T + FS  F++S  GY+L       GDG  +G  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+     +K+++ +F P+    +F    RP GE N   G  +F++ S L      Y  + T+F KV +
Sbjct:  384 KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG----KKNIMETFKPDPNSSSFK---RPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 143.28 bits (360), Expect = 2.571e-36
Identity = 89/277 (32.13%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG--IVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEA----------LTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWG 1046
            EE++ C  C+++LHNP Q   CGHR C  C  S RE    P CP D E+I    VF D   ++E+ NL +YC  NA       GC+ + +LG + DH + C ++PV C  E C   +  +++++H++  C+    +C +CK  V+V  L  HE   CPE P+ C NNC   I+KT   + + +     CP   ++CPF  +GC +      ++ H       H+ L+ E           L K+    E+ +Q L +   K   LE     F +L+G
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCS-NA------PGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAV-----CPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKK---LEKEFKQFAQLFG 300          

HSP 2 Score: 89.3521 bits (220), Expect = 3.007e-18
Identity = 62/173 (35.84%), Postives = 92/173 (53.18%), Query Frame = 3
Query:  990 KLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEY-GTYTLNQTIFFKVDI 1502
            K + S  E R  + E   +  +LIWKV  +  K  +A  G T + FS  F++S  GY+L       GDG  +G  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+     +K+++ +F P+    +F    RP GE N   G  +F++ S L      Y  + T+F KV +
Sbjct:  384 KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG----KKNIMETFKPDPNSSSFK---RPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Match: TRAF5 (TNF receptor associated factor 5 [Source:HGNC Symbol;Acc:HGNC:12035])

HSP 1 Score: 143.28 bits (360), Expect = 2.571e-36
Identity = 89/277 (32.13%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG--IVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEA----------LTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWG 1046
            EE++ C  C+++LHNP Q   CGHR C  C  S RE    P CP D E+I    VF D   ++E+ NL +YC  NA       GC+ + +LG + DH + C ++PV C  E C   +  +++++H++  C+    +C +CK  V+V  L  HE   CPE P+ C NNC   I+KT   + + +     CP   ++CPF  +GC +      ++ H       H+ L+ E           L K+    E+ +Q L +   K   LE     F +L+G
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCS-NA------PGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAV-----CPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKK---LEKEFKQFAQLFG 300          

HSP 2 Score: 89.3521 bits (220), Expect = 3.007e-18
Identity = 62/173 (35.84%), Postives = 92/173 (53.18%), Query Frame = 3
Query:  990 KLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEY-GTYTLNQTIFFKVDI 1502
            K + S  E R  + E   +  +LIWKV  +  K  +A  G T + FS  F++S  GY+L       GDG  +G  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+     +K+++ +F P+    +F    RP GE N   G  +F++ S L      Y  + T+F KV +
Sbjct:  384 KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG----KKNIMETFKPDPNSSSFK---RPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 200.675 bits (509), Expect = 1.958e-58
Identity = 132/411 (32.12%), Postives = 199/411 (48.42%), Query Frame = 3
Query:  270 CYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            C +C   L +P++L  C H  C +C+ +   T   P C     II  +    D   QK++  L + C      +    GC W G LG   DH   C ++      +CG      ++  H   KC L    C+FC   +   +   H    CP+V ISC   CG+    PR  +  H  + CP     CPF  +GC   G +  I+ HL  + + HL+ + + +T    T E   + +     + + + S       ++G QLIWK+++  Q+ ++AKSG  TT FS PF S  +GYK+    C FGDG + GK +SL+V + +GE+D  L+WPF   +  SLLDQ P    R ++ Y   P  +K N  FL RP GERN  FG++ F SL+ L     Y  +  I+ ++D+
Sbjct:   18 CPICEQALRDPIKLN-CDHHYCRQCFENENRT---PGCAACQTIIQPELCQHDRAKQKQILALPVVC------TFESSGCPWDGQLGTLHDHLSECTFKSSLKCEKCGRQFAKNDLEKH-RAKCELNRAVCSFCNKTIRDSDRERHPKT-CPQVIISCPFQCGLTDR-PRLEIEAHCPS-CPNVDNVCPFVPYGCTFAGGKESIQQHLSDEPVRHLMYLCDEITDLKGTYELMERDMGSFNDRQTRILSAAETCTEMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQ---NYVKDDKIYVQIDV 411          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 103.99 bits (258), Expect = 2.936e-24
Identity = 68/247 (27.53%), Postives = 121/247 (48.99%), Query Frame = 3
Query:  792 IHQNNQCPLEPR--------NCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKC-SALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXH-YGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            IH   + P  P+        +CPF   GC  +G  +E++ H++     HLVL+ ++L      +       +D+ +     +    + FE+ +GSQ  +++ +       A    +        F SH YGYK+     P+GDG+A  ++ S+FVC+ +GE+D++L+WPF   VTFS+L    +    K +  + +P + +    FL RP G RN  FG + F+ L+ + E+     +  IF ++ +
Sbjct:   65 IHVEGEEPTAPKSIVPDNWIDCPFKEHGCHKKGENSEVKRHVRDDRNLHLVLLCQSLNPIRTKINIQQSAYVDKYVGMLQYMSIAESAFEK-YGSQHTFRIPKIGLTVVKATKNKSHRSIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILSDDKKELLTKTIYVNEMPEIQE----FLERPEGLRNGTFGFQNFLPLAKVTEFAA---DGDIFIQIKV 303          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0334401)

HSP 1 Score: 129.028 bits (323), Expect = 3.830e-32
Identity = 101/391 (25.83%), Postives = 162/391 (41.43%), Query Frame = 3
Query:  498 KEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNN--------------------------QCPLEPRNCP-----------------------------FNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF-FGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            K+GC W   L +   H   C+     CP +CG  I    + DH+   C +   +C FC+ +     L EH N  C + P+ C   CG  + + R  M +H++                           QCP  P  CP                             F   GC+ +G    +E HL+  A  HL LM    ++    ++               L+S ++     +   L+WK+  +S K ++A+        SPPF++S YGYKL   +   G+G  +   +S+++ +  GEYD LL+WPF   +TF+L +Q  +   +  V  SFVP+   +NF    RP+ E +   FG  +FIS   L+    +    T+F +V +
Sbjct:  101 KQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEH-NGSCGQEPVYCEAKCG--QRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQ--------------MLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ-SGQGGVAESFVPDPTWENF---QRPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 469          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Match: Traf4 (gene:FBgn0026319 transcript:FBtr0077429)

HSP 1 Score: 129.028 bits (323), Expect = 4.778e-32
Identity = 101/391 (25.83%), Postives = 162/391 (41.43%), Query Frame = 3
Query:  498 KEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNN--------------------------QCPLEPRNCP-----------------------------FNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF-FGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            K+GC W   L +   H   C+     CP +CG  I    + DH+   C +   +C FC+ +     L EH N  C + P+ C   CG  + + R  M +H++                           QCP  P  CP                             F   GC+ +G    +E HL+  A  HL LM    ++    ++               L+S ++     +   L+WK+  +S K ++A+        SPPF++S YGYKL   +   G+G  +   +S+++ +  GEYD LL+WPF   +TF+L +Q  +   +  V  SFVP+   +NF    RP+ E +   FG  +FIS   L+    +    T+F +V +
Sbjct:  110 KQGCKWSDELRKLKGHLNACKHDATQCPNKCGAQIPRIMMTDHLQYTCTMRRTRCEFCQSEFSGAGLEEH-NGSCGQEPVYCEAKCG--QRILRGRMTLHKSKDCAKRLRRCAHCQREFSADTLPLHAAQCPRAPLACPQRCDAGPIPRGELEAHLRDECQSLAVSCSFKEAGCRFKGPRQMLEAHLESNAAAHLSLMVALSSRQGQQIQ--------------MLKSAVSKLSINYTGTLLWKITDWSAKMAEARGKDGLELVSPPFYTSQYGYKLQASMFLNGNGPGENTHVSVYIKVLPGEYDALLKWPFSHSITFTLFEQGAQ-SGQGGVAESFVPDPTWENFQ---RPSNEPDQLGFGFPRFIS-HELLHSRPFIKGDTVFLRVKV 478          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 66.6254 bits (161), Expect = 1.947e-11
Identity = 88/427 (20.61%), Postives = 174/427 (40.75%), Query Frame = 3
Query:  246 GENEEKFI-----CYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIIN-EDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKL--ALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            GE EE+ +     C +C   L+ PV L  CGHR C  C  ++ + K+   CP DN+ ++ E  +F D   ++E++ LK  CP +++      GCS      E   H  +C +R    P+E               +KC     +C+F    V   E N+ E     ++P   +      +         H+ +       N              N ++  + +     +V++ +   +    LEN     + ++L+ +  ++   V  R     ++W++E+     +  ++      +S   ++S +GYK    L + P      K   LSL V + + E D  L WPF  ++   ++  A     + D + +  P ++  + P     T      FG  ++ ++S++++ G +  +  +  K++I
Sbjct:   91 GEQEEELLDSRYECAICIDWLNEPV-LTSCGHRFCRSCLTAWMQ-KNNQCCPMDNKRLSAEHDIFPDNYTRREIEQLKRDCPNSSL------GCSVVASPIELHRHLPSCPYRRQQEPQE---------------EKCPFAKIKCDF----VGRPETNQLEEHLKADMPHHMQLMLQAFQQTAIATWQPHKPSTSGAAVENGHGQQQLPPPPQYANGVDEQIVQTMYQRIVVLEQRTREQETRLEN-----MQKQLRLARQQA--PVDPRYSNGTIVWRIEQLGALVARLRANANNQVYSHECYTSPHGYKFCARLNIQP-----RKPHVLSLHVHLMQSENDYHLDWPFKGRIKLCMVHPADATLSQHDTIMT-KPEILAFHKPREAISTR----GFGFLEYANISNIIQLG-FCADDRLLIKIEI 472          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Match: CG9014 (gene:FBgn0028847 transcript:FBtr0343664)

HSP 1 Score: 54.299 bits (129), Expect = 1.230e-7
Identity = 37/132 (28.03%), Postives = 55/132 (41.67%), Query Frame = 3
Query:  243 LGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNE-IINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRP---VTCPRECGYFIEFQNIRDH 626
            +G  +E+ IC +C  +L  PVQ  EC H  C  C + +   K    CP D   ++    V +    +  L  LKI C      +  + GC+    L EF  H   C+  P   V C + CG  +    +  H
Sbjct:    9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI--CPVDRSGLLTSHLVPVSRLMRNMLSRLKIKC------TFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH 132          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Match: CG9014 (gene:FBgn0028847 transcript:FBtr0080579)

HSP 1 Score: 54.299 bits (129), Expect = 1.230e-7
Identity = 37/132 (28.03%), Postives = 55/132 (41.67%), Query Frame = 3
Query:  243 LGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNE-IINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRP---VTCPRECGYFIEFQNIRDH 626
            +G  +E+ IC +C  +L  PVQ  EC H  C  C + +   K    CP D   ++    V +    +  L  LKI C      +  + GC+    L EF  H   C+  P   V C + CG  +    +  H
Sbjct:    9 VGHVDEELICPICTDVLEEPVQSSECEHAFCRACIDKWMIQKQI--CPVDRSGLLTSHLVPVSRLMRNMLSRLKIKC------TFSQSGCAQMLALEEFRTHVAACEHNPKVVVECSKGCGMKVPKDEMSRH 132          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 168.318 bits (425), Expect = 4.189e-46
Identity = 145/480 (30.21%), Postives = 220/480 (45.83%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIH------------------------QNNQ--CPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVL--------------MA-----EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   ++++  L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ +H+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H                        QN+Q  CP  P  CP N  G      E+ + NH+K      LVL              MA     E  TK+ LT+     C L  + +   LE R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P   RN        FG  KFIS   + +   Y  + +IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHS------EEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSE-FTGEAYENHQGICPQESVYCENKCGA--RMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCP-NQCGTPNIARED-LANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTM----MCSLVGRQRQEILELRREM-EELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Match: traf4a (tnf receptor-associated factor 4a [Source:ZFIN;Acc:ZDB-GENE-040308-1])

HSP 1 Score: 168.318 bits (425), Expect = 4.189e-46
Identity = 145/480 (30.21%), Postives = 220/480 (45.83%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIH------------------------QNNQ--CPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVL--------------MA-----EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   ++++  L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ +H+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H                        QN+Q  CP  P  CP N  G      E+ + NH+K      LVL              MA     E  TK+ LT+     C L  + +   LE R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P   RN        FG  KFIS   + +   Y  + +IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHS------EEGCRWTGQMKQLQSHFSTCAFNVIPCPNRCSVKLTRRDLPEHLQHDCPKRKVKCEFCGSE-FTGEAYENHQGICPQESVYCENKCGA--RMMRRLLSQHTMTECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCP-NQCGTPNIARED-LANHVKESCGSALVLCPFKEAGCKHRCPKMAIGRHLEESTKSHLTM----MCSLVGRQRQEILELRREM-EELSVSHDGVLIWKLTDYSRKLQEAKLRNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSSRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNSIFLKASIE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Match: traf4b (tnf receptor-associated factor 4b [Source:ZFIN;Acc:ZDB-GENE-040305-2])

