Calcium/calmodulin-dependent protein kinase Ib

Overview
NameCalcium/calmodulin-dependent protein kinase Ib
Smed IDSMED30016222
Length (bp)291
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calcium/calmodulin-dependent protein kinase Ib (SMED30016222) t-SNE clustered cells

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase Ib (SMED30016222) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Calcium/calmodulin-dependent protein kinase Ib (SMED30016222) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Calcium/calmodulin-dependent protein kinase Ib (SMED30016222) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016222

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30016222SMESG000078937.1 SmedASXL_019418SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30016222SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30016222SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30016222SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016222SMESG000078937.1 dd_Smed_v6_5783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30016222SMESG000078937.1 OX_Smed_1.0.21549ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016222SMESG000078937.1 dd_Smed_v4_5783_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Match: CAMK1 (calcium/calmodulin dependent protein kinase I [Source:HGNC Symbol;Acc:HGNC:1459])

HSP 1 Score: 56.9954 bits (136), Expect = 1.913e-10
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y F++VLGTGAFSEV LAED   +  VA+KCI K+A+              + +E S++NEI+VL
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEAL--------------EGKEGSMENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 56.6102 bits (135), Expect = 2.770e-10
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE LGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKAL--------------KGKESSIENEIAVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Match: CAMK1D (calcium/calmodulin dependent protein kinase ID [Source:HGNC Symbol;Acc:HGNC:19341])

HSP 1 Score: 56.6102 bits (135), Expect = 2.801e-10
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE LGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKAL--------------KGKESSIENEIAVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 48.9062 bits (115), Expect = 1.309e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   86 SRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S Y+ +E LG+GAFSEV LA++      VA+KCI KKA+              + +E  ++NEI+VLR
Sbjct:   13 SVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKAL--------------RGKEALVENEIAVLR 66          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Match: PNCK (pregnancy up-regulated nonubiquitous CaM kinase [Source:HGNC Symbol;Acc:HGNC:13415])

HSP 1 Score: 49.2914 bits (116), Expect = 1.414e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   86 SRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S Y+ +E LG+GAFSEV LA++      VA+KCI KKA+              + +E  ++NEI+VLR
Sbjct:   13 SVYEIRERLGSGAFSEVVLAQERGSAHLVALKCIPKKAL--------------RGKEALVENEIAVLR 66          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Celegans
Match: cmk-1 (Calcium/calmodulin-dependent protein kinase type 1 [Source:UniProtKB/Swiss-Prot;Acc:Q9TXJ0])

HSP 1 Score: 51.2174 bits (121), Expect = 7.171e-9
Identity = 31/68 (45.59%), Postives = 42/68 (61.76%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAED-TEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y F++VLGTGAFS+V LAE  ++     AVKCI KKA+              + +E+SL+NEI VLR
Sbjct:   21 KYDFRDVLGTGAFSKVFLAESKSDAGQMYAVKCIDKKAL--------------KGKEESLENEIKVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0333670)

HSP 1 Score: 50.0618 bits (118), Expect = 2.638e-8
Identity = 32/69 (46.38%), Postives = 40/69 (57.97%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAE--DTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y    +LGTGAFSEVRLAE  D+    F AVK I KKA+              + +E+SL+NEI VLR
Sbjct:   30 KYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDKKAL--------------KGKEESLENEIRVLR 83          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089067)

HSP 1 Score: 50.0618 bits (118), Expect = 3.009e-8
Identity = 32/69 (46.38%), Postives = 40/69 (57.97%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAE--DTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y    +LGTGAFSEVRLAE  D+    F AVK I KKA+              + +E+SL+NEI VLR
Sbjct:   30 KYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDKKAL--------------KGKEESLENEIRVLR 83          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089065)

HSP 1 Score: 50.0618 bits (118), Expect = 3.009e-8
Identity = 32/69 (46.38%), Postives = 40/69 (57.97%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAE--DTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y    +LGTGAFSEVRLAE  D+    F AVK I KKA+              + +E+SL+NEI VLR
Sbjct:   30 KYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDKKAL--------------KGKEESLENEIRVLR 83          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Fly
Match: CaMKI (gene:FBgn0016126 transcript:FBtr0089069)