HSP 1 Score: 150.984 bits (380), Expect = 7.999e-40
Identity = 135/493 (27.38%), Postives = 203/493 (41.18%), Query Frame = 3
Query:  231 VDFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG------------IVKTLPRKL------------MLIHQNNQCPLEPRNCP-----------------------------FNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXX--XXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFP-----FLGRPTG----ERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            +D K  E    KF C LC   +  PVQ+  CGHR C  C   Y  ++    CP+D   ++  ++F D   ++++ +L I C  +      +EGC W         H   C++  V+CP  C   +  + + +H+   C      C+ C  Q   GE  E+    CPE  + C N CG            + + L RKL             + +   QCP  P  CP                             F   GCK +  +  +  HL+  A  HL L+   + +  L L +                      E L GS+   L+WK+  FSQ+  +AK+  +     FSP F+S +YGY+L +     G+G  +   +S+++ +  GEYD LL+WPFP +V+FSLLDQ  P   K + +  +F P+    NF       LG   G    E    FG  KFIS    M+   Y  +  +F K  I
Sbjct:    4 LDLKFLERPRRKFYCPLCEKPMREPVQVSTCGHRFCDTCLQEYL-SEGVFTCPEDQLPLDYAKIFPDLELEQQILSLPIRCIHS------EEGCRWTAQNKLLQAHLSVCEFNVVSCPNRCSVKLLRRELPEHLQHDCAKRKLHCDHCGEQ-FTGEAYENHQGVCPEESVYCENKCGARMVRRLLAQHSVSECLKRKLPCRYCKKEFLYDTIQNHQQQCPRFPMQCPNRCGTPGITRDTLMAHVKEGCSTAMVLCPFKEAGCKHRSPKTGVARHLEEAAPTHLSLLCGLVNRQRLELRDLR-----------------RRMEELSGSRDGTLLWKLTDFSQRLQEAKTRTSGCLELFSPAFYSHNYGYRLQVSAFLNGNGSGEDTHMSVYLRVLPGEYDGLLEWPFPYRVSFSLLDQCDPALTKPQHITETFSPDPTWKNFQRPRPGALGSIRGGCLDESMLGFGYPKFISHEE-MKKRNYIRDNAVFIKASI 470          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 130.954 bits (328), Expect = 3.618e-32
Identity = 83/264 (31.44%), Postives = 129/264 (48.86%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCP-RECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLW 1043
            E K+ C  C  +L NP Q E CGHR C  C N    +K  P CP D   + ED++F D    +E+  LK+YC       + K GC  Q  L + ++H   C +  V CP  +C   +  +++ +H+++KC+     C FC +++ + EL +H+   CP  P++C N+C     L R  +  HQ++ CP     C F  +GC  +G   E+  H    A  HL +MA   T     +E+    L++      +L SRL   ER +
Sbjct:   51 EPKYCCETCRLVLCNPRQTE-CGHRFCESCINELL-SKPNPVCPADLLPLFEDKIFRDVCCNREIMALKVYC------RSEKNGCKEQMCLQQVMEHLVICPYFEVPCPLGKCKEKMMRKDMPEHLSRKCKHREVTCEFCSLKMALTELQKHKETVCPAFPVACPNHCSFSSIL-RSELSSHQHD-CPKAQVTCSFIRYGCSYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQY 304          

HSP 2 Score: 103.219 bits (256), Expect = 6.175e-23
Identity = 69/191 (36.13%), Postives = 106/191 (55.50%), Query Frame = 3
Query:  933 ALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            A  +  LT  + +  + D +L  + ++ +L V E   +   LIWK+  + ++  +A    T + +S PF++ ++GYK+   +   GDG+ KG  LSLF  + RGEYD LLQWPF  KVT  L+DQ P    RK +  +F P+    +F    RPTGE N   G   F++  +++E GTY  + TIF KV +
Sbjct:  384 ASLEQQLTRHDDLMSVHDVRL--AEMDLKLQVLETASFNGTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLMDQGP---ARKHLGDAFKPDPSSSSF---RRPTGEMNIASGCPLFVA-QTVLENGTYIKDDTIFIKVTV 565          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 116.701 bits (291), Expect = 1.890e-27
Identity = 127/465 (27.31%), Postives = 192/465 (41.29%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCW-NSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEAL---TKNSLTLE------------------NSVQC---LLDEKLKCSALESRL---------------------TVFER-----------LWGSQL----IWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAK-GKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNP-FFGARKFISLSSLMEYG 1460
            E K+ C +C   L + VQ   CGHR C  C   S R+T    +CP DNE++ E+++F D   ++E+ +L + C           GCS +  L +   H   C++    CP +C   +   ++ +H +Q C      C  C    +      HE  FCP     C   C +   L R  + +H +  C   P  C F+ FGC+ +   NE+  H++     H+  MAE L   T N+ T+                   +S QC   LL+ +     LE RL                     T   R           L   Q     +W+VE FS    + ++G      SPPF++   GYKL L L        +   F+SLFV   +GE+D+ L WP    +  ++LDQ  E +   +V+ +      K +     RPT  RNP  FG   F+ L +L + G
Sbjct:   66 ESKYECPICLMGLRSAVQTP-CGHRFCDSCIRKSIRDT--GQKCPVDNEVLLEEQLFPDNFAKREILSLTVKCSNF--------GCSEKMELRQLEKHLSQCRFATAPCP-QCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQ-FCPFANTVC-EYCEM--ELIRDQLALHCDTDCLKAPVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRLVRQDQQIRELCIHNDTQKNQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQV-EGQHHIEVMET------KPDLQAFQRPTVMRNPKGFGYVTFLHLQALRQRG 507          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Match: sytl2 (synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-945155])

HSP 1 Score: 166.777 bits (421), Expect = 2.005e-45
Identity = 135/488 (27.66%), Postives = 209/488 (42.83%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVL-----------------------------------------------------GE-FIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ--LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E    KF+C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   + ++  L I C  +      +EGC W G L                                                     GE + DH   C    V C  +CG  +  + +  H   +C    + C +C  + +   +  H+   CP  P  C N CGI  ++ R+ +  H  + C      CPF   GCK +G +  I  HL+     HL +M+  +++    +                LE R  V E    S+  LIWK+  +S+K  +AK       FSPPF++  YGYKL +     G+G  +G +LS+++ +  GEYDNLL+WPF  +VTFSLLDQ+ P   K + +  +F P+    NF    +PTG RN        FG  KFIS   + +   Y  +  IF +  ++
Sbjct:    5 DYKFLEKLRRKFLCPLCGKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDRDLETQVMGLSIRCIHS------EEGCRWSGQLKQLQPHLNICAFNVIPCPNRCSTKLIRRDLPEHMQHDCPKRKVRCEFCGADFTGEAYEDHQGCCPQESVYCENKCGARMMRRVLSQHSLVECPKRTQPCPYCNKEFVFDTIQSHQYQ-CPRYPTPCPNQCGIA-SIAREDLSNHLKDSCSSALVLCPFKDSGCKHRGPKITISRHLEENMRAHLSMMSSLVSRQRQEI----------------LELRKQVEELSVSSEGVLIWKISDYSRKVQEAKVRGNFESFSPPFYTHKYGYKLQVSAFLNGNGSGEGSYLSVYIRVLPGEYDNLLEWPFSYRVTFSLLDQSDPSLSKPQHITETFNPDPNWKNF---QKPTGSRNSLDESTLGFGYPKFISHEDIRKR-NYVRDNAIFLRASVE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 127.102 bits (318), Expect = 9.250e-31
Identity = 77/228 (33.77%), Postives = 120/228 (52.63%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRT-CQWRPVTCPR-ECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAE 932
            EEK+ C  C  +L NP Q E CGHR C  C N+   +  +PQC    + I +D+VF D   ++E+  L+++C           GC     LG  + H ++ CQ+  ++CPR +C   +  +++ DHI + C+     C FC+ QV + E+ +HE++ CP V ISC + C  VK+L R  +  H   +C   P  C F  +GC  +G   +I+ H    A+ H+ LM E
Sbjct:   43 EEKYKCEKCRLVLCNPRQTE-CGHRFCETCMNAILSST-SPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNET------RGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCS-VKSLLRSELNAHL-LECVNAPSTCSFKRYGCTFKGTNQQIKAHEASSAVQHVNLMKE 260          

HSP 2 Score: 101.679 bits (252), Expect = 2.573e-22
Identity = 70/198 (35.35%), Postives = 105/198 (53.03%), Query Frame = 3
Query:  918 VLMAEALTKNSLTLENSV----QCLLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKV 1496
            V+   A + N   LE  +    Q L    ++ + ++ R  V E   +   LIWK+  + ++  +A  G T + +S PF++ ++GYK+   +   GDG+ KG  LSLF  I RGEYD LL WPF  KV+  L+DQ P  R   D   +F P+    +F    +PTGE N   G   F++  +++E GTY  + TIF KV
Sbjct:  361 VMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD---AFKPDPNSSSFK---KPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKV 551          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 122.865 bits (307), Expect = 9.665e-30
Identity = 127/466 (27.25%), Postives = 189/466 (40.56%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSY-----RETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENE-IENHLKRKA--------------IPHLVLMAEALTKNSLTLENSVQCL--------------------LDEKLKCSALESRLTVFE---RLWGSQL-------IWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E K++C  C  +L  P+Q  +CGHR CS C N       R     P+CP                                    + E   W G L   + H   C +    CP  C   I   N   H  ++C      C +CK+     ++  H+ + CP+ P++C   CG  K +PR+ + +     C      C   +   K   +EN+ +  HL + +              +  ++L  + L K + T EN V  L                     D +L+ +  +  L V E   R+  S+L       IWK+  F +K  DA +G     FSPPF+++ YGYK+ L +   GDG  +   LSLF  + +G  D LL+WPF  KVT  LLDQ      R+ V+ +F P+V   +F    RP  E N   G   F  +S L    +Y  + TIF KV +
Sbjct:   32 EVKYLCSDCKNLLRRPLQ-AQCGHRYCSHCLNKIIRWVARNWGGVPECP-----------------------------------AVCERSDWTGALIS-VGHEGKCPYLLAPCP-ACKTIIRAANRDLHSERECPERKLNCRYCKLSFYFPDIKAHDEI-CPKFPMTC-EGCG-RKKIPREKVRLFVCMPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKGSPAPPANAPPNNSAKVAEMLLKFDTLDKKNTTFENIVSVLNREVERSSHAAEELARQLRAADTRLERTLGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVSSSSFQ---RPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 449          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 119.398 bits (298), Expect = 2.790e-28
Identity = 137/496 (27.62%), Postives = 210/496 (42.34%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKE--------------------LDNLKIYCP---QNAVLSTLKEGCSWQGVLGEFIDHY-RTCQWRP---------------------------VTCPRECGYFIEF------QNIRDH----INQKCRLTWRQCNF--CKIQVIVGELNE--------HENMFCPEVPI-----SCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAE-ALTKNSLTLENSV----QCLLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKV 1496
            EEK+ C  C  +L NP Q E CGHR C  C N+   +  +PQC    + I +D+VF D   ++E                    L NL I+     Q   LS  +  C  + +  +  DH  +TC++R                            ++CP  C            Q I+ H      Q   L     N+   K+ ++  E +E        H  M   E+ I       RNN   +  L R ++    +    L+         G +  G ++  E+   R  +  L +MA+ A + N   LE  +    Q L    ++ + ++ R  V E   +   LIWK+  + ++  +A  G T + +S PF++ ++GYK+   +   GDG+ KG  LSLF  I RGEYD LL WPF  KV+  L+DQ P  R   D   +F P+    +F    +PTGE N   G   F++  +++E GTY  + TIF KV
Sbjct:   43 EEKYKCEKCRLVLCNPRQTE-CGHRFCETCMNAILSST-SPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLKSDCQFEELSCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQILHNQMCSFEIEIERHKEQLRNNEARIIQLQR-VIEGQADKLKDLDKEIRNLRQTGDEADGMKSNYESLQNR--LSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYNGVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGD---AFKPDPNSSSFK---KPTGEMNIASGCPVFVA-QTVLENGTYIKDDTIFIKV 526          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 92.8189 bits (229), Expect = 1.667e-19
Identity = 71/192 (36.98%), Postives = 99/192 (51.56%), Query Frame = 3
Query:  930 EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFE-RLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            EALT     LE +   L  ++L  + LE+R+   E   +    IWK+  F +K  DA +G     FSPPF+++ YGYK+ L +   GDG  +   LSLF  + +G  D LL+WPF  KVT  LLDQ      R+ V+ +F P+V   +F    RP  E N   G   F  +S L    +Y  + TIF KV +
Sbjct:  295 EALTTKVRQLERT---LGQKELIVAELETRMQESELSTYDGVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVSSSSFQ---RPISEMNIASGCPLFCQVSKLEGKNSYVRDDTIFVKVIV 476          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 158.303 bits (399), Expect = 7.893e-42
Identity = 90/260 (34.62%), Postives = 140/260 (53.85%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCL---LDEKLKCSALESRL 1022
            EE++ C  C+++LHNP Q   CGHR C +C  S RE    P CP D E+I    VF D   ++E+ NL +YC +NA       GC+ + +LG F DH + C ++ V CP E C   +  +++++H++  CR    +C +CK  ++V  L +HE   CP  P+SC N C  V+T+PR  +  H    CP   ++CPF  +GC ++G    +  H +     H++L+ E     +  LE  V  L   L+ K K +A +S +
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYC-KNA------PGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRC--VQTIPRARVNEHL-TVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLE----KNYQLEQRVNALLSSLERKKKMAAADSAI 284          

HSP 2 Score: 88.9669 bits (219), Expect = 2.886e-18
Identity = 61/155 (39.35%), Postives = 86/155 (55.48%), Query Frame = 3
Query: 1041 WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLM-EYGTYTLNQTIFFKVDI 1502
            +  +LIWKV  +  K  +A  G T + FS PF++S  GY+L       GDG  KG  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+    K+  +V +F  +    +F    RP GE N   G  +F+S S+L     TY  + T+F KV +
Sbjct:  396 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG---KKNHIVETFKADPNSSSFK---RPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Match: Traf5 (TNF receptor-associated factor 5 [Source:MGI Symbol;Acc:MGI:107548])

HSP 1 Score: 158.303 bits (399), Expect = 7.893e-42
Identity = 90/260 (34.62%), Postives = 140/260 (53.85%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCL---LDEKLKCSALESRL 1022
            EE++ C  C+++LHNP Q   CGHR C +C  S RE    P CP D E+I    VF D   ++E+ NL +YC +NA       GC+ + +LG F DH + C ++ V CP E C   +  +++++H++  CR    +C +CK  ++V  L +HE   CP  P+SC N C  V+T+PR  +  H    CP   ++CPF  +GC ++G    +  H +     H++L+ E     +  LE  V  L   L+ K K +A +S +
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYC-KNA------PGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRC--VQTIPRARVNEHL-TVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLE----KNYQLEQRVNALLSSLERKKKMAAADSAI 284          

HSP 2 Score: 88.9669 bits (219), Expect = 2.886e-18
Identity = 61/155 (39.35%), Postives = 86/155 (55.48%), Query Frame = 3
Query: 1041 WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLM-EYGTYTLNQTIFFKVDI 1502
            +  +LIWKV  +  K  +A  G T + FS PF++S  GY+L       GDG  KG  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+    K+  +V +F  +    +F    RP GE N   G  +F+S S+L     TY  + T+F KV +
Sbjct:  396 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG---KKNHIVETFKADPNSSSFK---RPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 544          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Match: Traf4 (TNF receptor associated factor 4 [Source:MGI Symbol;Acc:MGI:1202880])

HSP 1 Score: 154.066 bits (388), Expect = 5.950e-41
Identity = 125/485 (25.77%), Postives = 205/485 (42.27%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPV-----------------------------------------------TCPRE-------CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ--LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTG---ERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + + +C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   + ++  L I C  +      +EGC W G L     H  TC +  V                                                CP+E       CG  +  + +  H   +C    + C +C  + +   +  H+   CP +P+ C N CG V T+ R+ +  H  + C      CPF   GCK +  +  +  H++    PHL +M   +++    L+                E R  + E   GS   LIWK+  + ++  +AK+      FSP F++  YGYKL +     G+G  +G  LS+++ +  G +DNLL+WPF  +VTFSLLDQ+ P   K + V  +F P+    NF   G   G   E +  FG  KFIS   + +   Y  +  +F +  ++
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHS------EEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQ-CPRLPVPCPNQCG-VGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQ----------------ELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRASVE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 137.117 bits (344), Expect = 1.097e-34
Identity = 139/512 (27.15%), Postives = 211/512 (41.21%), Query Frame = 3
Query:  192 TAPSDWYKLRIKMVDFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRET--KDAPQCPKDN------EIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFID-HYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGC-KIQGNENEIENHLKR-----------------------KAIPHLVLMAEALTKNSLTLENSVQCLLDEKL-------------------KCSALESRLTVFERLWG-------------SQL---------IWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            T+P     L+       LG   E K++C  C  IL  P Q  +CGHR CS C  S   +  ++   C  +        I+     F D   ++E+++L   CP +        GC+W+G L E+   H   C +    CP  C   +       H  Q+C      C  C+      +L  H  + CP+ P++C + CG  K +PR+    H    C      C F+  GC ++   EN  ++ L+R                       +  P L+   + L +   T EN V C+L+ ++                   K  AL +++   ER  G             S+L         IWK+  F++K  +A +G T   FSP F++S YGYK+ L +   GDG  +G  LSLF  + +G  D LLQWPF  KVT  LLD       R+ V+ +F P+V   +F    RP  + N   G   F  +S +    +Y  +  IF K  +
Sbjct:    7 TSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQ-AQCGHRYCSFCLTSILSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPND--------GCTWKGTLKEYESCHEGLCPFLLTECP-ACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEV-CPKFPLTC-DGCG-KKKIPRETFQDHVR-ACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIV-CVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH----NNREHVIDAFRPDVTSSSFQ---RPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Match: Traf2 (TNF receptor-associated factor 2 [Source:MGI Symbol;Acc:MGI:101835])

HSP 1 Score: 135.191 bits (339), Expect = 7.008e-34
Identity = 141/519 (27.17%), Postives = 211/519 (40.66%), Query Frame = 3
Query:  192 TAPSDWYKLRIKMVDFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRE-----TKDAPQ----CPKDN------EIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFID-HYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGC-KIQGNENEIENHLKR-----------------------KAIPHLVLMAEALTKNSLTLENSVQCLLDEKL-------------------KCSALESRLTVFERLWG-------------SQL---------IWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            T+P     L+       LG   E K++C  C  IL  P Q  +CGHR CS C  S        +   PQ    C  +        I+     F D   ++E+++L   CP +        GC+W+G L E+   H   C +    CP  C   +       H  Q+C      C  C+      +L  H  + CP+ P++C + CG  K +PR+    H    C      C F+  GC ++   EN  ++ L+R                       +  P L+   + L +   T EN V C+L+ ++                   K  AL +++   ER  G             S+L         IWK+  F++K  +A +G T   FSP F++S YGYK+ L +   GDG  +G  LSLF  + +G  D LLQWPF  KVT  LLD       R+ V+ +F P+V   +F    RP  + N   G   F  +S +    +Y  +  IF K  +
Sbjct:    7 TSPGSLELLQPGFSKTLLGTRLEAKYLCSACKNILRRPFQ-AQCGHRYCSFCLTSILRCASILSSSGPQNCAACVYEGLYEEGISILESSSAFPDNAARREVESLPAVCPND--------GCTWKGTLKEYESCHEGLCPFLLTECP-ACKGLVRLSEKEHHTEQECPKRSLSCQHCRAPCSHVDLEVHYEV-CPKFPLTC-DGCG-KKKIPRETFQDHVR-ACSKCRVLCRFHTVGCSEMVETENLQDHELQRLREHLALLLSSFLEAQASPGTLNQVGPELLQRCQILEQKIATFENIV-CVLNREVERVAVTAEACSRQHRLDQDKIEALSNKVQQLERSIGLKDLAMADLEQKVSELEVSTYDGVFIWKISDFTRKRQEAVAGRTPAIFSPAFYTSRYGYKMCLRVYLNGDGTGRGTHLSLFFVVMKGPNDALLQWPFNQKVTLMLLDH----NNREHVIDAFRPDVTSSSFQ---RPVSDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 503          
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Match: sp|P70191|TRAF5_MOUSE (TNF receptor-associated factor 5 OS=Mus musculus OX=10090 GN=Traf5 PE=1 SV=1)

HSP 1 Score: 157.918 bits (398), Expect = 6.796e-41
Identity = 90/279 (32.26%), Postives = 147/279 (52.69%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKF 1088
            EE++ C  C+++LHNP Q   CGHR C +C  S RE    P CP D E+I    VF D   ++E+ NL +YC +NA       GC+ + +LG F DH + C ++ V CP E C   +  +++++H++  CR    +C +CK  ++V  L +HE   CP  P+SC N C  V+T+PR  +  H    CP   ++CPF  +GC ++G    +  H +     H++L+ E   +    + +  Q L  ++ K   L   +  FE+        ++++F+Q F
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQQCIRSLRELNSVPICPVDKEVIKPQEVFKDNCCKREVLNLHVYC-KNA------PGCNARIILGRFQDHLQHCSFQAVPCPNESCREAMLRKDVKEHLSAYCRFREEKCLYCKRDIVVTNLQDHEENSCPAYPVSCPNRC--VQTIPRARVNEHL-TVCPEAEQDCPFKHYGCTVKGKRGNLLEHERAALQDHMLLVLEKNYQLEQRISDLYQSLEQKESKIQQLAETVKKFEK--------ELKQFTQMF 299          

HSP 2 Score: 88.9669 bits (219), Expect = 1.979e-17
Identity = 61/155 (39.35%), Postives = 86/155 (55.48%), Query Frame = 3
Query: 1041 WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLM-EYGTYTLNQTIFFKVDI 1502
            +  +LIWKV  +  K  +A  G T + FS PF++S  GY+L       GDG  KG  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+    K+  +V +F  +    +F    RP GE N   G  +F+S S+L     TY  + T+F KV +
Sbjct:  402 YSGKLIWKVTDYRVKKREAVEGHTVSVFSQPFYTSRCGYRLCARAYLNGDGSGKGTHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG---KKNHIVETFKADPNSSSFK---RPDGEMNIASGCPRFVSHSTLENSKNTYIKDDTLFLKVAV 550          
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Match: sp|Q61382|TRAF4_MOUSE (TNF receptor-associated factor 4 OS=Mus musculus OX=10090 GN=Traf4 PE=1 SV=2)

HSP 1 Score: 154.066 bits (388), Expect = 4.162e-40
Identity = 125/485 (25.77%), Postives = 205/485 (42.27%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPV-----------------------------------------------TCPRE-------CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ--LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTG---ERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + + +C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   + ++  L I C  +      +EGC W G L     H  TC +  V                                                CP+E       CG  +  + +  H   +C    + C +C  + +   +  H+   CP +P+ C N CG V T+ R+ +  H  + C      CPF   GCK +  +  +  H++    PHL +M   +++    L+                E R  + E   GS   LIWK+  + ++  +AK+      FSP F++  YGYKL +     G+G  +G  LS+++ +  G +DNLL+WPF  +VTFSLLDQ+ P   K + V  +F P+    NF   G   G   E +  FG  KFIS   + +   Y  +  +F +  ++
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLAIRCIHS------EEGCRWSGPLRHLQGHLNTCSFNVVPCPNRCPAKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGVCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCAYCTKEFVYDTIQSHQYQ-CPRLPVPCPNQCG-VGTVAREDLPTHLKDSCSTAFVLCPFKESGCKHRCPKLAMGRHVEESVKPHLAMMCALVSRQRQELQ----------------ELRRELEELSIGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSIYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRASVE 463          
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Match: sp|Q9BUZ4|TRAF4_HUMAN (TNF receptor-associated factor 4 OS=Homo sapiens OX=9606 GN=TRAF4 PE=1 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 7.135e-38
Identity = 126/485 (25.98%), Postives = 206/485 (42.47%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSW-------QGVL----------------------------------------------GE-FIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ--LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTG---ERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + + +C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   + ++  L I C  +      +EGC W       QG L                                              GE +  H   C    V C  +CG  +  + +  H   +C    + C +C  + +   +  H+   CP +P++C N CG V T+ R+ +  H  + C      CPF   GCK +  +  +  H++    PHL +M   +++    L+                E R  + E   GS   LIWK+  + ++  +AK+      FSP F++  YGYKL +     G+G  +G  LSL++ +  G +DNLL+WPF  +VTFSLLDQ+ P   K + V  +F P+    NF   G   G   E +  FG  KFIS   + +   Y  +  +F +  ++
Sbjct:    5 DYKFLEKPKRRLLCPLCGKPMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEVQVLGLPIRCIHS------EEGCRWSGPLRHLQGHLNTCSFNVIPCPNRCPMKLSRRDLPAHLQHDCPKRRLKCEFCGCDFSGEAYESHEGMCPQESVYCENKCGARMMRRLLAQHATSECPKRTQPCTYCTKEFVFDTIQSHQYQ-CPRLPVACPNQCG-VGTVAREDLPGHLKDSCNTALVLCPFKDSGCKHRCPKLAMARHVEESVKPHLAMMCALVSRQRQELQ----------------ELRRELEELSVGSDGVLIWKIGSYGRRLQEAKAKPNLECFSPAFYTHKYGYKLQVSAFLNGNGSGEGTHLSLYIRVLPGAFDNLLEWPFARRVTFSLLDQSDPGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDIRKR-NYVRDDAVFIRAAVE 463          
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Match: sp|O00463|TRAF5_HUMAN (TNF receptor-associated factor 5 OS=Homo sapiens OX=9606 GN=TRAF5 PE=1 SV=2)