HSP 1 Score: 50.0618 bits (118), Expect = 3.009e-8
Identity = 32/69 (46.38%), Postives = 40/69 (57.97%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAE--DTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y    +LGTGAFSEVRLAE  D+    F AVK I KKA+              + +E+SL+NEI VLR
Sbjct:   30 KYNLHGLLGTGAFSEVRLAESKDSPGEHF-AVKIIDKKAL--------------KGKEESLENEIRVLR 83          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 62.3882 bits (150), Expect = 1.404e-12
Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y FKEVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E+S++NEI+VL 
Sbjct:   21 YDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKAL--------------EGKENSIENEIAVLH 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 62.3882 bits (150), Expect = 1.747e-12
Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y FKEVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E+S++NEI+VL 
Sbjct:   21 YDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKAL--------------EGKENSIENEIAVLH 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 62.3882 bits (150), Expect = 1.747e-12
Identity = 32/66 (48.48%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y FKEVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E+S++NEI+VL 
Sbjct:   21 YDFKEVLGTGAFSEVFLAEEKKTQRLVAIKCIPKKAL--------------EGKENSIENEIAVLH 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 61.6178 bits (148), Expect = 2.758e-12
Identity = 34/65 (52.31%), Postives = 42/65 (64.62%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y FKEVLGTGAFSEV LAE+   R  VAVKCI KKA+              + +E+S++NEI+VL
Sbjct:   21 YDFKEVLGTGAFSEVMLAEEKRTRKLVAVKCIAKKAL--------------EGKENSIENEIAVL 71          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Match: camk1da (calcium/calmodulin-dependent protein kinase 1Da [Source:ZFIN;Acc:ZDB-GENE-080402-7])

HSP 1 Score: 56.6102 bits (135), Expect = 1.983e-10
Identity = 32/66 (48.48%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKEVLGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   25 FEFKEVLGTGAFSEVVLAEERSTGKMYAVKCIPKKAL--------------KGKESSIENEIAVLR 76          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 60.4622 bits (145), Expect = 9.038e-12
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+F+EVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E S++NEI+VLR
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPKKAL--------------EGKETSIENEIAVLR 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 60.4622 bits (145), Expect = 1.140e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+F+EVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E S++NEI+VLR
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPKKAL--------------EGKETSIENEIAVLR 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 60.077 bits (144), Expect = 1.390e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+F+EVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E S++NEI+VLR
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPKKAL--------------EGKETSIENEIAVLR 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 59.6918 bits (143), Expect = 1.866e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+F+EVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E S++NEI+VLR
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPKKAL--------------EGKETSIENEIAVLR 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Match: dnz1 (DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbase;Acc:XB-GENE-5747351])

HSP 1 Score: 59.6918 bits (143), Expect = 2.130e-11
Identity = 32/66 (48.48%), Postives = 44/66 (66.67%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+F+EVLGTGAFSEV LAE+ + +  VA+KCI KKA+              + +E S++NEI+VLR
Sbjct:   21 YEFREVLGTGAFSEVVLAEEKKTQKLVAIKCIPKKAL--------------EGKETSIENEIAVLR 72          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Match: Camk1 (calcium/calmodulin-dependent protein kinase I [Source:MGI Symbol;Acc:MGI:1098535])

HSP 1 Score: 57.7658 bits (138), Expect = 6.709e-11
Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y F++VLGTGAFSEV LAED   +  VA+KCI KKA+              + +E S++NEI+VL
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKAL--------------EGKEGSMENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Match: Camk1d (calcium/calmodulin-dependent protein kinase ID [Source:MGI Symbol;Acc:MGI:2442190])

HSP 1 Score: 56.9954 bits (136), Expect = 1.492e-10
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE LGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKAL--------------KGKESSIENEIAVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 49.6766 bits (117), Expect = 3.625e-8
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   86 SRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S Y+ +E LG+GAFSEV LA++      VA+KCI KKA+              + +E  ++NEI+VLR
Sbjct:   13 SVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKAL--------------RGKEALVENEIAVLR 66          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 47.7506 bits (112), Expect = 2.532e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   86 SRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S Y+ +E LG+GAFSEV LA++      VA+KCI KKA+              + +E  ++NEI+VLR
Sbjct:   13 SVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKAL--------------RGKEALVENEIAVLR 66          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Match: Pnck (pregnancy upregulated non-ubiquitously expressed CaM kinase [Source:MGI Symbol;Acc:MGI:1347357])