HSP 1 Score: 143.28 bits (360), Expect = 1.235e-35
Identity = 89/277 (32.13%), Postives = 137/277 (49.46%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG--IVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEA----------LTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWG 1046
            EE++ C  C+++LHNP Q   CGHR C  C  S RE    P CP D E+I    VF D   ++E+ NL +YC  NA       GC+ + +LG + DH + C ++PV C  E C   +  +++++H++  C+    +C +CK  V+V  L  HE   CPE P+ C NNC   I+KT   + + +     CP   ++CPF  +GC +      ++ H       H+ L+ E           L K+    E+ +Q L +   K   LE     F +L+G
Sbjct:   40 EERYKCAFCHSVLHNPHQTG-CGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCS-NA------PGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAV-----CPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLEKNVQLEEQISDLHKSLEQKESKIQQLAETIKK---LEKEFKQFAQLFG 300          

HSP 2 Score: 89.3521 bits (220), Expect = 1.444e-17
Identity = 62/173 (35.84%), Postives = 92/173 (53.18%), Query Frame = 3
Query:  990 KLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEY-GTYTLNQTIFFKVDI 1502
            K + S  E R  + E   +  +LIWKV  +  K  +A  G T + FS  F++S  GY+L       GDG  +G  LSL+  + RGE+D+LLQWPF  +VT  LLDQ+     +K+++ +F P+    +F    RP GE N   G  +F++ S L      Y  + T+F KV +
Sbjct:  384 KAQLSKNEERFKLLEGTCYNGKLIWKVTDYKMKKREAVDGHTVSIFSQSFYTSRCGYRLCARAYLNGDGSGRGSHLSLYFVVMRGEFDSLLQWPFRQRVTLMLLDQSG----KKNIMETFKPDPNSSSFK---RPDGEMNIASGCPRFVAHSVLENAKNAYIKDDTLFLKVAV 549          
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Match: sp|Q12933|TRAF2_HUMAN (TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2 PE=1 SV=2)

HSP 1 Score: 140.969 bits (354), Expect = 3.844e-35
Identity = 132/490 (26.94%), Postives = 204/490 (41.63%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRET--KDAPQCPKDN------EIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFID-HYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGC--KIQG---NENEIE---NHL----------------KRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKL-------------------KCSALESRLTVFERLWGSQ----------------------LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E K++C  C  +L  P Q  +CGHR CS C  S   +  ++   C  +        I+     F D   ++E+++L   CP +        GC+W+G L E+   H   C      CP  C   +       H+  +C      C  C+      ++  H  + CP+ P++C + CG  K +PR+    H    C      C F+  GC   ++G    E+E++    HL                +  A   L+   E+L K + T EN V C+L+ ++                   K  AL S++   ER  G +                       IWK+  F++K  +A +G     FSP F++S YGYK+ L +   GDG  +G  LSLF  + +G  D LL+WPF  KVT  LLDQ      R+ V+ +F P+V   +F    RP  + N   G   F  +S +    +Y  +  IF K  +
Sbjct:   29 EAKYLCSACRNVLRRPFQ-AQCGHRYCSFCLASILSSGPQNCAACVHEGIYEEGISILESSSAFPDNAARREVESLPAVCPSD--------GCTWKGTLKEYESCHEGRCPLMLTECP-ACKGLVRLGEKERHLEHECPERSLSCRHCRAPCCGADVKAHHEV-CPKFPLTC-DGCG-KKKIPREKFQDHVKT-CGKCRVPCRFHAIGCLETVEGEKQQEHEVQWLREHLAMLLSSVLEAKPLLGDQSHAGSELLQRCESLEKKTATFENIV-CVLNREVERVAMTAEACSRQHRLDQDKIEALSSKVQQLERSIGLKDLAMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLRIYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQ----NNREHVIDAFRPDVTSSSFQ---RPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIV 496          
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Match: A0A3M7SHF5 (TNF receptor-associated factor 4-like OS=Brachionus plicatilis OX=10195 GN=BpHYR1_034858 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 4.594e-98
Identity = 175/446 (39.24%), Postives = 258/446 (57.85%), Query Frame = 3
Query:  165 TKIIEHSIATAPSDWYKLRIKMVDFKLGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            T  I +  A++P     + IK   +K G+ ++K+ C  C + L  P+Q +EC HR+CS C+      K +  CP  +  I  ++V +D  FQKE+ NL +YC  N        GC W+G     + H   C++  + C R CG   + ++ R HI  +C     +C FC  +++  +   H +  CP   I C +NCGI + +PR+ M  H  N+C     +CPF    C+ +   +E+  HLK     HL LMA+ ++     LE   + +  +K +  +L S++   E++ GSQ+IWK++ F++KF+D+KSG   T FSPPF +S +GYKLAL    FGDG AKGKF+SLF+CIC+GE+D+LL WPF  K+T +LLDQ  + ++R+ V YS  PN  K+N PFLGRPTGERN  FGA+KF+ L  L  Y  Y  +  IF KV+I
Sbjct:   38 TNGIRYKSASSPQPRSPIEIK---WKFGKLDKKYECNYCNSYLKCPIQFQECHHRVCSSCFTDL--IKKSQSCPTCDRTITREKVIVDNEFQKEIHNLPVYCSNNL------NGCKWEGAFKAHMMHMEECEYTLIDCVRGCGLQYQRKDERAHIANECLKNEVECEFCSERIVKADEMNHLSS-CPRFLIPCPSNCGI-REIPREKMANHLENECKKHEVSCPFADSNCEFKSLRSEMPRHLKESPGIHLNLMAKTISIQKKQLELLSEIIEKQKEQIFSLGSKVDSIEKISGSQIIWKIDHFNEKFNDSKSGKKQTIFSPPFLTSRHGYKLALSATLFGDGKAKGKFMSLFLCICKGEFDSLLSWPFSHKITITLLDQCDDIQERRHVSYSIKPNTCKENTPFLGRPTGERNASFGAQKFVELEVLNSYD-YIKDDAIFIKVEI 469          
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Match: A0A1S3KE24 (TNF receptor-associated factor 4 OS=Lingula unguis OX=7574 GN=LOC106181010 PE=4 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 8.002e-97
Identity = 160/416 (38.46%), Postives = 239/416 (57.45%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E+K+ C +C  +L  P+Q +ECGHR CS C       + AP+CP D   I+ D+V++D  FQ+++D+L + C            C W G L E + H   C+++ + CP+ CG   E + +  H ++ C      C FCK  ++  E  EH N+ C   PI C N C   K +PR+ +  H    CP +   CPF   GC+ + N  ++  H+  +   HL L+AE + ++   L+     + D   K + +E R+   E+L+G+Q +WK++ + +K  +AK+G   T FS PF +S  GYK+AL  C FGDG A+GKF+SLF CIC+GE D LL WPF  +VTF+L+DQ  +   R++V Y+  PN  KDN PFLGRP+G+RN  FGA+KF+ L  +M    Y  + TIF KV++
Sbjct:   52 EKKYECPVCCQVLRYPIQFDECGHRCCSSCLPEL--LRVAPRCPIDQRHIDRDKVYVDKAFQRDIDHLGVKCSNGR--------CKWTGALKELVPHQEDCKYKVIPCPKGCGAEFEKRFLDKHRDEDCPKRKIACEFCKSNILFEEEIEHLNL-CKRFPIPCPNGCK-RKDIPREEVAEHMEGDCPKQTVPCPFVDCGCEYRCNRKKLTAHVNEEPTMHLSLVAETIARHKEILDKYKLSMEDHTEKLAGMEKRIEGLEKLYGAQFVWKIDSYQEKLDEAKAGTKRTIFSQPFLTSRNGYKMALSACLFGDGKARGKFMSLFACICKGESDALLSWPFSHRVTFTLMDQCEDPAARRNVTYTVKPNTCKDNKPFLGRPSGDRNASFGAQKFVEL-EVMSTLDYIRDDTIFIKVNV 454          
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Match: A0A267ELC7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027678g1 PE=4 SV=1)

HSP 1 Score: 302.753 bits (774), Expect = 1.265e-93
Identity = 162/422 (38.39%), Postives = 244/422 (57.82%), Query Frame = 3
Query:  243 LGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGT--YTLNQTIFFKVDI 1502
            L + ++K+ C +C  +L  PVQ EECGHR CS C       + AP+CP D   I++D+V++D  FQKE DNL + C  +A       GC W G+L E + H   C     TCP  CG   E + +  H N  C      C FC+I++I     EH  + CP+  + C N C   + + R+ +  H  N+C  +  NCPF  +GC+  G +  ++ H+  K + H+ ++  A+ +     EN  + + + + K   +E R+   E L+G QLIWK++ + +K ++AKSG  +T FSPPF ++ +GYKLA+  C +GDG ++GK++SLFVCIC+G+ D LL WPF  K+TF L+DQ  +   R+++VY   PN  K+N PFLGRP GERN  FGA +F  L  +   GT  Y  + T++ KV++
Sbjct:   76 LEQLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDL--LRVAPRCPLDQVAIDKDKVYVDKAFQKETDNLGVKCSFSA------RGCPWTGLLLELMAHMEGCDRMMTTCPMRCGVEFEKRFLEKHRNDDCPKREIHCQFCEIRLIAENEAEHLEI-CPKFLVPCPNKCK-RREVARERLTEHLENECMKQDLNCPFASYGCQFTGKKKAMKEHVAAKQLNHMEILCAAVKQGDKNRENQDKAIQEMEKKMLGIERRINGLENLYGPQLIWKIDNYEEKLAEAKSGKKSTIFSPPFLTNRHGYKLAMSACLYGDGKSRGKYMSLFVCICKGDNDPLLAWPFAYKITFHLIDQCEDVAARRNIVYVVKPNTCKENRPFLGRPVGERNASFGAARFAELEVI---GTLDYIKDDTMYIKVEV 484          
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Match: A0A267DPF2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig027678g2 PE=4 SV=1)

HSP 1 Score: 300.827 bits (769), Expect = 6.321e-93
Identity = 161/422 (38.15%), Postives = 244/422 (57.82%), Query Frame = 3
Query:  243 LGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGT--YTLNQTIFFKVDI 1502
            L + ++K+ C +C  +L  PVQ EECGHR CS C       + AP+CP D   I++++V++D  FQKE DNL + C  +A       GC W G+L E + H   C     TCP  CG   E + +  H N  C      C FC+I++I     EH  + CP+  + C N C   + + R+ +  H  N+C  +  NCPF  +GC+  G +  ++ H+  K + H+ ++  A+ +     EN  + + + + K   +E R+   E L+G QLIWK++ + +K ++AKSG  +T FSPPF ++ +GYKLA+  C +GDG ++GK++SLFVCIC+G+ D LL WPF  K+TF L+DQ  +   R+++VY   PN  K+N PFLGRP GERN  FGA +F  L  +   GT  Y  + T++ KV++
Sbjct:   76 LEQLDKKYECPVCGQVLRYPVQFEECGHRCCSSCLPDL--LRVAPRCPLDQVAIDKEKVYVDKAFQKETDNLGVKCSFSA------RGCPWTGLLLELMAHMEGCDRMMTTCPMRCGVEFEKRFLEKHRNDDCPKREIHCQFCEIRLIAENEAEHLEI-CPKFLVPCPNKCK-RREVARERLTEHLENECMKQDLNCPFASYGCQFTGKKKAMKEHVAAKQLNHMEILCAAVKQGDKNRENQDKAIQEMEKKMLGIERRINGLENLYGPQLIWKIDNYEEKLAEAKSGKKSTIFSPPFLTNRHGYKLAMSACLYGDGKSRGKYMSLFVCICKGDNDPLLAWPFAYKITFHLIDQCEDVAARRNIVYVVKPNTCKENRPFLGRPVGERNASFGAARFAELEVI---GTLDYIKDDTMYIKVEV 484          
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Match: A0A5K4F9L5 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 4.727e-92
Identity = 169/484 (34.92%), Postives = 267/484 (55.17%), Query Frame = 3
Query:   84 NSEEFEEIKRFSLNYKQVPTDVSSDDITKIIEHSIATAP--SDWYKLRIKMVDFKLGENEE---------KFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            N E  +E K+ SL   +  T+  +D +    + +    P  S+  K  I  +++K+    E          + C  C  +L  P   E+CGHR CS C       +   +CP D + + +DRV +D  FQ+ +D L + C      S   EGC W G+L E   H   C++R V CP  CG   + ++I +HI   C    ++C FC ++ I  +  EH N  C E P+ C N C   K +PR L+  H  N+C  +   CPFN+ GC+ +G++N+I+ HL+R  + HL  +  ++ + SL +E   +   + +    +   R+T  E+  G+  +WK++ +S+K ++AKSG  T  FS PF++  YGY++AL +  +G+G A+GK++S++ C+ RG++D+LLQWPF  ++TF+L+DQ PE   R+ +VY+  P++  D   F GRPT ERN  FGA +FI L  LME  TY LN  I+ KV +
Sbjct:   17 NVEVSKETKK-SLTRMKSSTNRKTDPLNTPKQPNEDAEPKTSETDKGEIHGIEYKISREPEIVFVEQLDIAYRCVNCNRVLRVPFLFEDCGHRCCSGCVPDI--LRGTSKCPVDKQNLKKDRVHLDKAFQEHMDGLNVRC------SYHTEGCPWIGILSELGYHLSQCEYRIVLCPNGCGAESQRKSIENHIKNDCPKRIKRCKFCNVKYIAEKEIEHTNN-CREYPVPCPNKCEKTK-IPRSLISEHLKNECSRQNIRCPFNVHGCEFRGHKNKIDTHLERSLMVHLNFLNLSVQQMSLLIEAQTKSYAETRKSLESQIKRVTALEQCLGAPFLWKIDSYSEKLNNAKSGKQTALFSSPFYTHRYGYRMALSVSLYGNGDARGKYMSVYACLFRGDHDSLLQWPFSHQLTFTLIDQNPEINARQPIVYTINPSITGDYNQFFGRPTNERNSCFGAPRFIKL-ELMEMSTYILNDEIYLKVTM 488          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:103024022])

HSP 1 Score: 166.777 bits (421), Expect = 1.375e-45
Identity = 141/480 (29.38%), Postives = 217/480 (45.21%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIH------------------------QNNQ--CPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMA-------------------EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   ++++  L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ +H+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H                        QN+Q  CP  P  CP N  G      E+ +  H+K      LVL                     E  TK+ LT+     C L  + +   +E R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P+  RN        FG  KFIS   + +   Y  +  IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEQQILALPIRCIHS------EEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCAVKLTRRDLPEHLQHDCPKRKVKCEFCGSE-FTGEAFENHQGICPQESVYCENKCGA--RMMRRLLAQHTMAECPKRTQPCKYCGKEFVYDTIQNHQYHCPRFPVQCP-NQCGTPNIARED-LATHVKESCGSALVLCPFKDAGCKHRCPKLAIGRHLEETTKSHLTM----MCSLVGRQRQEIIELRREM-EELSVSHDGVLIWKLNDYSRKLQEAKLHNNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSIYIRVLPGEYDNLLEWPFAYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPSSSRNSLDESTLGFGYPKFISHDEIRKR-NYIRDNAIFLKASIE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Match: traf4b (TNF receptor-associated factor 4-like [Source:NCBI gene;Acc:103043275])

HSP 1 Score: 149.443 bits (376), Expect = 2.798e-39
Identity = 132/493 (26.77%), Postives = 206/493 (41.78%), Query Frame = 3
Query:  231 VDFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCG--IVKTL----------PRKL------------MLIHQNNQCPLEPRN-----------------------------CPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXX--XXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNF--PFLGRPTGERNPF-------FGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            +D+K  E    +F+C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  ++F D   ++++  L I C  +      +EGC W     +   H   C +  V+CP  C   +  +++ DH+   C     +C+ C ++   GE +E     CPE  + C N CG  +V+ L           RKL             + H  NQCP  P                               CPF   GCK +  +  + +HL+     HL L+   + +  L L +                      E L GSQ   L+WK+  + ++  +A++  T +         S  +GY+L +     G+G  +G +LS+++ +  GEYD LL+WPFP +VTFSLLDQ+ P   K + +V SF P+    NF  P  G     R          FG  KFIS    M    Y  +  IF +  I
Sbjct:    4 LDYKFLERPRRRFLCPLCSKPMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIFPDVELEQQILALPIRCIHS------EEGCRWSAQNKQLQAHLSACAYNVVSCPNRCSVKLLRRDLLDHLQHDCSKRKLRCDHCSLE-FTGEAHERHQDACPEESVYCENKCGARMVRRLLAQHTLSECSKRKLPCKYCNKEFLYDTIQHHQNQCPRFPVQCPNKCGTPGIAREDLMTHVKESCGTAMVFCPFKEAGCKYRCIKPAVPHHLEDATHSHLSLLCGLVNRQRLELRDLR-----------------RRVEELSGSQDGVLLWKIPDYCRRLQEARTRTTGSAELFSPAFYSHRHGYRLQVSAFLNGNGSGEGSYLSIYIRVLPGEYDGLLEWPFPYRVTFSLLDQSDPALSKPQHIVESFSPDPNWKNFQRPQPGAMGSIRAGSLDESMLGFGYPKFISHEQ-MRKRNYIRDNAIFIQASI 470          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Match: traf5 (TNF receptor-associated factor 5 [Source:NCBI gene;Acc:103031120])

HSP 1 Score: 120.168 bits (300), Expect = 1.198e-28
Identity = 128/517 (24.76%), Postives = 214/517 (41.39%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTL--------------------------------------KEGCSWQGVL----------GEFIDHYRT-CQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNF----CKIQVIVGELNEHENM-FCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRN------------CPFNMFGCKIQGNEN-EIENHLKRK-------------------------AIPHLVLMAEALTKNSLTLENSVQC---LLD---EKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLM--EYGTYTLNQTIFFKVDI 1502
            +++F+C  C  ++ NP Q   CGH  CS C     E  +  +CP D  +I  + VF D   ++EL NL+++C  +   S                                        +  CS++  L           +  DH +T C    V CP +C + ++   ++DH ++ C      C +    C ++   G++  HE   F   V +   +N  ++K +  +L       Q  L+ RN            C   +   +    E  E+ + +KR+                         ++   V M ++L ++   L  + Q    LLD   ++L+CS  E R    E   +  +LIWKV  + +K  +A + + +  F       H GYKL+  +   G+G A+G  LSL+V + RG++D+LL WPF   VT ++LDQ+     R  V  SF P++  +NF    RPT E N   G  +FI+ + L       Y  + T+F KV +
Sbjct:   42 DDQFVCPACGGVVFNPHQTG-CGHIFCSPCIRVILENNETSKCPFDGILIKPEEVFQDNCCKRELLNLEVFCTNSPACSQTIPLCNLQDHLKSCQYEALQCPNSSCTDILLRKNLPDHQRSHCSYRTELCRYCQKPYPVSQLTDHEKTSCPEAEVQCPNKCIHLVKRHKLKDHADE-CPEQETDCIYKKYGCTVRNKRGQVKVHEQTEFNHHVLLLLESNSKLIKQVD-QLQQDFAAQQGELKERNLLVSNLKREVSKCDTTVSAMQRSVEEQRELVSSVKRELKDLRDVLEADLTKEELVSLRASLDSLREQVAMTQSLREHLGALGQTCQSHTRLLDIHVQQLQCS--EQRFQQLESTSYDGKLIWKVHDYHRK-KEAGTALNSPPFYTS----HSGYKLSARVYLGGEGTARGTHLSLYVMLMRGDFDSLLPWPFRQNVTLAVLDQSG---NRNHVSLSFTPDLASNNF---RRPTSETNAALGFPRFITHADLEAPRNAAYVRDDTLFIKVKV 542          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 112.464 bits (280), Expect = 2.112e-26
Identity = 105/390 (26.92%), Postives = 161/390 (41.28%), Query Frame = 3
Query:  495 LKEGCSWQGVLGEF-IDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNE--------------NEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSA-------------------LESRLTVFERLWGSQ----------------------LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKV 1496
            + EGCSW G + E+   H   C +  + CP  C   +    +  H  ++C      C +CK       +  H+ + CP+ P+ C   C   K +PR+  + H    C      C F++ GC +  ++                    L +  +  L    + L     T EN V C+L+ +++ SA                   L +++   ER  G +                       +WK+  FS+K  DA +G     FSP F++S YGYK+ L +   GDG  +G  LSLF  + RG  D LL+WPF  KVT  LLDQ      R+ ++ +F P++   +F    RP  + N   G   F  LS L    +Y  + TIF K 
Sbjct:   76 INEGCSWTGTIKEYEATHEGQCDFMIIPCP-SCKELLRANELERHNERECPERTLNCKYCKEPFHFKNIKAHDEI-CPKYPMIC-EGCA-KKKIPREKYVDHIK-LCTKFRTPCRFHVVGCDMSVSKPQWNLILTPRDLLYTSFTVPLSQTKVAELSRRCQELELKVGTFENIV-CVLNREMERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYDGVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQ----NNREHIIDAFRPDISSSSF---QRPVSDMNIASGCPLFCPLSKLDSKNSYIRDDTIFIKA 452          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 101.679 bits (252), Expect = 1.411e-22
Identity = 113/438 (25.80%), Postives = 188/438 (42.92%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCW-NSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGE--LNEHENMFCPEVPISCRNNC-GIVKTLPRKLMLIHQN---------------NQC--------------PLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFE-RLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAK-GKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNP-FFGARKFISLSSLMEYG 1460
            E K+ C +C   L + VQ   CGHR C+ C   S R+T    +CP DNE++ ED++F D   ++E+ +L + C +N        GC  +  L    +H   C++  V CP +C   +    + +HINQ+C      C  C   +I  E  L  H +  C + P++C  +  G  + + R  + +H                 NQ               P + R       G      E +       +    LV     L + S+  E     + + + K ++LE  +   + + +    +W++E FS    + ++G      SPPF++   GYKL L L        +   ++SLFV   +GE+D+ L WP    +  ++LDQA E +   +V+ +      K +     RPT +RNP  FG   F+ L +L + G
Sbjct:   65 ESKYECPICLMGLRSAVQTP-CGHRFCNCCIRKSIRDT--GQKCPVDNEVLTEDQLFPDNFAKREILSLTVRC-RNV-------GCMEKMELRHLENHIPHCKFATVPCP-QCQESVWKSELEEHINQECSHRLITCPDCAENIIYAEKQLASHCDTDCLKAPVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQMTELRKKLASLEESMRELQAQQYQGVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQA-EGQHHVEVMET------KPDLQAFQRPTVQRNPKGFGYVTFMQLQALHQRG 483          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.5969 bits (244), Expect = 1.277e-22
Identity = 62/165 (37.58%), Postives = 94/165 (56.97%), Query Frame = 3
Query: 1011 ESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E RL V E   +  +L+WK+  ++++  +A SG T + +S PF++S +GYK+       GDG+ +G  LSLF  + RGEYD LL+WPF  +VT SLLDQ    R   D   +F P+    +F    RP G+ N   G   F+S  +L E  +Y ++ T+F +V +
Sbjct:  255 ERRLQVLETAGYSGKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLLDQGAARRHLSD---TFTPDPASGSFR---RPDGDMNVASGCPLFVSHVAL-EGSSYLVDDTVFVRVVV 412          