HSP 1 Score: 47.7506 bits (112), Expect = 2.532e-7
Identity = 28/68 (41.18%), Postives = 40/68 (58.82%), Query Frame = 2
Query:   86 SRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S Y+ +E LG+GAFSEV LA++      VA+KCI KKA+              + +E  ++NEI+VLR
Sbjct:   13 SVYEIREKLGSGAFSEVMLAQERGSAHLVALKCIPKKAL--------------RGKEALVENEIAVLR 66          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Match: sp|Q91YS8|KCC1A_MOUSE (Calcium/calmodulin-dependent protein kinase type 1 OS=Mus musculus OX=10090 GN=Camk1 PE=1 SV=1)

HSP 1 Score: 57.7658 bits (138), Expect = 4.693e-10
Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y F++VLGTGAFSEV LAED   +  VA+KCI KKA+              + +E S++NEI+VL
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKAL--------------EGKEGSMENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Match: sp|Q63450|KCC1A_RAT (Calcium/calmodulin-dependent protein kinase type 1 OS=Rattus norvegicus OX=10116 GN=Camk1 PE=1 SV=2)

HSP 1 Score: 57.7658 bits (138), Expect = 5.434e-10
Identity = 31/65 (47.69%), Postives = 41/65 (63.08%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y F++VLGTGAFSEV LAED   +  VA+KCI KKA+              + +E S++NEI+VL
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKKAL--------------EGKEGSMENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Match: sp|Q14012|KCC1A_HUMAN (Calcium/calmodulin-dependent protein kinase type 1 OS=Homo sapiens OX=9606 GN=CAMK1 PE=1 SV=1)

HSP 1 Score: 56.9954 bits (136), Expect = 9.186e-10
Identity = 30/65 (46.15%), Postives = 41/65 (63.08%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y F++VLGTGAFSEV LAED   +  VA+KCI K+A+              + +E S++NEI+VL
Sbjct:   20 YDFRDVLGTGAFSEVILAEDKRTQKLVAIKCIAKEAL--------------EGKEGSMENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Match: sp|Q8BW96|KCC1D_MOUSE (Calcium/calmodulin-dependent protein kinase type 1D OS=Mus musculus OX=10090 GN=Camk1d PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 1.044e-9
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE LGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKAL--------------KGKESSIENEIAVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Match: sp|Q8IU85|KCC1D_HUMAN (Calcium/calmodulin-dependent protein kinase type 1D OS=Homo sapiens OX=9606 GN=CAMK1D PE=1 SV=1)

HSP 1 Score: 56.6102 bits (135), Expect = 1.345e-9
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE LGTGAFSEV LAE+       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   23 FEFKETLGTGAFSEVVLAEEKATGKLFAVKCIPKKAL--------------KGKESSIENEIAVLR 74          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Match: A0A1I8GKE8 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 98.5969 bits (244), Expect = 1.219e-23
Identity = 49/75 (65.33%), Postives = 58/75 (77.33%), Query Frame = 2
Query:   71 FTSSLSRYQFKEVLGTGAFSEVRLAED--TEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
              S + RY+FK+VLGTGAFSEVRLA D  +    +VA+KCIKK+AI A  RAS KDKQEAQ RE+SLKNEI VL+
Sbjct:    8 INSEIQRYEFKDVLGTGAFSEVRLARDKWSSSEHYVAIKCIKKRAIKAPGRASEKDKQEAQGREESLKNEIRVLK 82          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Match: A0A267FDS5 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig024676g1 PE=3 SV=1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.722e-22
Identity = 50/75 (66.67%), Postives = 58/75 (77.33%), Query Frame = 2
Query:   71 FTSSLSRYQFKEVLGTGAFSEVRLAEDTEKRS--FVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
              S + RY+FK+VLGTGAFSEVRLA D    S  +VA+KCIKK+AI A  RAS KDKQEAQ RE+SLKNEI VL+
Sbjct:    8 INSEIQRYEFKDVLGTGAFSEVRLARDKWSSSEHYVAIKCIKKRAIKAPGRASEKDKQEAQGREESLKNEIRVLK 82          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Match: A0A1I8IY04 (Protein kinase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 1.378e-21
Identity = 49/69 (71.01%), Postives = 56/69 (81.16%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAEDTEKRS--FVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            RY+FK+VLGTGAFSEVRLA D    S  +VA+KCIKK+AI A  RAS KDKQEAQ RE+SLKNEI VL+
Sbjct:   29 RYEFKDVLGTGAFSEVRLARDKWSSSEHYVAIKCIKKRAIKAPGRASEKDKQEAQGREESLKNEIRVLK 97          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Match: A0A4E0RWC7 (Calcium/calmodulin-dependent protein kinase Ib OS=Fasciola hepatica OX=6192 GN=D915_002235 PE=3 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 2.996e-17
Identity = 44/76 (57.89%), Postives = 57/76 (75.00%), Query Frame = 2
Query:   65 MNFTSSLSRYQFKEVLGTGAFSEVRLAEDTEKR-SFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            M F  S+ R+ F+EVLGTGAFSEVRLAED E   SFVA+KCI+KK ++ S  + N  + EA++R++SL NEI VLR
Sbjct:   50 MTFGKSIKRFDFREVLGTGAFSEVRLAEDLENPGSFVAIKCIRKKFLSKSQNSENS-RNEAESRKESLNNEIEVLR 124          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Match: A0A183R8H0 (Protein kinase domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 2.021e-15
Identity = 41/71 (57.75%), Postives = 53/71 (74.65%), Query Frame = 2
Query:   80 SLSRYQFKEVLGTGAFSEVRLAEDTEKR-SFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            S+  Y+FKE+LGTGAFSEVRLAED     SFVA+KCI+KK ++ S  +    K EA++R++SL NEI VLR
Sbjct:    6 SIDHYEFKEILGTGAFSEVRLAEDQRNPGSFVAIKCIRKKYLSKSQNSECAIK-EAESRKESLNNEIEVLR 75          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Match: camk1a (calcium/calmodulin-dependent protein kinase Ia [Source:ZFIN;Acc:ZDB-GENE-131120-147])

HSP 1 Score: 59.3066 bits (142), Expect = 1.613e-11
Identity = 34/66 (51.52%), Postives = 43/66 (65.15%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            RY FKEVLGTGAFSEV LAE+   +  VAVKCI KKA+              + +E+S++NEI+VL
Sbjct:   19 RYDFKEVLGTGAFSEVVLAEEKGTQRLVAVKCIPKKAL--------------EGKENSIENEIAVL 70          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Match: camk1b (calcium/calmodulin-dependent protein kinase Ib [Source:ZFIN;Acc:ZDB-GENE-141014-1])

HSP 1 Score: 57.7658 bits (138), Expect = 5.297e-11
Identity = 32/65 (49.23%), Postives = 42/65 (64.62%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            Y FK+VLGTGAFSEV LAE+   R  VA+KCI KKA+              + +E+S++NEI+VL
Sbjct:   21 YDFKDVLGTGAFSEVVLAEEKRTRRLVAIKCIPKKAL--------------EGKENSIENEIAVL 71          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Match: camk1db (calcium/calmodulin-dependent protein kinase type 1D-like [Source:NCBI gene;Acc:103041809])

HSP 1 Score: 54.299 bits (129), Expect = 1.006e-9
Identity = 29/66 (43.94%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++ KE+LGTGAFSEV LA++       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   24 FELKEILGTGAFSEVVLAQERSTGKMYAVKCIPKKAL--------------RGKESSIENEIAVLR 75          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Match: camk1da (calcium/calmodulin-dependent protein kinase 1Da [Source:ZFIN;Acc:ZDB-GENE-080402-7])

HSP 1 Score: 52.373 bits (124), Expect = 4.071e-9
Identity = 30/66 (45.45%), Postives = 41/66 (62.12%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            ++FKE+LGTGAFSEV LA++       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   24 FEFKEILGTGAFSEVVLAQERATGKMFAVKCIPKKAL--------------KGKESSIENEIAVLR 75          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Match: pnck (calcium/calmodulin-dependent protein kinase type 1B-like [Source:NCBI gene;Acc:103046554])