HSP 2 Score: 49.6766 bits (117), Expect = 8.632e-7
Identity = 39/143 (27.27%), Postives = 60/143 (41.96%), Query Frame = 3
Query:  579 PRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKI-QGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCS 1004
            PR CG  ++   +  H    C      C +C   V    L  H    C + P+ C NNC     +PR  +  H  + C +  + C F+M GC   QG    +  H +     H  L+   +++NS   E  +QC    +L+CS
Sbjct:   11 PR-CGTSVQRTRLAAH-RASCPHRAEFCKYCSAAVTCSLLERHHKEECAQYPLPCPNNCE-EHGIPRAELSQHM-SACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLV---ISRNS---ELELQC---ARLQCS 140          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 95.9005 bits (237), Expect = 2.399e-21
Identity = 112/519 (21.58%), Postives = 190/519 (36.61%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKC-WNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPR--------------------------ECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCR-NNCGIVKTLPRKLMLIHQNNQCPLEPR-------------------------NCPFNMF---------------GCKIQGNENEIE----------NHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFE-RLWGSQLIWKVERFSQKFSD------AKSGVXXXXXXXXXXXXHY----GYKLALGL-------CPFGDG------IAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNP-FFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E K+ C +C   L  PVQ   CGHR C  C  +S R     P+CP DN +++E ++F D   ++E+ +L + CP           C  +G L    +H   C++  V C R                           C   + +++ ++H  Q C L    C  C+ ++I  +L  H  + C +  + C  +  G    + R L+  H +    +  R                         + P N                   + QG+ +               + R     +VL    + + S   +N    L +      +LE+R+   E RL      W+VERFS+          A  G+     +    S  Y    GY+L L L        P G          +   L+LFV + +G+YD+ L WPF  ++  S++DQ       +D V+               RP+  RNP  FG   F+ +++L  + +Y  +  +  + ++
Sbjct:   60 ESKYECPICLMALREPVQTP-CGHRFCRACILHSMRLRDAGPKCPVDNAVLHEGQLFPDNFAKREILSLTVRCPNKP--------CGHRGELRALQEHQLRCEYAQVPCVRCEMPVCRRDLAKHEEQECMRRIVTCLHCCEKMAYKDSKNH-EQMCPLVVVNCKHCQQELIREQLGPHLEVDCQQAQVPCTFSPLGCEAQMVRSLLAAHMHEHTQVHMRLLANGLKILRIQVGQGAQPSSAAGSSAPPNSLSWLSSTSGGDVQTAGASRSQGSRDRAACDCAQELDRLREITRTLEERVVLQLHQIRELSAKTDNQQGLLAEATRLVRSLEARVAESESRLCAGIFTWRVERFSRLLPGGLASGFASDGMHPDAPAVMHSSGFYTGVPGYRLCLRLQVLSGREVPAGAASPSVLLAGRQPHLALFVHLLQGDYDHRLPWPFKGRIRISVVDQC-----ERDSVHVTEMMDADPQLSAFQRPSVHRNPKGFGYMNFMDINTL-HHRSYLRDDCLVVRCEV 562          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 94.7449 bits (234), Expect = 4.484e-21
Identity = 62/176 (35.23%), Postives = 96/176 (54.55%), Query Frame = 3
Query:  978 LLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            L     + + ++ R  V E   +  +L+WK+  ++++  DA SG T + +S PF++S +GY++       GDG+ +G  LSLF  + RGEYD LL WPF  +VT +LLDQ    R+  D   +F P+    +F    RPT + N   G   F+S  +L E  +Y  + TIF KV +
Sbjct:  301 LFAHDTRLAEMDLRFQVLETASYNGKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLLDQGAARRQLSD---TFKPDPASSSFR---RPTSDMNIASGCPLFVSHVAL-ESASYLQDDTIFIKVVV 469          

HSP 2 Score: 73.1738 bits (178), Expect = 3.453e-14
Identity = 59/216 (27.31%), Postives = 92/216 (42.59%), Query Frame = 3
Query:  414 RVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRE-CGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLI 1058
            +VF D   ++E+  L+++C  +        GC     LG+  +H   C    V CP   C   +    + +H+   C      C +C  QV + E  +H    CP  PI C N C   +++ R+ ++ H    CP +   C F+ FGCK +G    ++ H       HL L    +T  S  LE          LK S L+S+L   ER   + L+
Sbjct:    1 QVFRDNCCRREILALRVHCRNDTA------GCKQIVELGKLQEHMAVCVHEAVNCPHAGCTERLLRGELVNHVALGCHFRTESCRYCNQQVPLAEKRKHYETRCPRYPIPCPNKCE-EQSIAREELVSHLGI-CPYKQAECFFSQFGCKYKGTLQGLKEHESGATQQHLSL----VTARSANLE----------LKVSMLQSQLA--ERANSADLL 192          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 3.639e-12
Identity = 65/280 (23.21%), Postives = 110/280 (39.29%), Query Frame = 3
Query:  261 KFICYLCYTILHNPVQLEECGHRLCSKC-----WNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEF-IDHYRTCQWRPVTCPRECGYFIEF---QNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNN-------CGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDE-----KLKCSALESRLTVFER 1037
            +F C  C  +L + VQ   CGHR C  C      + +R   D      +  + +  + F D   ++E+  L + C        + EGC W+G L E+ + H   C W  V  P              +  H+ Q+C +    C  C   +   +L +H+        + CR+        CG  K++P      H+  +C      CP++  GC  +G+   + NH K     HL ++ +A  K   T E  ++   D        +  A E++L   +R
Sbjct:    2 RFACGSCQGLLRDAVQTH-CGHRFCKPCIARLITSVHRSCNDTLM-NSNFLVYSPTQFFPDAALRREMGVLPVRC--------VSEGCEWRGRLLEYDVAHVERCDW--VLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQLLPYRQLQKHQ--------LHCRSRRTRECKLCG-QKSIPEDKWQHHEERRCMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKK---TFEQLIKGHADNIKHPPSARLVAAEAQLATMDR 257          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Match: EDO32849 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV3])

HSP 1 Score: 228.794 bits (582), Expect = 2.479e-69
Identity = 131/416 (31.49%), Postives = 219/416 (52.64%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E K +C +C  I  +PVQ++ECGHRLC  C+ +   + + P+CPK +  +++    +D  F+ +++ L   C  +        GC  +    + I H   C++  + C  +CG   + +  + H+++ C      C +C  + +     EH    C  +P+ C N C    T+PR  +  H   +CP     C F   GC+ + +  ++  H+K + I H+ ++   + +    L+N  Q   + +     ++SR+   E++  SQ+IW++E +++K  +AK+G   T FSP F +S +GY+L   +C  GDG  KG  +S+FV + +G +D LL+WPF  +VTF LL+Q     +RK V +S  PN I DN PFLGRP  E+N  FG  KFI    + E G +  + T+F KV +
Sbjct:   50 ERKHLCPVCEDIFVSPVQIKECGHRLCQHCYKTIWRSPE-PKCPKCSGDLDDKIPDVDQAFENDMNELPCRCINHEW------GCKVEVPFTQMITHKGECEYSDILCDNDCGAKFQRRFKQKHLDKDCPKKIISCPYCDDRHLRENKKEHLED-CLLIPLPCPNKCDKTLTIPRGQLDEHIEKECPRAKLMCEFESLGCQHRCSREKMAKHMKSEIIGHVKMIFGVVLEQKEKLDNHAQKFEEHETIMKQVDSRVGDLEKIAHSQIIWRIEDYTRKLKEAKAGNAETLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFVSVLKGAFDALLKWPFHYRVTFFLLNQHENPEERKHVKFSIKPNPIPDNEPFLGRPRLEKNASFGGAKFIKHEEI-ESGNFIKDDTVFLKVSV 456          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Match: EDO32851 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STV5])

HSP 1 Score: 224.172 bits (570), Expect = 1.124e-67
Identity = 136/424 (32.08%), Postives = 217/424 (51.18%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEH-ENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQ-------GNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            ++K+IC  C  +L  PVQ++ CGHR+C+KC+     +  + +CP   + +NE+   ID  F +E+  L + C        ++  C W+G + EF  H   C +  + C  +CG   + + +  H+++ C      C +C  + +  +   H EN  CP +P  C N C    T+ R  +  H  N CP     C + + GC  +       G+  ++  H K   I H+ ++A+   KN   +    + L +        E RL   E++  SQLIW++E +++K  +AK+G T T FSP F +S +GY+L   +C  GDG  KG  +S+F+ + +G +D LL+WPF  +VTF LLDQ  +  +RK + +S  PN   DN PFLGRP  E+N  FG  KF     ++    Y    TIF K+ +
Sbjct:   40 QKKYICLDCEGLLWYPVQIKPCGHRVCTKCYTKLLSS--SARCPGCMDELNENIPDIDKAFHEEIQELDVKC------RNVEWNCKWEGCVNEFSSHVEKCDYSDILCENDCGAKFQRRFLTKHLDKDCPEKLITCLYCDEKHLRKDKKGHLEN--CPLLPCPCPNKCDKKLTIHRCELDSHVENDCPRTKLMCEYEVLGCGHRITGLEGGGSREKMPKHNKTNIIAHVKMVADLALKNKELIMRFSEKLSEHGTLIEKHEKRLNDLEKIAHSQLIWRIEDYTRKMKEAKAGNTDTLFSPTFTTSKHGYRLCASVCLNGDGKGKGTHMSVFISVLKGAFDALLKWPFDYRVTFVLLDQNDDPAQRKHIRFSIKPNPCADNEPFLGRPRLEKNASFGGAKFAKHEEIVSR-NYIKEDTIFLKISV 452          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Match: EDO45915 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRA4])

HSP 1 Score: 207.223 bits (526), Expect = 1.048e-61
Identity = 125/420 (29.76%), Postives = 212/420 (50.48%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHY-RTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLL--DEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSG-VXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            ++ F C +C   L +PVQ+  CGHR+C  C       +  P+CP DN  +N  ++F D    +++ ++ I CP +       +GC WQG + +   H  R C    V CP++CG  +E   +  H  + C      C  C  +V+  ++N H    C   PISC   CG  K L ++ + +H N +CPL    C F   GC  +    ++  H++     H+ ++ + + +  L +    + LL   E ++   +E R     R    + IWK++ FS+K  DAK+G  +    S  F++S +GYK+  G+   G G  +G+++S+ + +  GE+D++L+WP   + TF+LLDQ+ + + ++DVV +F P  I        RP+ +R    GAR+F+ L   +   TY  + TIF K  +
Sbjct:   13 DKSFECPVCLMALRDPVQVTPCGHRVCQTCIKPIIRNRR-PRCPLDNLTLNVGKIFPDNACHRQILSMDILCPHHG------DGCEWQGTISDLEKHLERGCNLSEVRCPKDCGASVERGKLEGHYPE-CSRRLVNCTHCNKEVVFADMNVHLQS-CASFPISCPLTCG-AKDLTKEALAVHLNQECPLLVIPCRFAEAGCTFKAKRQKMAAHVQESLTSHVAMLCDLVCEQKLQISAQKERLLLQKEHIQLQIVECR----SRCANGEFIWKIQCFSRKLMDAKTGRASEPMISEAFYTSPHGYKMCAGVWLNGIGTGRGRYISVGLQVQSGEFDSILKWPLYPRYTFTLLDQSEDTKTKRDVVATFEPQSI-------SRPSADRQLGKGARRFV-LQDEVCGTTYCKDNTIFIKFSV 410          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Match: EDO49545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGK7])

HSP 1 Score: 167.162 bits (422), Expect = 1.040e-46
Identity = 122/420 (29.05%), Postives = 190/420 (45.24%), Query Frame = 3
Query:  258 EKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQ-CPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPR-ECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDA-KSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFL-GRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            E++ C +C     +P+Q+EECGHR C  C    R  + +P  CP D   I+  +VF+D   ++ +  L + C         K  C W G L    +H + C    V C   EC   +  ++++ H+  KC+     C+FC       +   H    C  +PI C N CG  K +PR+ M  H + +CPL    C +   GC  +G  + +E H K     HL +  + + +N                     ESR      ++    +WK+  +  ++  A  S      FSPPF++S YGYKL L     G    KG  LSL++ I +G+YD LL+WPF  K+TF L+DQ+    K+    +   PN    N   +  RPT + N   G   F+  + ++E G Y  +  +F K  ++
Sbjct:   22 EEYECPICQLAFRDPIQIEECGHRFCQSCLQELRRLQGSPVLCPMDRRPISSTKVFVDKAARRAILGLGVKC------WNWKRKCEWTGELSNIEEHAKNCAHEDVHCTNPECNEVMPRRSLQYHLVSKCKWRIVSCHFCTEMYTYKDGKTHMKS-CKRLPIECVNKCG-AKDIPREEMPFHMS-ECPLAVHPCMYRDIGCPFKGRRDALEEHCKNAVHTHLNIACQKIREN---------------------ESRSLCTNGIF----LWKISNYKHQYDQAVASPEELAIFSPPFYTSQYGYKLRLKAYLNGRDRGKGTHLSLYIIIMKGDYDALLEWPFKQKITFYLIDQS---EKQNHRTHLLSPNRSLPNIKVVFNRPTVKENLGIGNPCFVP-NEVLESGEYVKDDVMFIKAVVE 403          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Match: EDO48773 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI91])