HSP 1 Score: 51.2174 bits (121), Expect = 1.023e-8
Identity = 27/66 (40.91%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            Y+ +E LG G+FSEVR+A+  +    VAVKCI+K+A+              + +E  L+NEI+VLR
Sbjct:   18 YELREKLGEGSFSEVRVAQHRKTHKLVAVKCIRKRAL--------------KGKESMLENEIAVLR 69          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Nematostella
Match: EDO36253 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJ85])

HSP 1 Score: 54.299 bits (129), Expect = 3.359e-10
Identity = 30/67 (44.78%), Postives = 41/67 (61.19%), Query Frame = 2
Query:   89 RYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            +Y  +EVLGTGAFSEV LAE+    S  AVKCI KK              E + +E+S++NEI++L+
Sbjct:   16 KYDLREVLGTGAFSEVVLAEEKATGSLFAVKCISKK--------------ELKGKEESVENEIAILK 68          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 58.5362 bits (140), Expect = 2.816e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 2
Query:   74 TSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            T    +Y FKE+LGTGAFSEV LAE+      VA+KCI KKA+              + +E+S++NEI+VL
Sbjct:   51 TDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKAL--------------EGKENSIENEIAVL 107          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 58.5362 bits (140), Expect = 3.133e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 2
Query:   74 TSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            T    +Y FKE+LGTGAFSEV LAE+      VA+KCI KKA+              + +E+S++NEI+VL
Sbjct:   15 TDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKAL--------------EGKENSIENEIAVL 71          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 58.5362 bits (140), Expect = 3.191e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 2
Query:   74 TSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            T    +Y FKE+LGTGAFSEV LAE+      VA+KCI KKA+              + +E+S++NEI+VL
Sbjct:   28 TDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKAL--------------EGKENSIENEIAVL 84          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Match: camk1b (calcium/calmodulin-dependent protein kinase type 1 [Source:NCBI gene;Acc:101170017])

HSP 1 Score: 57.7658 bits (138), Expect = 5.422e-11
Identity = 32/71 (45.07%), Postives = 43/71 (60.56%), Query Frame = 2
Query:   74 TSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVL 286
            T    +Y FKE+LGTGAFSEV LAE+      VA+KCI KKA+              + +E+S++NEI+VL
Sbjct:   33 TDVKEQYDFKEILGTGAFSEVVLAEEKRTHKLVAIKCIPKKAL--------------EGKENSIENEIAVL 89          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Match: camk1da (calcium/calmodulin dependent protein kinase ID [Source:NCBI gene;Acc:101162588])

HSP 1 Score: 56.225 bits (134), Expect = 2.373e-10
Identity = 31/66 (46.97%), Postives = 40/66 (60.61%), Query Frame = 2
Query:   92 YQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            + FKEVLGTGAFSEV LA++       AVKCI KKA+              + +E S++NEI+VLR
Sbjct:   25 FDFKEVLGTGAFSEVVLAQEKLSGRMFAVKCIPKKAL--------------KGKESSIENEIAVLR 76          
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Planmine SMEST
Match: SMESG000078937.1 (SMESG000078937.1)