HSP 1 Score: 160.999 bits (406), Expect = 6.384e-44
Identity = 129/448 (28.79%), Postives = 212/448 (47.32%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDA-PQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLD----------------EKLKCSA-------------LESRLTVFE-RLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERN-PFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            E K+ C +C   L +PVQ   CGHR C  C    R  +DA P+CP DN  ++E  ++ D   ++E+ +  ++C         + GC+W+G L E  +H + C      CP ECG  ++ + +  H  + C      C+ CK++V + ++ EH    CP +  +C N CG V  + RK +  H    CP   R+ P +   CK++ ++ E  +H  ++  PH   +       S  ++  V  L                  E +K S+             LE+R    E R+     IWK++ F Q    + +G+T    SPPF++S YGYK+ L +   G     G+ +SLF+ + +G++D +L+WPF  ++T S+LDQ+ +   R+ +  +    V K N     RPT  RN   +G  +F  +  L E G Y  N +I  ++ I
Sbjct:   53 ESKYECPICLLGLRDPVQTP-CGHRFCFNCIR--RSIRDAGPKCPVDNTPLSERELYRDNFAKREMMSFIVWCRLKK-----ERGCTWKGALKELEEHLKGCPCMDTNCPNECGAVMQRKEVDKHCAEACPNRSVPCDHCKMKVTISKIEEHLK-GCPCMDTNCPNECGAV--MQRKEVDKHCAEACP--NRSVPCDH--CKMKSSK-EQASHGPQEHTPHEAELRREALFQSANMQREVDMLGSRGDEYRQFLAYLERKVEDVKTSSDRRIAELTHKLMRLETREIELEGRVCNGTFIWKLDNFRQCREGSIAGLTAAIHSPPFYTSMYGYKMCLRMNLNGVDGGLGEHVSLFIHMMQGDWDGILEWPFIGRITLSILDQSDQIDSRRPISETL---VAKPNLLAFQRPTSPRNHKGYGYVEFCPIDQLTE-GQYIKNNSILVRIQI 480          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 190.274 bits (482), Expect = 1.634e-54
Identity = 141/440 (32.05%), Postives = 212/440 (48.18%), Query Frame = 3
Query:  195 APSDWYKLRIKMVDFKLGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCP-RECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPR--KLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERL-WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            AP+ +  +R    D  +   E K+ C  C  +L  P Q  ECGHR C  C N      + P CP D E + +D++F D    +E+  LK+YC   A       GC  Q  L +  DH   C +  V CP  +C   +  + I +H+  KC+     C FCK ++ + EL +H+   CP  P+SC N+C    +LPR  KLM  H      LE           +++     ++    R  +  L     A  +  L   + +  L   +++ + ++ R  V E   +   LIWK+  + ++  DA +G T + +S PF++ ++GYK+   +   GDG+ KG  LSLF  + RGEYD LL WPF  KVT  L+DQ P    RK +  +F P+    +F    RP  E N   G   F+S  S++E GTY  + TIF KV +
Sbjct:   23 APAGFLPVRGGFRDHFVEAPEAKYCCEACRLVLCQPRQ-TECGHRFCYSCINDILSCPN-PVCPADMEPLFKDKIFRDVCCHREIMALKVYCRSEA------NGCQEQMSLQQIPDHVNVCPFFEVPCPLGKCKERMMRKEIPEHLAWKCKYRESTCEFCKNKMPLTELQKHKETVCPAFPVSCPNHC-TSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDT--VRTRLSALEQGGRASLETQLNRHDDM--LSVHEIRLADMDLRFQVLETASYNGTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPS---RKHLGDAFKPDPSSSSF---RRPVAEMNIASGCPLFVS-QSVLESGTYIKDDTIFIKVTV 442          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 167.162 bits (422), Expect = 7.650e-46
Identity = 144/480 (30.00%), Postives = 218/480 (45.42%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIH------------------------QNNQ--CPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMA-------------------EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   ++++ +L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ DH+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H                        QN+Q  CP  P  CP N  G      E+ + NH+K      LVL                     E  TK+ LT+     C L  + +   LE R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P   RN        FG  KFIS   + +   Y  +  IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHS------EEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSE-FTGEAFENHQGVCPQESVYCENKCGA--RMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCP-NQCGTPNIARED-LANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTM----MCNLVSRQRQEILELRREM-EELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 167.548 bits (423), Expect = 1.243e-45
Identity = 141/478 (29.50%), Postives = 219/478 (45.82%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPF------------NMFGCK---IQ-----GNEN----EIENHLKRKAIPHLVLMA-------------------EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +  ++   +CP+D   ++  +++ D   ++++ +L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ DH+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H   +CP   + C +            + F C    +Q     G  N    ++ NH+K      LVL                     E  TK+ LT+     C L  + +   LE R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P   RN        FG  KFIS   + +   Y  +  IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFL-SEGVFKCPEDQLPLDYAKIYPDPELEQQILSLPIRCIHS------EEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSE-FTGEAFENHQGVCPQESVYCENKCGA--RMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCPNQCGTPNIAREDLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTM----MCNLVSRQRQEILELRREM-EELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIE 463          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Match: traf4a (TNF receptor associated factor 4 [Source:NCBI gene;Acc:101161428])

HSP 1 Score: 153.295 bits (386), Expect = 7.852e-41
Identity = 143/484 (29.55%), Postives = 210/484 (43.39%), Query Frame = 3
Query:  234 DFKLGEN-EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRE----TKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIH------------------------QNNQ--CPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMA-------------------EALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ---LIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQA-PEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPF------FGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            D+K  E  + +F C LC   +  PVQ+  CGHR C  C   +          PQ            ++ D   ++++ +L I C  +      +EGC W G + +   H+ TC +  + CP  C   +  +++ DH+   C     +C FC  +   GE  E+    CP+  + C N CG    + R+L+  H                        QN+Q  CP  P  CP N  G      E ++ NH+K      LVL                     E  TK+ LT+     C L  + +   LE R  + E L  S    LIWK+  +S+K  +AK      FFSPPF++  YGYKL +     G+G  +G  LS+++ +  GEYDNLL+WPF  KVTFS+LDQ+ P   K + +  +F P+    NF    +P   RN        FG  KFIS   + +   Y  +  IF K  I+
Sbjct:    5 DYKFLEKPKRRFQCPLCSKAMREPVQVSTCGHRFCDTCLQEFLSIFFPMGLLPQ------------IYPDPELEQQILSLPIRCIHS------EEGCRWTGQMKQLQGHFSTCAFNVIPCPNRCSVKLTRRDLPDHLQHDCPKRKVKCEFCGSE-FTGEAFENHQGVCPQESVYCENKCGA--RMMRRLLSQHGMAECPKRTQPCKYCGKEFVFDTIQNHQFHCPRFPVQCP-NQCGTPNIARE-DLANHVKDNCGSALVLCPFKDAGCKHRCPKLAIGRHLEDTTKSHLTM----MCNLVSRQRQEILELRREM-EELSVSHDGVLIWKLNDYSRKLQEAKLRSNHEFFSPPFYTHRYGYKLQVSAFLNGNGSGEGSHLSVYIRVLPGEYDNLLEWPFSYKVTFSILDQSDPSLSKPQHITETFNPDPNWKNF---QKPCSTRNSLDESTLGFGYPKFISHEEIKKR-NYIRDNCIFIKASIE 456          
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 121.324 bits (303), Expect = 3.066e-29
Identity = 134/503 (26.64%), Postives = 207/503 (41.15%), Query Frame = 3
Query:  255 EEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETKDAP--QCPKDN------EIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHY----------------------------RTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGE-LNEH------ENMFCPEVPISCRN-----------NCGIVKTLPRKLMLIHQNNQCPLEP-------RNCPFNMF-----GCKIQGNENEIENHLKRKAIPHLV-LMAEALTKNSLTLEN-SVQCLLD-EKL-----KCSALESRLTV-------FERL--------WGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKV 1496
            E+K+ C  C  +L  PVQ  +CGHR C  C+     +   P   C K+        I+N    F D    +E+ +L   C        L +GC W G + E+   +                            R C+ R + C + C     F++I+ H ++ C+    QC  C  + I  E  N+H          CP   + C++           +   ++ L   L ++    +  L+         +    ++     GC    +   ++   K  A+ ++V ++   + ++SLTLE  S Q  LD EK+     K   LE  LTV        E++        +    +WK+  FS +  +A SG     FSP F+SS YGYK+ L L   GDG  +G  LSLF  + R +YD LL+WPF  KVT  LLDQ      R+ ++ +F P++   +F    RP  E N   G   F  L+ L     Y  + TIF K 
Sbjct:   25 EDKYKCQQCLQVLRKPVQ-AQCGHRFCVHCFRQLTSSGPKPCQACRKEEIYEEPMSILNSSEAFPDNAAGREIASLPARC--------LNQGCDWTGSIKEYEAKHEGRCEFEQIQCEACQALVLRKDKDRHNDRECEERTLNC-KYCKVTFNFKDIKAH-DEICQKFPLQCKDCGKKKIPREKFNDHAKSCAKSKSACPFSEVGCKSVVENGKISEHEHSSTMEHLRLLLPMVLSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREVERSSLTLEAFSHQHRLDQEKIENLSNKIRQLERSLTVKDLQLSEAEQMVRELQYCTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQ----NNREHIIDAFRPDITSTSFQ---RPVSEMNIASGCPLFCPLAKLAGKSPYLRDDTIFIKA 509          
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Match: SMESG000003970.1 (SMESG000003970.1)

HSP 1 Score: 425.631 bits (1093), Expect = 4.394e-149
Identity = 221/221 (100.00%), Postives = 221/221 (100.00%), Query Frame = 3
Query:  843 MFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            MFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVTTTFFSPPFFSSHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ
Sbjct:    1 MFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVTTTFFSPPFFSSHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 221          
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Match: SMESG000016362.1 (SMESG000016362.1)

HSP 1 Score: 285.419 bits (729), Expect = 5.994e-92
Identity = 149/377 (39.52%), Postives = 222/377 (58.89%), Query Frame = 3
Query:  372 APQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            AP+CP D   I  D+V++D  FQKE+DNL + C      S  ++GC W GVL E  +H  +C  R +TCP  C    E + +  H    C     QC FC+  +I  E+  +    C + PI C N C   K + R+ +  H  ++C  + ++CPF+ +GC  +G +  +  HL    + HL LM EA+ +N+  +E   + +   + +    E R+   E+L+G QLIWK++ + +KF++AK+G  TT FS PF +S +GYK+AL +C +GDG A+GK  SLF+CIC+G+YD+LL WPF  ++TF+L+DQ  +   RK+VVY+  PN  K+N PFLGRPT +RN  FGA+KF+ L  L     Y  +  IF K  +
Sbjct:    4 APRCPIDQCHIERDKVYVDKEFQKEIDNLGVRC------SFYQKGCIWTGVLKELSNHLESCLHRMITCPNNCNVEFEIRFLEKHKQDDCPKRIIQCQFCEASLI-AEVEANHLKVCNKFPIPCPNGCK-KKEILRENLAEHLESKCVKQEQDCPFSEYGCDFKGKKKRVREHLNDDFVSHLTLMCEAIKENTRIVEEQSKIITQYQTEVGTFEKRIESLEKLYGPQLIWKIDNYQEKFNEAKTGKKTTIFSAPFMTSRFGYKMALSVCLYGDGKARGKHFSLFICICKGDYDSLLLWPFSHRITFTLIDQCQDPEARKNVVYTVKPNTCKENAPFLGRPTTDRNASFGAQKFVELDVLNTLD-YIRDDAIFIKAQV 371          
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Match: SMESG000003972.1 (SMESG000003972.1)

HSP 1 Score: 212.231 bits (539), Expect = 3.639e-67
Identity = 117/121 (96.69%), Postives = 117/121 (96.69%), Query Frame = 3
Query:    6 SLEYKSNENDLXXXXXXXXXXXXATVNSEEFEEIKRFSLNYKQVPTDVSSDDITKIIEHSIATAPSDWYKLRIKMVDFKLGENEEKFICYLCYTILHNPVQLEECGHRLCSKCWNSYRETK 368
            SLEYKSNENDLEEEIKEKIKSSSATVNSEE EEIKRFSLNYKQVPTDVSSDDITKIIEHSIATAPSDWYKLRIKMVD KLGENEEKFICYLC TILHNPVQLEECGHRLCSKCWNSY ETK
Sbjct:    2 SLEYKSNENDLEEEIKEKIKSSSATVNSEESEEIKRFSLNYKQVPTDVSSDDITKIIEHSIATAPSDWYKLRIKMVDLKLGENEEKFICYLCNTILHNPVQLEECGHRLCSKCWNSYGETK 122          
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Match: SMESG000006747.1 (SMESG000006747.1)