HSP 1 Score: 150.599 bits (379), Expect = 5.886e-46
Identity = 75/75 (100.00%), Postives = 75/75 (100.00%), Query Frame = 2
Query:   65 MNFTSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 289
            MNFTSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR
Sbjct:    1 MNFTSSLSRYQFKEVLGTGAFSEVRLAEDTEKRSFVAVKCIKKKAITASSRASNKDKQEAQAREDSLKNEISVLR 75          
The following BLAST results are available for this feature:
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAMK11.913e-1046.15calcium/calmodulin dependent protein kinase I [Sou... [more]
CAMK1D2.770e-1046.97calcium/calmodulin dependent protein kinase ID [So... [more]
CAMK1D2.801e-1046.97calcium/calmodulin dependent protein kinase ID [So... [more]
PNCK1.309e-841.18pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
PNCK1.414e-841.18pregnancy up-regulated nonubiquitous CaM kinase [S... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cmk-17.171e-945.59Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CaMKI2.638e-846.38gene:FBgn0016126 transcript:FBtr0333670[more]
CaMKI3.009e-846.38gene:FBgn0016126 transcript:FBtr0089067[more]
CaMKI3.009e-846.38gene:FBgn0016126 transcript:FBtr0089065[more]
CaMKI3.009e-846.38gene:FBgn0016126 transcript:FBtr0089069[more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1a1.404e-1248.48calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a1.747e-1248.48calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1a1.747e-1248.48calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1b2.758e-1252.31calcium/calmodulin-dependent protein kinase Ib [So... [more]
camk1da1.983e-1048.48calcium/calmodulin-dependent protein kinase 1Da [S... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dnz19.038e-1248.48DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.140e-1148.48DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.390e-1148.48DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz11.866e-1148.48DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
dnz12.130e-1148.48DNZDHHC/NEW1 zinc finger protein 11 [Source:Xenbas... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Camk16.709e-1147.69calcium/calmodulin-dependent protein kinase I [Sou... [more]
Camk1d1.492e-1046.97calcium/calmodulin-dependent protein kinase ID [So... [more]
Pnck3.625e-841.18pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck2.532e-741.18pregnancy upregulated non-ubiquitously expressed C... [more]
Pnck2.532e-741.18pregnancy upregulated non-ubiquitously expressed C... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q91YS8|KCC1A_MOUSE4.693e-1047.69Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q63450|KCC1A_RAT5.434e-1047.69Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q14012|KCC1A_HUMAN9.186e-1046.15Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q8BW96|KCC1D_MOUSE1.044e-946.97Calcium/calmodulin-dependent protein kinase type 1... [more]
sp|Q8IU85|KCC1D_HUMAN1.345e-946.97Calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GKE81.219e-2365.33Protein kinase domain-containing protein OS=Macros... [more]
A0A267FDS52.722e-2266.67Protein kinase domain-containing protein OS=Macros... [more]
A0A1I8IY041.378e-2171.01Protein kinase domain-containing protein OS=Macros... [more]
A0A4E0RWC72.996e-1757.89Calcium/calmodulin-dependent protein kinase Ib OS=... [more]
A0A183R8H02.021e-1557.75Protein kinase domain-containing protein OS=Schist... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1a1.613e-1151.52calcium/calmodulin-dependent protein kinase Ia [So... [more]
camk1b5.297e-1149.23calcium/calmodulin-dependent protein kinase Ib [So... [more]
camk1db1.006e-943.94calcium/calmodulin-dependent protein kinase type 1... [more]
camk1da4.071e-945.45calcium/calmodulin-dependent protein kinase 1Da [S... [more]
pnck1.023e-840.91calcium/calmodulin-dependent protein kinase type 1... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362533.359e-1044.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
camk1b2.816e-1145.07calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b3.133e-1145.07calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b3.191e-1145.07calcium/calmodulin-dependent protein kinase type 1... [more]
camk1b5.422e-1145.07calcium/calmodulin-dependent protein kinase type 1... [more]
camk1da2.373e-1046.97calcium/calmodulin dependent protein kinase ID [So... [more]
back to top
BLAST of Calcium/calmodulin-dependent protein kinase Ib vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000078937.15.886e-46100.00SMESG000078937.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016222 ID=SMED30016222|Name=Calcium/calmodulin-dependent protein kinase Ib|organism=Schmidtea mediterranea sexual|type=transcript|length=291bp
ATTTAATTGTCATGCACCCTAAACAGTTGCTTCATTTGTATTTCTTTTAA
GAATAAAATTAAATATGAATTTTACAAGTTCACTTTCTCGATATCAATTT
AAAGAAGTCTTAGGAACAGGAGCATTTTCAGAAGTAAGATTAGCTGAAGA
TACTGAAAAAAGGTCGTTTGTAGCTGTTAAATGTATTAAGAAAAAAGCTA
TTACCGCTTCTTCACGTGCAAGTAATAAAGATAAACAAGAGGCGCAAGCT
CGAGAAGATTCTTTAAAAAATGAAATTAGTGTTTTAAGAAA
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017441Protein_kinase_ATP_BS
IPR000719Prot_kinase_dom
IPR011009Kinase-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 50..75
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 2..75
e-value: 5.2E-15
score: 57.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 56..75
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 47..75
NoneNo IPR availablePANTHERPTHR24347:SF197CALCIUM/CALMODULIN-DEPENDENT PROTEIN KINASE TYPE 1coord: 9..49
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 9..49
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 16..43
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 10..75
score: 10.068
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 6..43