HSP 1 Score: 211.846 bits (538), Expect = 5.036e-62
Identity = 129/426 (30.28%), Postives = 214/426 (50.23%), Query Frame = 3
Query:  261 KFICYLCYTILHNPVQLEECGHRLCSKCW---NSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNNCGI------VKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRKAIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXX-XXXXXHYGYKLALGLCPFGDGIA-KGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDIQ 1505
            ++ C  C  IL NP++L+ CGH +C  C    +S++   D   CP D E   ED +     ++  + NL+IYC      ST+   C W G+L  F  H+ TC+ + + CP +C   I++ N   H    C +    C FC   +   +   HEN+ C E  I C N+C           L + ++  H  N C      CPF MFGCK +  + ++ +HL + AI HL ++     KN+ +LE  V+ +L+ K K    + ++ +    +G+QL+WK++  ++K+  A  G      S   + ++ YGYK  + L      +    ++LS+F+ IC   ++ LL WPF LK+   L++Q  E    K + + F+PN I +N+PF+ RP  +RNP+FG  KF + +   +   +     +F K+ I+
Sbjct:  112 EYFCEKCSRILWNPIKLK-CGHIICYTCQPFPDSFQ--NDVMNCPIDEETTKEDEIEQCENYKDNIWNLQIYC------STI--LCDWFGILSNFRSHFETCELKQIKCP-QCDEMIQWGNFEAHKLNTCEMRSVLCQFCSNPIFSKDAKSHENV-CDEKLIECPNSCKFPTDKTKAMILKQGILKFHLENACSERKVPCPFEMFGCKNKSKQKKMHHHLTKYAIIHLEMICSFGRKNTESLEKQVRFMLELKDKLERSDGKIKILNSEFGTQLLWKIDNINEKYQAALVGANEEIVSNPFYSTAPYGYKFIMRLVFNVHNVKLSSQYLSIFISICDSPFNVLLPWPFKLKLNIHLVNQISE----KHISHCFLPNTIVENYPFINRPKTQRNPYFGIEKFANCNIFHDNSPFVAGNAMFIKILIE 520          
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Match: SMESG000027123.1 (SMESG000027123.1)

HSP 1 Score: 154.451 bits (389), Expect = 2.205e-41
Identity = 132/439 (30.07%), Postives = 207/439 (47.15%), Query Frame = 3
Query:  270 CYLCYTILHNPVQLEECGHRLCSKCWNSY--RETKDAPQCPKDNEIINEDR-VFIDTGFQKELDNLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFIEFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEH-----ENMFCPEVPISCRNNCGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNEN-EIENHLKRKAIPHL-------------VLMAE------ALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQLIWKVERFSQKFSDAKSGVXXXXXXXXXXXXHYGYKLALGLCPFGDGIAKGKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVPNVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI 1502
            C +C ++L N  Q  +CG ++C  C N Y  +  KD P     NE+++ D+ ++ D    KE+ NLKI CP         +GC+    + +   H ++C++R VTC   C   I  +  + HI+ +C +   +C FC   + +  LNE      +N  C E    C NNCG  K L  KL L     +  L  ++   N     IQ   N ++ N LK+ A+ +              V++ E      ALT++++ L   +  L  E+     + ++   F        IWK++    +  +A+     +  S PF++S +GYKL L + P GDG+ KG  LS+F  + +GEYD+LL WPF  K+T SLLDQ    +   D   +F P+      P   RP  + N   G+ KF S+S L     Y  N TI+ K+ +
Sbjct:   27 CIICSSLLKNAKQ-TKCGCKVCENCINEYLSKGPKDCPNKECLNELLSIDKDIYNDNATNKEILNLKIACPF--------KGCAQLETVFKISQHVKSCEYRDVTCD-PCQKRILAKEKQKHIDGECEMRITKCEFCHKTMTIKYLNEMHLNTTKNELCSEYVGHCPNNCGETKELNLKLHL-----ETCLNRKSDDQNDTNYHIQEFSNTQLSNLLKQIALLNQTSKDLLTKLENQDVIIREMSTKYIALTEDNIKLTKKINALEAERSNPVKIIAKTNDFR---NGSFIWKIKDLKSQIQNAERSERLSITSDPFYTSEFGYKLCLRVYPSGDGLGKGTHLSVFFALMKGEYDDLLPWPFRQKLTLSLLDQENFTKHYSD---TFKPD---PKSPCFQRPILDSNIASGSPKFYSISHLSFNSIYYKNDTIYIKITV 441          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF38.950e-4029.73TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF41.486e-3825.98TNF receptor associated factor 4 [Source:HGNC Symb... [more]
TRAF52.571e-3632.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF52.571e-3632.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
TRAF52.571e-3632.13TNF receptor associated factor 5 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.958e-5832.12TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-22.936e-2427.53TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf43.830e-3225.83gene:FBgn0026319 transcript:FBtr0334401[more]
Traf44.778e-3225.83gene:FBgn0026319 transcript:FBtr0077429[more]
Traf61.947e-1120.61gene:FBgn0265464 transcript:FBtr0071188[more]
CG90141.230e-728.03gene:FBgn0028847 transcript:FBtr0343664[more]
CG90141.230e-728.03gene:FBgn0028847 transcript:FBtr0080579[more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a4.189e-4630.21tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4a4.189e-4630.21tnf receptor-associated factor 4a [Source:ZFIN;Acc... [more]
traf4b7.999e-4027.38tnf receptor-associated factor 4b [Source:ZFIN;Acc... [more]
traf33.618e-3231.44TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
traf61.890e-2727.31TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sytl22.005e-4527.66synaptotagmin like 2 [Source:Xenbase;Acc:XB-GENE-9... [more]
ssh29.250e-3133.77slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF29.665e-3027.25TNF receptor associated factor 2 [Source:NCBI gene... [more]
ssh22.790e-2827.62slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
TRAF21.667e-1936.98TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf57.893e-4234.62TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf57.893e-4234.62TNF receptor-associated factor 5 [Source:MGI Symbo... [more]
Traf45.950e-4125.77TNF receptor associated factor 4 [Source:MGI Symbo... [more]
Traf21.097e-3427.15TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
Traf27.008e-3427.17TNF receptor-associated factor 2 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P70191|TRAF5_MOUSE6.796e-4132.26TNF receptor-associated factor 5 OS=Mus musculus O... [more]
sp|Q61382|TRAF4_MOUSE4.162e-4025.77TNF receptor-associated factor 4 OS=Mus musculus O... [more]
sp|Q9BUZ4|TRAF4_HUMAN7.135e-3825.98TNF receptor-associated factor 4 OS=Homo sapiens O... [more]
sp|O00463|TRAF5_HUMAN1.235e-3532.13TNF receptor-associated factor 5 OS=Homo sapiens O... [more]
sp|Q12933|TRAF2_HUMAN3.844e-3526.94TNF receptor-associated factor 2 OS=Homo sapiens O... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3M7SHF54.594e-9839.24TNF receptor-associated factor 4-like OS=Brachionu... [more]
A0A1S3KE248.002e-9738.46TNF receptor-associated factor 4 OS=Lingula unguis... [more]
A0A267ELC71.265e-9338.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267DPF26.321e-9338.15Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A5K4F9L54.727e-9234.92Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf4a1.375e-4529.38TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4b2.798e-3926.77TNF receptor-associated factor 4-like [Source:NCBI... [more]
traf51.198e-2824.76TNF receptor-associated factor 5 [Source:NCBI gene... [more]
traf2a2.112e-2626.92TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf61.411e-2225.80TNF receptor associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000002130.11.277e-2237.58pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
traf62.399e-2121.58TNF receptor-associated factor 6 [Source:NCBI gene... [more]
ENSPMAT00000000074.14.484e-2135.23pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000008091.13.639e-1223.21pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO328492.479e-6931.49Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO328511.124e-6732.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO459151.048e-6129.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495451.040e-4629.05Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487736.384e-4428.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.634e-5432.05TNF receptor associated factor 3 [Source:NCBI gene... [more]
traf4a7.650e-4630.00TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a1.243e-4529.50TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf4a7.852e-4129.55TNF receptor associated factor 4 [Source:NCBI gene... [more]
traf2b3.066e-2926.64TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor 4-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003970.14.394e-149100.00SMESG000003970.1[more]
SMESG000016362.15.994e-9239.52SMESG000016362.1[more]
SMESG000003972.13.639e-6796.69SMESG000003972.1[more]
SMESG000006747.15.036e-6230.28SMESG000006747.1[more]
SMESG000027123.12.205e-4130.07SMESG000027123.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016228 ID=SMED30016228|Name=TNF receptor-associated factor 4-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1506bp
TCCGATCTCTCGAGTATAAGAGCAATGAAAATGATCTTGAAGAAGAAATT
AAAGAGAAAATTAAGAGTTCTTCAGCCACGGTCAACAGTGAGGAGTTTGA
GGAAATTAAGAGATTCTCGTTAAATTACAAGCAAGTTCCTACCGATGTTT
CATCCGATGACATAACGAAAATCATTGAACATAGCATTGCCACGGCTCCG
TCGGATTGGTATAAATTAAGAATAAAAATGGTGGACTTTAAGCTTGGGGA
AAATGAAGAAAAATTCATCTGCTATTTATGCTATACGATTTTGCACAATC
CCGTCCAACTGGAGGAATGCGGCCACAGGTTATGTAGCAAATGCTGGAAC
TCCTACAGAGAAACCAAAGATGCGCCTCAATGTCCTAAAGACAATGAAAT
AATAAACGAAGATCGTGTTTTTATAGATACAGGCTTTCAGAAAGAATTGG
ACAATCTTAAAATATATTGCCCACAGAACGCAGTTTTATCAACTTTGAAA
GAGGGGTGCTCTTGGCAAGGTGTTTTAGGTGAATTCATCGATCACTATAG
AACTTGCCAATGGAGACCAGTAACATGTCCTAGAGAGTGTGGATATTTCA
TAGAATTTCAAAATATTAGAGATCATATTAATCAAAAGTGCCGATTGACT
TGGCGTCAGTGTAATTTCTGTAAGATTCAAGTTATTGTTGGTGAATTAAA
TGAACATGAAAATATGTTTTGCCCTGAGGTTCCAATTTCCTGCCGAAATA
ATTGCGGTATTGTTAAAACCTTACCAAGAAAGTTAATGTTAATTCATCAG
AATAACCAGTGTCCCCTTGAACCCCGCAATTGTCCTTTTAATATGTTTGG
TTGTAAAATTCAAGGAAACGAAAATGAGATTGAAAATCATTTAAAACGAA
AAGCAATACCTCACCTGGTTCTTATGGCTGAAGCTCTAACTAAAAACTCA
TTAACTTTAGAAAATTCTGTTCAATGTCTATTAGATGAAAAATTAAAATG
CTCAGCATTAGAGAGCAGACTCACTGTCTTTGAAAGATTATGGGGATCTC
AACTGATTTGGAAAGTTGAAAGATTTTCTCAAAAATTTAGTGATGCAAAA
TCTGGAGTAACGACTACATTTTTCAGTCCACCTTTCTTTTCAAGTCACTA
TGGTTATAAATTGGCCTTGGGTTTGTGTCCGTTTGGAGATGGCATTGCTA
AAGGTAAATTTTTATCTTTGTTTGTCTGTATATGTCGAGGTGAATATGAT
AATTTATTACAATGGCCATTTCCACTAAAAGTGACCTTTAGTTTACTTGA
TCAGGCCCCAGAATTTAGGAAAAGAAAAGATGTGGTTTATTCGTTCGTTC
CTAATGTAATCAAGGACAATTTTCCATTTTTGGGACGACCAACAGGTGAA
AGGAATCCATTTTTTGGAGCCCGAAAATTTATTAGTTTATCTTCATTGAT
GGAATATGGAACATATACATTAAATCAAACAATATTTTTCAAAGTTGATA
TTCAAG
back to top

protein sequence of SMED30016228-orf-1

>SMED30016228-orf-1 ID=SMED30016228-orf-1|Name=SMED30016228-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=501bp
RSLEYKSNENDLEEEIKEKIKSSSATVNSEEFEEIKRFSLNYKQVPTDVS
SDDITKIIEHSIATAPSDWYKLRIKMVDFKLGENEEKFICYLCYTILHNP
VQLEECGHRLCSKCWNSYRETKDAPQCPKDNEIINEDRVFIDTGFQKELD
NLKIYCPQNAVLSTLKEGCSWQGVLGEFIDHYRTCQWRPVTCPRECGYFI
EFQNIRDHINQKCRLTWRQCNFCKIQVIVGELNEHENMFCPEVPISCRNN
CGIVKTLPRKLMLIHQNNQCPLEPRNCPFNMFGCKIQGNENEIENHLKRK
AIPHLVLMAEALTKNSLTLENSVQCLLDEKLKCSALESRLTVFERLWGSQ
LIWKVERFSQKFSDAKSGVTTTFFSPPFFSSHYGYKLALGLCPFGDGIAK
GKFLSLFVCICRGEYDNLLQWPFPLKVTFSLLDQAPEFRKRKDVVYSFVP
NVIKDNFPFLGRPTGERNPFFGARKFISLSSLMEYGTYTLNQTIFFKVDI
Q
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0016567protein ubiquitination
GO:0007165signal transduction
GO:0007250activation of NF-kappaB-inducing kinase activity
GO:0046330positive regulation of JNK cascade
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR002083MATH/TRAF_dom
IPR013083Znf_RING/FYVE/PHD
IPR008974TRAF-like
IPR013323SIAH-type
IPR001293Znf_TRAF
IPR001841Znf_RING
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular