Wnt5

Overview
NameWnt5 (ACJ64864.1)
Smed IDSMED30016207
Length (bp)1332
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Wnt5 (SMED30016207) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Wnt5 (SMED30016207) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016207

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 32

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 ACJ64864.1smed_ncbi_20200123PMID:20707997
Gurley et al., 2010
whole organism asexual adult fluorescence in situ hybridization evidence
headSMED30016207SMESG000055035.1 SmedASXL_014959SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
muscle cellSMED30016207SMESG000055035.1 dd_Smed_v4_15469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016207SMESG000055035.1 dd_Smed_v4_15469_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30016207SMESG000055035.1 dd_Smed_v6_15469_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:18063757
Gurley et al., 2008
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:21295483
Gaviño et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:21295483
Gaviño et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:21295483
Gaviño et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749.1smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
ventral nerve cordSMED30016207SMESG000055035.1 FJ463749smed_ncbi_20200123PMID:19211673
Adell et al., 2009
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Wnt5 vs. Ensembl Human
Match: WNT5B (Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:16265])

HSP 1 Score: 327.791 bits (839), Expect = 4.994e-109
Identity = 154/345 (44.64%), Postives = 217/345 (62.90%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF HA+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +   +++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  ++    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC ++C+ C  +   ++C
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKG-RLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYIC 358          
BLAST of Wnt5 vs. Ensembl Human
Match: WNT5B (Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:16265])

HSP 1 Score: 327.791 bits (839), Expect = 4.994e-109
Identity = 154/345 (44.64%), Postives = 217/345 (62.90%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF HA+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +   +++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  ++    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC ++C+ C  +   ++C
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKG-RLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYIC 358          
BLAST of Wnt5 vs. Ensembl Human
Match: WNT5B (Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:16265])

HSP 1 Score: 327.791 bits (839), Expect = 4.994e-109
Identity = 154/345 (44.64%), Postives = 217/345 (62.90%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF HA+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +   +++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  ++    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC ++C+ C  +   ++C
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKG-RLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYIC 358          
BLAST of Wnt5 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 317.775 bits (813), Expect = 5.024e-105
Identity = 152/345 (44.06%), Postives = 212/345 (61.45%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW+   L   N    SE   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN+ Y Y FAK F+D RE+E    +GS + A I++NLHNN AGR  VY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R N +G  L +++         +L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +    VC
Sbjct:   24 VVIEANSWWS---LGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG-KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC 364          
BLAST of Wnt5 vs. Ensembl Human
Match: WNT5A (Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:12784])

HSP 1 Score: 317.775 bits (813), Expect = 7.622e-105
Identity = 152/345 (44.06%), Postives = 212/345 (61.45%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW+   L   N    SE   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN+ Y Y FAK F+D RE+E    +GS + A I++NLHNN AGR  VY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R N +G  L +++         +L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +    VC
Sbjct:   39 VVIEANSWWS---LGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG-KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC 379          
BLAST of Wnt5 vs. Ensembl Celegans
Match: cwn-2 (pep chromosome:WBcel235:IV:10067824:10070251:1 gene:WBGene00000858.1 transcript:W01B6.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-2)

HSP 1 Score: 301.597 bits (771), Expect = 2.877e-99
Identity = 152/346 (43.93%), Postives = 218/346 (63.01%), Query Frame = 1
Query:  199 ATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQ-----PDELIYYKNSPDYCELSRVHSGFI-TSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            A+WW+         + H+      +K +C  L G S  QA +C  + DHMPAVSIGA+  I+ECQRQ    +WNCS  +++ + G     +T+EAAF +AI +AGV H I R CK+G L++CGCSDE +P+++  DW WGGCGDN++Y Y F+++FIDIREKE   P+ ++D    ++N  NN AGR  + +     CKCHGVSG+C++++CW QLP   Q+G  +  KYD A +V+ N +G +L+ ++    K +     P +L++  +SPDYC   R HSG + T GR CK     +E C+ LCC R Y T+T+EV  KC+CKF WCCK+ CQ C  + QV +C
Sbjct:   24 ASWWSTVAQLSTALAGHN------VKPVC-ELPGLSPGQAQVCELFKDHMPAVSIGAQNAIQECQRQFTGHRWNCSTHYSTGMLGPIHKMATREAAFTYAILSAGVTHEIGRRCKQGLLTSCGCSDETKPKNVPTDWSWGGCGDNVEYGYKFSRDFIDIREKEHD-PKRNHDNGRSLMNRRNNEAGRKILKRHRKPKCKCHGVSGACNMKTCWMQLPSMEQVGKILRNKYDKAIRVQINDRG-NLQLLADEATKERKTRALPTDLVFMDDSPDYCRFDR-HSGTLGTEGRVCKRGSGGAEGCDSLCCGRGYNTYTQEVKSKCNCKFEWCCKVVCQTCNNVTQVDIC 359          
BLAST of Wnt5 vs. Ensembl Celegans
Match: egl-20 (Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05])

HSP 1 Score: 211.075 bits (536), Expect = 8.380e-64
Identity = 128/395 (32.41%), Postives = 190/395 (48.10%), Query Frame = 1
Query:  133 KYFVGVTFYSLLIV---------DSIIIAIPATWWTMEVLPWKNQSP---HSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHN---------SDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSD---------ENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGT-HLRKISGHRKK--LQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++F+ + F  +L+V               +P  W T+  +   +  P   +   D    K +C RL G + +Q  +C +    +P V+ G R  I EC+ + K+ +WNCS              D+ G     + KEAAF +AI  A +VH+I + C  G L+ CGC           E+ P      + WGGC DN+ +   +AK F+D  E  + F +  N     +V  HNN  GR A+ +     C+CHGVSGSC  ++CW Q+  F Q+   + ++YD    V+  RK T  LR+     +K  L+ +E+ Y   SP YCE +       TSGREC  +   SE C+ LCC R Y T       +C CKF+WCC++KC+ C     VH C
Sbjct:    2 QFFICLIFLFVLLVYGQYSPPSATYSTQQVPYNWLTLAFVGSNDYLPRPHYHSTDREHFKELCRRLDGLNPNQQALCAENPFSIPFVARGVREAIRECENKFKFERWNCSSRDEVTETRHGKFQDILGKTLRSANKEAAFLNAIMAASIVHSITKGCNTGNLTECGCDSKPGMQRYQAESDPSMSRDQFSWGGCSDNVPHGIRYAKKFLDDWET-AQFDKTKN--VAHLVRRHNNFVGREAIAQNIRRQCRCHGVSGSCEFKTCWLQMQKFSQVSDLLKKRYDHFA-VQVTRKATKRLRRKERTERKIPLRGNEMAYVHRSPSYCEKNLTAGILGTSGRECIHNSYSSESCDLLCCGRGYNTRLEIRQTQCECKFVWCCEVKCKTCTEEVAVHTC 392          
BLAST of Wnt5 vs. Ensembl Celegans
Match: cwn-1 (pep chromosome:WBcel235:II:130983:133598:-1 gene:WBGene00000857.1 transcript:K10B4.6a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:cwn-1)

HSP 1 Score: 201.06 bits (510), Expect = 3.005e-60
Identity = 112/330 (33.94%), Postives = 168/330 (50.91%), Query Frame = 1
Query:  283 CLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSI--PHNSDVYGG-FTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANI-----------MVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRK-GTHLRKI---SGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            C  L G ++ Q   C K  D M +V  G+     ECQ Q   R+WNC++  P   +V    F Y +T+E+AF HAIS+A V + + R C  G    CGC            + + GC DN+K+    +K F+D  ++     +  N  + +           M+NLHNN AGR  + K     CKCHG+SGSC +R+CW  LP F  IG  +  K+D A +V+  ++ G    +I   +   K+    +L+Y   SPD+CE   +     T GR+C L     + C  LCC R Y    + V EKC+CKFI+CC+++C+ C +  + ++C
Sbjct:   42 CKSLKGLTRRQMRFCKKNIDLMESVRSGSLAAHAECQFQFHKRRWNCTLIDPVTHEVIPDVFLYENTRESAFVHAISSAAVAYKVTRDCARGISERCGCDYSKNDHSGKSQFQYQGCSDNVKFGIGVSKEFVDSAQRRVLMMKDDNGTSLLGPSQLSADGMHMINLHNNQAGRQVLEKSLRRECKCHGMSGSCEMRTCWDSLPNFRHIGMAIKDKFDGAAEVKVVKEDGIEKPRIVMKNSQFKRHTNADLVYMTPSPDFCESDPLRGILGTKGRQCTLAPNAIDDCSLLCCGRGYEKKVQIVEEKCNCKFIYCCEVRCEPCQKRIEKYLC 371          
BLAST of Wnt5 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355988:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 182.185 bits (461), Expect = 4.044e-53
Identity = 110/382 (28.80%), Postives = 182/382 (47.64%), Query Frame = 1
Query:  163 LLIVDSIIIAIPAT---WWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPED----------LHRDWLWGGCGDNLKYAYWFAKNFIDIREKE-SSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFN----------------RKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            LL +   ++  P +   WW +      +++  S  +S     +C  + G +  Q  +C +  + +  +  G R  +  C+   +   WNC++     V       +++E+A+ +AIS AGV H++AR+C +G +  CGC +  +                D++W GC DN+K+   F + F+D  +++ ++ PR         +NLHNN  GR  +    +  CKCHGVSGSC  ++CWK +P F +    + QKY +AK V  N                R     R +    K+++ +ELIY   SP+YC +           REC       E C  +CC R +RT    V E CHC+F+WCC++KC+ C +L + + C
Sbjct:    8 LLAIIYFLVFAPKSADAWWLL------SKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTLTL-PGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRS-------QMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMR-NELIYLDASPNYCAID-------VKDREC------GENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYC 361          
BLAST of Wnt5 vs. Ensembl Celegans
Match: mom-2 (pep chromosome:WBcel235:V:8355953:8358185:1 gene:WBGene00003395.1 transcript:F38E1.7.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:mom-2)

HSP 1 Score: 182.185 bits (461), Expect = 4.044e-53
Identity = 110/382 (28.80%), Postives = 182/382 (47.64%), Query Frame = 1
Query:  163 LLIVDSIIIAIPAT---WWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPED----------LHRDWLWGGCGDNLKYAYWFAKNFIDIREKE-SSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFN----------------RKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            LL +   ++  P +   WW +      +++  S  +S     +C  + G +  Q  +C +  + +  +  G R  +  C+   +   WNC++     V       +++E+A+ +AIS AGV H++AR+C +G +  CGC +  +                D++W GC DN+K+   F + F+D  +++ ++ PR         +NLHNN  GR  +    +  CKCHGVSGSC  ++CWK +P F +    + QKY +AK V  N                R     R +    K+++ +ELIY   SP+YC +           REC       E C  +CC R +RT    V E CHC+F+WCC++KC+ C +L + + C
Sbjct:    8 LLAIIYFLVFAPKSADAWWLL------SKTDTSSANSGSSPILCKNVPGLTPQQKRMCHENPNIIKYLISGLRSALHTCEYTFQREAWNCTLTL-PGVGTSPLQIASRESAYVYAISAAGVSHSLARACSKGLIDDCGCGETPQGSGSVAVSQASSRSSSDFVWAGCSDNVKFGNTFGRKFVDQYDRQHATEPRS-------QMNLHNNRVGRRLLVNAMNKECKCHGVSGSCVTKTCWKVMPKFDEFASRLHQKYQLAKLVTNNDQKLTVRSSPSAGSSGRSERFARNMDASSKQMR-NELIYLDASPNYCAID-------VKDREC------GENCPNICCGRGWRTTREIVDEPCHCQFVWCCEVKCKTCKKLVERNYC 361          
BLAST of Wnt5 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0339383)

HSP 1 Score: 187.578 bits (475), Expect = 1.818e-55
Identity = 113/322 (35.09%), Postives = 171/322 (53.11%), Query Frame = 1
Query:  280 ICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDL-----HRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRF--NRKGTHL----RKISGHRKKLQP-------DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVC 1191
            +C R+ G +  Q  +C +  D + A+  G ++G +ECQ Q +  +WNCS     +V+      +++EAA+ +AI++AG  +A+  +C  G +STCGC   ++            W WGGC  ++ +   +A+ F+D RE E          +  ++NLHNN AGR  V KM    CKCHGVSGSC +++CWK LPPF  +G  +  KY  AK V+    ++G  L    +K +G  +  +P        ELIY + SP+YCE S       TSGR C+      + C+ LCC R + T       +C C+F WCC++KC  C
Sbjct:    2 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERD--------SRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 315          
BLAST of Wnt5 vs. Ensembl Fly
Match: Wnt2 (gene:FBgn0004360 transcript:FBtr0088512)

HSP 1 Score: 187.963 bits (476), Expect = 2.343e-55
Identity = 113/322 (35.09%), Postives = 171/322 (53.11%), Query Frame = 1
Query:  280 ICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDL-----HRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRF--NRKGTHL----RKISGHRKKLQP-------DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVC 1191
            +C R+ G +  Q  +C +  D + A+  G ++G +ECQ Q +  +WNCS     +V+      +++EAA+ +AI++AG  +A+  +C  G +STCGC   ++            W WGGC  ++ +   +A+ F+D RE E          +  ++NLHNN AGR  V KM    CKCHGVSGSC +++CWK LPPF  +G  +  KY  AK V+    ++G  L    +K +G  +  +P        ELIY + SP+YCE S       TSGR C+      + C+ LCC R + T       +C C+F WCC++KC  C
Sbjct:   29 LCGRIPGLTPGQRNMCREMPDALIALGEGHQLGAQECQHQFRGHRWNCSEVWQRNVFAHVIPTASREAAYTYAIASAGAAYAVTAACARGNISTCGCDVRHKATPTGGGTPDEPWKWGGCSADVDFGMRYARRFMDARELERD--------SRTLMNLHNNRAGRTLVKKMLRTDCKCHGVSGSCVMKTCWKSLPPFRLVGDRLMLKYQKAKTVQAVKGKRGLRLVLSRKKHAGTARAQKPVLDWPKRMELIYLEASPNYCERSLQTGSQGTSGRTCQRTGHGPQSCDLLCCGRGHNTQHIRRTTQCRCQFRWCCEVKCDEC 342          
BLAST of Wnt5 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0334800)

HSP 1 Score: 159.844 bits (403), Expect = 4.995e-44
Identity = 69/204 (33.82%), Postives = 112/204 (54.90%), Query Frame = 1
Query:  607 WLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            W WGGC DN+ +    ++ F+D ++++     G+      +V  HNNNAGR+A+     + CKCHG+SGSC++++CW ++PPF ++   +  +YD A++V     G      S H +     +L++  +SPD+C  +       T GREC +    S+RC+ LCCNR +     E    C C F WCC++ C+ C+    V+ C
Sbjct:  222 WEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT------LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419          

HSP 2 Score: 54.6842 bits (130), Expect = 8.267e-8
Identity = 35/137 (25.55%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  163 LLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSI-GARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGC 570
            L+++  +I A+P T +      W           L+   +C +        A IC      +  + I G  +G  EC+ Q + R+WNC++   S          ++E  F +AI+ AGV +A+ ++C  G+L  C C
Sbjct:    4 LMVIAILIFAMPMTGFG-----W----AEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKS--MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSC 129          
BLAST of Wnt5 vs. Ensembl Fly
Match: Wnt6 (gene:FBgn0031902 transcript:FBtr0303251)

HSP 1 Score: 159.844 bits (403), Expect = 4.995e-44
Identity = 69/204 (33.82%), Postives = 112/204 (54.90%), Query Frame = 1
Query:  607 WLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            W WGGC DN+ +    ++ F+D ++++     G+      +V  HNNNAGR+A+     + CKCHG+SGSC++++CW ++PPF ++   +  +YD A++V     G      S H +     +L++  +SPD+C  +       T GREC +    S+RC+ LCCNR +     E    C C F WCC++ C+ C+    V+ C
Sbjct:  222 WEWGGCSDNVNFGLRHSRVFLDAKQRQRRSDLGT------LVKFHNNNAGRLAIRDAMRLECKCHGLSGSCTVKTCWLKMPPFREVAGRLRDRYDSARKVTLRNDGNSFMPESPHARPANKYQLVFADDSPDFCTPNSKTGALGTQGRECNVTSSGSDRCDRLCCNRGHTRRIVEEQTNCKCVFKWCCEVTCEKCLEHRAVNTC 419          

HSP 2 Score: 54.6842 bits (130), Expect = 8.267e-8
Identity = 35/137 (25.55%), Postives = 61/137 (44.53%), Query Frame = 1
Query:  163 LLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSI-GARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGC 570
            L+++  +I A+P T +      W           L+   +C +        A IC      +  + I G  +G  EC+ Q + R+WNC++   S          ++E  F +AI+ AGV +A+ ++C  G+L  C C
Sbjct:    4 LMVIAILIFAMPMTGFG-----W----AEGTNILLDPNLMCKKTRRLRGKLAEICRHDSALLKEIIINGINLGFRECEFQFRNRRWNCTVLRKS--MRKILMRDSRETGFVNAITAAGVTYAVTKACTMGQLVECSC 129          
BLAST of Wnt5 vs. Ensembl Fly
Match: Wnt4 (gene:FBgn0010453 transcript:FBtr0334799)

HSP 1 Score: 153.68 bits (387), Expect = 6.295e-41
Identity = 100/313 (31.95%), Postives = 154/313 (49.20%), Query Frame = 1
Query:  325 CTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYST--KEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKL-----------QPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKF--IWCCKIKCQVCIRLEQVHVC 1218
            C K       +S   R+    C+ Q +Y +WNCSI    +  G    +    KE AF HA++ A + H+IAR+C EG+++ C C  +    +  +D+ WGGC DNLK+     ++F+D+R  +       ++++ I+   H++  G  AV       CKCHGVSGSCS+++CWK++  F      + QKY+ A +   N++   +R++S  R K            Q   L Y + SP YC         +T  R+C       + C  LCC R Y T   +  EKC C+F    CC++ C  C RLE  + C
Sbjct:  253 CRKETGLPGTLSEARRLATTHCEEQFRYDRWNCSI----ETRGKRNIFKKLYKETAFVHALTAAAMTHSIARACAEGRMTKCSCGPKKHNREA-QDFQWGGCNDNLKHGKRVTRSFLDLRGGDG------DEVSEIL--RHDSEVGIEAVSSQMMDKCKCHGVSGSCSMKTCWKKMADFNATATLLRQKYNEAIRKAPNQR--SMRQVSSSRMKKPKQRRKKPQQSQYTTLYYLETSPSYCA--------VTKDRQC----LHPDNCGTLCCGRGYTTQVVKQVEKCRCRFNNGRCCQLICDYCQRLENKYFC 538          
BLAST of Wnt5 vs. Ensembl Zebrafish
Match: wnt5b (wingless-type MMTV integration site family, member 5b [Source:NCBI gene;Acc:30105])

HSP 1 Score: 336.65 bits (862), Expect = 1.081e-112
Identity = 158/353 (44.76%), Postives = 226/353 (64.02%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L++ +S ++ +  +WW++ + P   Q P  E   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G   +  ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y Y FA+ F+D RE+E ++PRGS + A  ++NL NN AGRMAVY +++VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R NR+G  L  ++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   15 TLIVCNSQLLVVANSWWSLAMNPI--QRP--EMYIIGAQPLCSQLTGLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMHIGSRETAFTYAVSAAGVVNAVSRACREGELSTCGCSRAARPRDLPRDWLWGGCGDNVNYGYRFAREFVDAREREKNYPRGSVEHARTLMNLQNNEAGRMAVYNLANVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRINRRG-KLELVNNRFNPPTGEDLVYIDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTYKHERCHCKFHWCCYVKCKRCTSLVDQFVC 362          
BLAST of Wnt5 vs. Ensembl Zebrafish
Match: wnt5b (wingless-type MMTV integration site family, member 5b [Source:NCBI gene;Acc:30105])

HSP 1 Score: 336.65 bits (862), Expect = 1.081e-112
Identity = 158/353 (44.76%), Postives = 226/353 (64.02%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L++ +S ++ +  +WW++ + P   Q P  E   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G   +  ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y Y FA+ F+D RE+E ++PRGS + A  ++NL NN AGRMAVY +++VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R NR+G  L  ++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   15 TLIVCNSQLLVVANSWWSLAMNPI--QRP--EMYIIGAQPLCSQLTGLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMHIGSRETAFTYAVSAAGVVNAVSRACREGELSTCGCSRAARPRDLPRDWLWGGCGDNVNYGYRFAREFVDAREREKNYPRGSVEHARTLMNLQNNEAGRMAVYNLANVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRINRRG-KLELVNNRFNPPTGEDLVYIDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTYKHERCHCKFHWCCYVKCKRCTSLVDQFVC 362          
BLAST of Wnt5 vs. Ensembl Zebrafish
Match: wnt5b (wingless-type MMTV integration site family, member 5b [Source:NCBI gene;Acc:30105])

HSP 1 Score: 336.65 bits (862), Expect = 1.081e-112
Identity = 158/353 (44.76%), Postives = 226/353 (64.02%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L++ +S ++ +  +WW++ + P   Q P  E   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G   +  ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y Y FA+ F+D RE+E ++PRGS + A  ++NL NN AGRMAVY +++VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R NR+G  L  ++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   15 TLIVCNSQLLVVANSWWSLAMNPI--QRP--EMYIIGAQPLCSQLTGLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMHIGSRETAFTYAVSAAGVVNAVSRACREGELSTCGCSRAARPRDLPRDWLWGGCGDNVNYGYRFAREFVDAREREKNYPRGSVEHARTLMNLQNNEAGRMAVYNLANVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRINRRG-KLELVNNRFNPPTGEDLVYIDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTYKHERCHCKFHWCCYVKCKRCTSLVDQFVC 362          
BLAST of Wnt5 vs. Ensembl Zebrafish
Match: wnt5a (wingless-type MMTV integration site family, member 5a [Source:ZFIN;Acc:ZDB-GENE-060328-3])

HSP 1 Score: 300.056 bits (767), Expect = 3.151e-98
Identity = 158/372 (42.47%), Postives = 224/372 (60.22%), Query Frame = 1
Query:  109 DMDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQP--DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            D  +  L+       F+ L IVD+       +WW++ + P        E   +  + +C +LSG SK Q  +C  Y DHM  +  GA+ GI ECQ Q ++ +WNCS   NS V G   +  ++E+AFA AIS AGV+HA++R+C+EG LS+CGCS  +RP+DL RDWLWGGCGDNL Y Y F++ F+D RE+E +F +GS + A  M+NLHNN AGR  V  ++ V+CKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R N +G   + +  H K   P   +L+Y + SPDYC  +       T GR C    +  + C  +CC R Y  +  E+ E+CHCKF WCC ++C+ C  +   +VC
Sbjct:   15 DTPHTLLFIIITFCVFFMLEIVDA------NSWWSLAMNPLLI----PEVYVIGGQPLCSQLSGLSKGQKKLCQLYQDHMQYIGEGAKTGIRECQHQFRHHRWNCSTVDNSTVLGRVMHIGSRESAFAFAISAAGVLHAVSRACREGALSSCGCSRASRPKDLPRDWLWGGCGDNLNYGYRFSREFVDAREREKTFSKGSAESARQMMNLHNNEAGRRIVSDLADVSCKCHGVSGSCSLKTCWLQLADFRKVGDVLKEKYDSAAAMRMNGRG---KLVQMHSKFSPPSGQDLLYLQPSPDYCIRNSSSGSLGTQGRLCNKTSEGMDGCALMCCGRGYDQYKAELVERCHCKFHWCCYVRCKRCSSIVDQYVC 373          
BLAST of Wnt5 vs. Ensembl Zebrafish
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:ZFIN;Acc:ZDB-GENE-060824-6])

HSP 1 Score: 248.825 bits (634), Expect = 4.802e-78
Identity = 125/322 (38.82%), Postives = 184/322 (57.14%), Query Frame = 1
Query:  262 SLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDE--NRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L  + IC  + G    Q  +C KY D M ++  GA+  I ECQ Q ++ +WNCS +  +  V+G     S++EAAF +AIS+AGVV AI R+C +G+L  C C  +   R  D   ++ WGGC DN+ Y   FAK FID +E+     R        ++NLHNN  GRMAV +   + CKCHGVSGSC+LR+CW  +  F + G ++ +KY+ A +V  N+ GT     +   +K   ++L+Y++NSPDYC + +      T+GR C    + ++ CE +CC R Y T   +   KC CKF WCC ++C+ C     +H C
Sbjct:   70 ALGARVICDNIPGLVNKQRQLCQKYPDIMQSIGGGAKEWIRECQYQFRHHRWNCSALDRDHTVFGRVIQRSSREAAFVYAISSAGVVFAITRACSQGELKACNCDPQKRGRASDERGEFDWGGCSDNINYGIKFAKAFIDAKERTVKDARA-------LMNLHNNRCGRMAVKRFMKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLRKKYNGAIEVTMNQDGTGFTVANKDFRKATKNDLVYFENSPDYCLMDKTAGSLGTAGRVCNKTSRGTDGCEVMCCGRGYDTTRSKRITKCECKFKWCCTVECKDCEEAVDIHTC 384          
BLAST of Wnt5 vs. Ensembl Xenopus
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:448452])

HSP 1 Score: 329.331 bits (843), Expect = 1.763e-109
Identity = 157/339 (46.31%), Postives = 220/339 (64.90%), Query Frame = 1
Query:  202 TWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +WW++ + P   Q P  E   +  + +C +L+G S  Q  +C  Y DHM  +  GA+ GI+ECQ Q K+R+WNCS   N+ V+G      ++EAAF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +FP+GS + A  ++NL NN AGR AVYK++ VACKCHGVSGSCSL++CW QL  F ++G ++ +KYD A  +R N++   L +++        ++L+Y   SPDYC  +       T GR+C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +   +VC
Sbjct:   41 SWWSLALNPV--QRP--EMYIIGAQPLCSQLTGLSPGQRKLCQLYQDHMVYIGEGAKTGIKECQHQFKHRRWNCSTVDNNSVFGRVMQIGSREAAFTYAISAAGVVNAISRACREGELSTCGCSRTPRPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFPKGSEEQARSLMNLQNNEAGRRAVYKLADVACKCHGVSGSCSLKTCWLQLADFRKVGEYIKEKYDSAASMRLNKR-NKLEQVNQRFNPPTAEDLVYLDPSPDYCLYNETTGSLGTHGRQCNKTSEGMDGCELMCCGRGYDQFKTVQVERCHCKFHWCCFVKCKKCTEIVDQYVC 374          
BLAST of Wnt5 vs. Ensembl Xenopus
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:448452])

HSP 1 Score: 325.479 bits (833), Expect = 2.458e-108
Identity = 159/354 (44.92%), Postives = 224/354 (63.28%), Query Frame = 1
Query:  169 IVDSIIIAIPATWWTMEVLPWK----NQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +V S+ +A+ A      +LP +    N     E   +  + +C +L+G S  Q  +C  Y DHM  +  GA+ GI+ECQ Q K+R+WNCS   N+ V+G      ++EAAF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +FP+GS + A  ++NL NN AGR AVYK++ VACKCHGVSGSCSL++CW QL  F ++G ++ +KYD A  +R N++   L +++        ++L+Y   SPDYC  +       T GR+C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +   +VC
Sbjct:    6 LVGSLDVALRAVCL---ILPCRSLALNPVQRPEMYIIGAQPLCSQLTGLSPGQRKLCQLYQDHMVYIGEGAKTGIKECQHQFKHRRWNCSTVDNNSVFGRVMQIGSREAAFTYAISAAGVVNAISRACREGELSTCGCSRTPRPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFPKGSEEQARSLMNLQNNEAGRRAVYKLADVACKCHGVSGSCSLKTCWLQLADFRKVGEYIKEKYDSAASMRLNKR-NKLEQVNQRFNPPTAEDLVYLDPSPDYCLYNETTGSLGTHGRQCNKTSEGMDGCELMCCGRGYDQFKTVQVERCHCKFHWCCFVKCKKCTEIVDQYVC 355          
BLAST of Wnt5 vs. Ensembl Xenopus
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:448452])

HSP 1 Score: 325.094 bits (832), Expect = 4.514e-108
Identity = 151/313 (48.24%), Postives = 208/313 (66.45%), Query Frame = 1
Query:  280 ICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +C +L+G S  Q  +C  Y DHM  +  GA+ GI+ECQ Q K+R+WNCS   N+ V+G      ++EAAF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +FP+GS + A  ++NL NN AGR AVYK++ VACKCHGVSGSCSL++CW QL  F ++G ++ +KYD A  +R N++   L +++        ++L+Y   SPDYC  +       T GR+C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +   +VC
Sbjct:   46 LCSQLTGLSPGQRKLCQLYQDHMVYIGEGAKTGIKECQHQFKHRRWNCSTVDNNSVFGRVMQIGSREAAFTYAISAAGVVNAISRACREGELSTCGCSRTPRPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFPKGSEEQARSLMNLQNNEAGRRAVYKLADVACKCHGVSGSCSLKTCWLQLADFRKVGEYIKEKYDSAASMRLNKR-NKLEQVNQRFNPPTAEDLVYLDPSPDYCLYNETTGSLGTHGRQCNKTSEGMDGCELMCCGRGYDQFKTVQVERCHCKFHWCCFVKCKKCTEIVDQYVC 357          
BLAST of Wnt5 vs. Ensembl Xenopus
Match: ENSXETT00000050987.1 (Wnt family member 5A [Source:NCBI gene;Acc:101734372])

HSP 1 Score: 316.235 bits (809), Expect = 1.377e-104
Identity = 155/362 (42.82%), Postives = 223/362 (61.60%), Query Frame = 1
Query:  133 KYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++FV +      +  S++    ++WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +AIS AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDNL Y Y FAK F+D RE+E  + +GS + + +++NLHNN AGR AV  ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  ++ N +G  L +++        ++LIY   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +     C
Sbjct:    4 QHFVALLISLCCLTQSVVET--SSWWSLAMNPV--QIP--EVYIIGAQPLCSQLSGLSQGQKKLCQLYQDHMQFIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAVSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNLDYGYRFAKEFVDAREREKIYQKGSYESSRLLMNLHNNEAGRRAVSTLADVACKCHGVSGSCSLKTCWLQLADFRKVGDLLKEKYDSAAAMKLNTRG-KLVQVNNKFNSPTMNDLIYIDPSPDYCVHNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEVVDQFAC 358          
BLAST of Wnt5 vs. Ensembl Xenopus
Match: ENSXETT00000050993.1 (Wnt family member 5A [Source:NCBI gene;Acc:101734372])

HSP 1 Score: 316.235 bits (809), Expect = 2.117e-104
Identity = 155/362 (42.82%), Postives = 223/362 (61.60%), Query Frame = 1
Query:  133 KYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++FV +      +  S++    ++WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +AIS AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDNL Y Y FAK F+D RE+E  + +GS + + +++NLHNN AGR AV  ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  ++ N +G  L +++        ++LIY   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +     C
Sbjct:   17 QHFVALLISLCCLTQSVVET--SSWWSLAMNPV--QIP--EVYIIGAQPLCSQLSGLSQGQKKLCQLYQDHMQFIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAVSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNLDYGYRFAKEFVDAREREKIYQKGSYESSRLLMNLHNNEAGRRAVSTLADVACKCHGVSGSCSLKTCWLQLADFRKVGDLLKEKYDSAAAMKLNTRG-KLVQVNNKFNSPTMNDLIYIDPSPDYCVHNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEVVDQFAC 371          
BLAST of Wnt5 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 319.701 bits (818), Expect = 3.993e-106
Identity = 152/345 (44.06%), Postives = 214/345 (62.03%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI ECQ Q + R+WNCS   N+ V+G      ++E AF +A+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +    ++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  R+G  L   +    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHC+F WCC ++C+ C  +   +VC
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQG-KLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVC 358          
BLAST of Wnt5 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 319.701 bits (818), Expect = 3.993e-106
Identity = 152/345 (44.06%), Postives = 214/345 (62.03%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI ECQ Q + R+WNCS   N+ V+G      ++E AF +A+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +    ++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  R+G  L   +    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHC+F WCC ++C+ C  +   +VC
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQG-KLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVC 358          
BLAST of Wnt5 vs. Ensembl Mouse
Match: Wnt5b (wingless-type MMTV integration site family, member 5B [Source:MGI Symbol;Acc:MGI:98959])

HSP 1 Score: 319.701 bits (818), Expect = 7.389e-106
Identity = 152/345 (44.06%), Postives = 214/345 (62.03%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI ECQ Q + R+WNCS   N+ V+G      ++E AF +A+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +    ++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  R+G  L   +    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHC+F WCC ++C+ C  +   +VC
Sbjct:   32 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMSYIGEGAKTGIRECQHQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRALMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRITRQG-KLELANSRFNQPTPEDLVYVDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDRFKSVQVERCHCRFHWCCFVRCKKCTEVVDQYVC 371          
BLAST of Wnt5 vs. Ensembl Mouse
Match: Wnt5a (wingless-type MMTV integration site family, member 5A [Source:MGI Symbol;Acc:MGI:98958])

HSP 1 Score: 318.546 bits (815), Expect = 1.193e-105
Identity = 155/357 (43.42%), Postives = 217/357 (60.78%), Query Frame = 1
Query:  148 VTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
             TF+S     + ++    +WW+   L   N    SE   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN+ Y Y FAK F+D RE+E    +GS + A I++NLHNN AGR  VY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R N +G  L +++         +L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +    VC
Sbjct:   11 ATFFSF----AQVVIEANSWWS---LGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG-KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC 359          
BLAST of Wnt5 vs. Ensembl Mouse
Match: Wnt5a (wingless-type MMTV integration site family, member 5A [Source:MGI Symbol;Acc:MGI:98958])

HSP 1 Score: 318.931 bits (816), Expect = 1.590e-105
Identity = 155/357 (43.42%), Postives = 217/357 (60.78%), Query Frame = 1
Query:  148 VTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
             TF+S     + ++    +WW+   L   N    SE   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q ++R+WNCS   N+ V+G      ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN+ Y Y FAK F+D RE+E    +GS + A I++NLHNN AGR  VY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R N +G  L +++         +L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +    VC
Sbjct:   31 ATFFSF----AQVVIEANSWWS---LGMNNPVQMSEVYIIGAQPLCSQLAGLSQGQKKLCHLYQDHMQYIGEGAKTGIKECQYQFRHRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAMSRACREGELSTCGCSRAARPKDLPRDWLWGGCGDNIDYGYRFAKEFVDARERERIHAKGSYESARILMNLHNNEAGRRTVYNLADVACKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMRLNSRG-KLVQVNSRFNSPTTQDLVYIDPSPDYCVRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTVQTERCHCKFHWCCYVKCKKCTEIVDQFVC 379          
BLAST of Wnt5 vs. UniProt/SwissProt
Match: sp|Q92050|WNT5B_DANRE (Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=2 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 8.160e-112
Identity = 158/353 (44.76%), Postives = 226/353 (64.02%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L++ +S ++ +  +WW++ + P   Q P  E   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G   +  ++E AF +A+S AGVV+A++R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y Y FA+ F+D RE+E ++PRGS + A  ++NL NN AGRMAVY +++VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R NR+G  L  ++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   15 TLIVCNSQLLVVANSWWSLAMNPI--QRP--EMYIIGAQPLCSQLTGLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMHIGSRETAFTYAVSAAGVVNAVSRACREGELSTCGCSRAARPRDLPRDWLWGGCGDNVNYGYRFAREFVDAREREKNYPRGSVEHARTLMNLQNNEAGRMAVYNLANVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRINRRG-KLELVNNRFNPPTGEDLVYIDPSPDYCLRNETTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTYKHERCHCKFHWCCYVKCKRCTSLVDQFVC 362          
BLAST of Wnt5 vs. UniProt/SwissProt
Match: sp|O42122|WNT5B_ORYLA (Protein Wnt-5b OS=Oryzias latipes OX=8090 GN=wnt5b PE=2 SV=1)

HSP 1 Score: 329.717 bits (844), Expect = 4.566e-109
Identity = 162/354 (45.76%), Postives = 221/354 (62.43%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPA-TWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            + L  +S ++ + A +WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y   FA+ F+D RE+E ++PRGS + A  ++NLHNN AGR AVY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  +        P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   22 AFLTCNSQLLLVDANSWWSLGLTPI--QRP--EMYIIGAQPLCSQLSGLSQGQRKLCQLYQDHMTYIGDGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAISRACREGELSTCGCSRTARPRDLPRDWLWGGCGDNVYYGKRFAQEFVDAREREKNYPRGSREHARTLMNLHNNEAGRQAVYNLADVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRIGRKG-RLELLDKRFNPPTPEDLVYIDLSPDYCHRNETTGSLGTQGRFCNKTSEGMDGCELMCCGRGYDQFRVYKHERCHCKFHWCCYVKCKRCSTLVDQFVC 370          
BLAST of Wnt5 vs. UniProt/SwissProt
Match: sp|P33945|WNT5B_XENLA (Protein Wnt-5b OS=Xenopus laevis OX=8355 GN=wnt5b PE=2 SV=2)

HSP 1 Score: 328.561 bits (841), Expect = 8.938e-109
Identity = 157/339 (46.31%), Postives = 220/339 (64.90%), Query Frame = 1
Query:  202 TWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +WW++ + P   Q P  E   +  + +C +L+G S  Q  +C  Y DHM  +  GA+ GI+ECQ Q K+R+WNCS   N+ V+G      ++EAAF +AIS+AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +FP+GS + A  ++NL NN AGR AVYK++ VACKCHGVSGSCSL++CW QL  F ++G ++ +KYD A  +R N++   L +++        ++L+Y   SPDYC  +       T GR+C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +    VC
Sbjct:   26 SWWSLALNPV--QRP--EMFIIGAQPLCSQLTGLSPGQRKLCQLYQDHMVHIGEGAKTGIKECQHQFKHRRWNCSTVDNNSVFGRVMQIGSREAAFTYAISSAGVVNAISRACREGELSTCGCSRTPRPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFPKGSEEQARSLMNLQNNEAGRRAVYKLADVACKCHGVSGSCSLKTCWLQLADFRKVGEYIKEKYDSAASMRLNKR-NKLEQVNQRFNPPTGEDLVYLDPSPDYCLYNETTGSLGTHGRQCNKTSEGMDGCELMCCGRGYDQFKTVQVERCHCKFQWCCFVKCKKCTEIVDQFVC 359          
BLAST of Wnt5 vs. UniProt/SwissProt
Match: sp|Q9H1J7|WNT5B_HUMAN (Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE=2 SV=2)

HSP 1 Score: 327.791 bits (839), Expect = 2.398e-108
Identity = 154/345 (44.64%), Postives = 217/345 (62.90%), Query Frame = 1
Query:  184 IIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            ++    +WW++ + P   Q P  E   +  + +C +L G S  Q  +C  Y +HM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF HA+S AGVV+AI+R+C+EG+LSTCGCS   RP+DL RDWLWGGCGDN++Y Y FAK F+D RE+E +F +GS +   +++NL NN AGR AVYKM+ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  ++    +  P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC ++C+ C  +   ++C
Sbjct:   19 LLTDANSWWSLALNP--VQRP--EMFIIGAQPVCSQLPGLSPGQRKLCQLYQEHMAYIGEGAKTGIKECQHQFRQRRWNCSTADNASVFGRVMQIGSRETAFTHAVSAAGVVNAISRACREGELSTCGCSRTARPKDLPRDWLWGGCGDNVEYGYRFAKEFVDAREREKNFAKGSEEQGRVLMNLQNNEAGRRAVYKMADVACKCHGVSGSCSLKTCWLQLAEFRKVGDRLKEKYDSAAAMRVTRKG-RLELVNSRFTQPTPEDLVYVDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYNQFKSVQVERCHCKFHWCCFVRCKKCTEIVDQYIC 358          
BLAST of Wnt5 vs. UniProt/SwissProt
Match: sp|Q06443|WNT5B_AMBME (Protein Wnt-5b OS=Ambystoma mexicanum OX=8296 GN=WNT-5B PE=2 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 2.477e-108
Identity = 156/340 (45.88%), Postives = 213/340 (62.65%), Query Frame = 1
Query:  199 ATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
             +WW++     +N     E   +  + +C +LS  S  Q  +C  Y DHM  +  GA+ GI+ECQ Q K R+WNCS   N+ V+G      ++E AF +A+S AGVV+AI+R+C+EG+LSTCGCS   RP+DLHRDWLWGGCGDN+ Y Y FAK F+D RE+E ++P+GS + A  ++NL NN AGR AVYK++  ACKCHGVSGSCSL++CW QL  F ++G H+ +KYD A  +R NRKG  L  ++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F     E+CHCKF WCC +KC+ C  +   +VC
Sbjct:   22 TSWWSLA----QNPVQRPEMYIIGAQPVCSQLSSLSPGQKKLCQLYQDHMMYIGEGAKTGIKECQYQFKQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAVSAAGVVNAISRACREGELSTCGCSRTTRPKDLHRDWLWGGCGDNVDYGYRFAKEFVDAREREKNYPKGSEEQARTLMNLQNNEAGRRAVYKLADAACKCHGVSGSCSLKTCWLQLADFRKVGDHLKEKYDSAAAMRINRKG-KLELVNNRFNLPTVEDLVYTDQSPDYCLRNESTGSLGTLGRLCNKTSEGMDGCELMCCGRGYDQFKTVQVERCHCKFHWCCFVKCKKCTEIVDQYVC 356          
BLAST of Wnt5 vs. TrEMBL
Match: C3U5B0 (Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 703.745 bits (1815), Expect = 0.000e+0
Identity = 336/336 (100.00%), Postives = 336/336 (100.00%), Query Frame = 1
Query:  214 MEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            MEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN
Sbjct:    1 MEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 336          
BLAST of Wnt5 vs. TrEMBL
Match: T1D117 (Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 604.364 bits (1557), Expect = 0.000e+0
Identity = 282/370 (76.22%), Postives = 321/370 (86.76%), Query Frame = 1
Query:  112 MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            MD++ +W++ + +  Y+L+ V + II+IP+TWW +EVLPWK +S +SE    E +  CL+LSGYS  QA +C KY+DHMPAV+IGARIGIEECQRQLKYR WNCS PHNSD+YG FTY STKEAAFAHAISNAGVVHAIARSCKE +LSTCGCS   RP+ LHRDW+WGGCGDNLKYAYWFAKNFID+REKESSFPR S +LANI+VNLHNN AGRMAV+KMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHH+TQKYDMAK+V+FNR+GT LRKISG   +   +ELIY + SPDYCELS+V  GFITSGREC+LDRK  ERCE LCCNR YRT+TREVHEKCHCKFIWCCKI+CQVCIRLEQVHVCN
Sbjct:    1 MDFIMIWRFIIIIILYNLVYVTTFIISIPSTWWNIEVLPWKIKSQNSESSVRETQHTCLKLSGYSYSQATMCAKYFDHMPAVTIGARIGIEECQRQLKYRHWNCSTPHNSDIYGSFTYVSTKEAAFAHAISNAGVVHAIARSCKEARLSTCGCSTAERPKQLHRDWIWGGCGDNLKYAYWFAKNFIDMREKESSFPRASKELANILVNLHNNKAGRMAVFKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHITQKYDMAKRVKFNRRGTRLRKISGRPIQPAANELIYSEKSPDYCELSKVQPGFITSGRECRLDRKGVERCELLCCNRSYRTYTREVHEKCHCKFIWCCKIQCQVCIRLEQVHVCN 370          
BLAST of Wnt5 vs. TrEMBL
Match: A0A1S6WN06 (Protein Wnt OS=Dugesia japonica OX=6161 PE=2 SV=1)

HSP 1 Score: 582.793 bits (1501), Expect = 0.000e+0
Identity = 281/336 (83.63%), Postives = 300/336 (89.29%), Query Frame = 1
Query:  214 MEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            MEVLPWKNQSP  E+D  EIK ICL+LSGYS DQAL+CTKYYDHMPAVSIGARIGIEECQRQLKYR WNCSIPHNSD+YG F+YY TKEAAFAHAISNAGVVHAIARSCKE KLSTCGCS E+RP+ LHRDW+WGGCGDNLKYAYWFAK FIDIREKESSFPRGS DLA I+VNLHNNNAGRM VY+MSSVACKCHGV GSCSLRSCWKQLPPF+QIGH +TQKYDMAKQV+FN++GT L+K     KK   D+ +   NSPDYC+LSRVHSGFITSGRECK DRKKSE CE LCCN  YRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN
Sbjct:    1 MEVLPWKNQSPLLERDPSEIKHICLKLSGYSTDQALMCTKYYDHMPAVSIGARIGIEECQRQLKYRHWNCSIPHNSDIYGSFSYYFTKEAAFAHAISNAGVVHAIARSCKEAKLSTCGCSTEDRPKHLHRDWIWGGCGDNLKYAYWFAKTFIDIREKESSFPRGSKDLAKILVNLHNNNAGRMMVYQMSSVACKCHGVFGSCSLRSCWKQLPPFMQIGHRVTQKYDMAKQVKFNKRGTRLKKKKSGHKKKLLDDELITCNSPDYCKLSRVHSGFITSGRECKSDRKKSESCEVLCCNSSYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 336          
BLAST of Wnt5 vs. TrEMBL
Match: Q86LV3 (Protein Wnt OS=Girardia tigrina OX=6162 GN=wnt5 PE=2 SV=1)

HSP 1 Score: 570.466 bits (1469), Expect = 0.000e+0
Identity = 269/327 (82.26%), Postives = 298/327 (91.13%), Query Frame = 1
Query:  214 MEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCI 1194
            MEVLPWKN++P+ EKD LEI++ICL+LSG+S DQA ICTKYYDHMPAVSIGA+IGIEECQRQLKYR WNCSIPHNSD YG FTYYSTKEAAFAHAISNAGVVHAIARSCKE KLSTCGCS E RP+DLHRDW  GGCGDNL+YAYWFAKNFID REKE+S+PR S DLA I+VNLHNN AGRMAVY+MSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHH+TQKYDMA++V+FNR GT  +K +G+RKKL PDELIY+++SPDYCELS+ H+GF+TSGRECKLDRKKSER E LCCNR YRT+TREVHEKCHCK  WCC I+CQVCI
Sbjct:    1 MEVLPWKNKNPNPEKDHLEIQQICLKLSGFSSDQASICTKYYDHMPAVSIGAKIGIEECQRQLKYRHWNCSIPHNSDQYGAFTYYSTKEAAFAHAISNAGVVHAIARSCKEAKLSTCGCSTEERPKDLHRDW--GGCGDNLRYAYWFAKNFIDSREKETSYPRHSKDLAIILVNLHNNRAGRMAVYQMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHVTQKYDMAEKVKFNRLGTRSKKTTGYRKKLVPDELIYFESSPDYCELSKDHAGFVTSGRECKLDRKKSERWEVLCCNRSYRTYTREVHEKCHCKLSWCCIIRCQVCI 325          
BLAST of Wnt5 vs. TrEMBL
Match: A0A4Z2D4Q3 (Protein Wnt OS=Schistosoma japonicum OX=6182 GN=EWB00_004551 PE=3 SV=1)

HSP 1 Score: 412.149 bits (1058), Expect = 1.170e-138
Identity = 186/341 (54.55%), Postives = 247/341 (72.43%), Query Frame = 1
Query:  205 WWTMEVLPWK--NQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            WW + +L W+  +QSP      L  K +CLR+ G +  QA +C +Y+DHMP +SIGA++GI ECQRQ ++R WNCS  +++  +G  T   ++EA FAHAIS AGVVHA+ARSCKE +L +CGCS  +RP+ LHRDW+WGGCGDN+ YAY FAK FID+REKE S+PR SN+LA +++NLHNN AGR+AVYK++SVACKCHGVSGSCSLR+CW QL PF +IG ++ Q YD A +V+FNR+GT LR+ S   +++ PD + Y   S +YCE   +     T GREC  +      C  LCCNR  ++  REVHEKCHC+F WCC+++CQ C++ E+ HVCN
Sbjct:   45 WWNIGLLSWRTIHQSP---AFLLAPKPLCLRVQGLTHSQAQLCQRYFDHMPVISIGAKLGIYECQRQFRFRHWNCSSDNDASAFGPVTLTGSREAGFAHAISAAGVVHALARSCKEARLYSCGCSKADRPDQLHRDWIWGGCGDNIAYAYRFAKAFIDVREKEKSYPRHSNELARMLMNLHNNRAGRLAVYKLASVACKCHGVSGSCSLRTCWTQLSPFTRIGRYLRQGYDEAVKVKFNRRGTKLRRASRQLRRVTPDHITYLDESSNYCEYDPITQSPGTRGRECLPNSTDQASCATLCCNRGSQSQLREVHEKCHCQFNWCCRVECQTCVKTEEYHVCN 382          
BLAST of Wnt5 vs. Ensembl Cavefish
Match: wnt5a (Wnt family member 5A [Source:NCBI gene;Acc:103037231])

HSP 1 Score: 318.931 bits (816), Expect = 1.212e-105
Identity = 156/360 (43.33%), Postives = 219/360 (60.83%), Query Frame = 1
Query:  145 GVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPD--ELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            GV   + L     ++    +WW++ + P        E   +  + +C +L+G SK Q  +C  Y DHM  +  GA+ GI ECQ Q ++R+WNCS   NS V+G      ++EAAF +AIS AGVV+A++R+C+EG+LS+CGCS   RP+DL RDWLWGGCGDNL Y Y F+K F+D RE+E S+ + S + A +++NLHNN AGR  V  ++ V+CKCHGVSGSCSL++CW QL  F ++G  + +KYD A  ++ N +G   + +  H K   P   +L+Y   SPDYC  +R      T GR C    +  + C  +CC R Y  FT  + E+CHCKF WCC +KC+ C R     VC
Sbjct:   20 GVMAITFLAFFMQVVVEATSWWSLAMNPL----LIPEAYIIGAQPLCSQLAGLSKGQKKLCQLYQDHMQYIGEGAKTGIRECQFQFRHRRWNCSTVDNSSVFGRVMQIGSREAAFTYAISAAGVVNAVSRACREGELSSCGCSRAARPKDLPRDWLWGGCGDNLNYGYRFSKEFVDAREREKSYDKASMENARLLMNLHNNEAGRRMVSDLAHVSCKCHGVSGSCSLKTCWLQLADFRKVGDALKEKYDSAAAMKLNGRG---KLVQVHSKFNPPSSHDLVYIDPSPDYCIFNRTTGSLGTQGRLCNKTSEGMDGCALMCCGRGYDQFTATLTERCHCKFHWCCYVKCKRCSRKVDQFVC 372          
BLAST of Wnt5 vs. Ensembl Cavefish
Match: wnt5b (wingless-type MMTV integration site family, member 5b [Source:NCBI gene;Acc:30105])

HSP 1 Score: 312.383 bits (799), Expect = 3.021e-103
Identity = 158/369 (42.82%), Postives = 221/369 (59.89%), Query Frame = 1
Query:  112 MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            MD +   ++ +  T  +LL   S  +A   +WW++ + P   Q P  E   +  + +C +L+G S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G               +   GVV+A++R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y Y FA+ F+D RE+E ++PRGS D A  ++NL NN AGRMAVY +++VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R NR+G  L +++        ++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:    2 MDAIQSLRFIL--TIITLLACSSQRLAHANSWWSLAMNPI--QRP--EMYIIGAQPLCSQLTGLSQGQRKLCQLYQDHMVYIGEGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGE---WMDRCMVLRGVVNAVSRACREGELSTCGCSRAARPRDLPRDWLWGGCGDNVNYGYRFAREFVDAREREKNYPRGSIDHARTLMNLQNNEAGRMAVYNLANVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRINRRG-KLEQVNNRFNPPTGEDLVYIDPSPDYCLRNESTGSLGTQGRLCNKTSEGMDGCELMCCGRGYDQFKTYKHERCHCKFHWCCYVKCKRCTSLVDQFVC 360          
BLAST of Wnt5 vs. Ensembl Cavefish
Match: wnt2ba (protein Wnt-2b-like [Source:NCBI gene;Acc:103029625])

HSP 1 Score: 242.276 bits (617), Expect = 5.675e-76
Identity = 125/322 (38.82%), Postives = 179/322 (55.59%), Query Frame = 1
Query:  262 SLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSD--ENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +L  + IC  + G    Q  +C ++ D M ++  GA   I ECQ Q ++ +WNCS +  +  V+G     S++EAAF +AIS+AGVV+AI R+C  G+L  C C      R  D   D+ WGGC DN+ Y   FAK F+D RE+     R        ++NLHNN  GRMAV +   + CKCHGVSGSC+LR+CW  +  F + G ++ +KY+ A +V  N+ GT       + K    ++L+Y ++SPDYC + R      T+GR C    +  + CE +CC R Y T   +   KC CKF WCC ++C+ C     VH C
Sbjct:   38 ALGARVICDNIPGLVNKQRQLCQRHPDLMQSIGEGANEWIRECQHQFRHHRWNCSTLERDHTVFGRVMLRSSREAAFVYAISSAGVVYAITRACSLGELKICSCDTHKRGRASDEMGDFDWGGCSDNINYGIKFAKAFVDARERMVKDARA-------LMNLHNNRCGRMAVKRFMKLQCKCHGVSGSCALRTCWLAMSDFRRTGDYLRKKYNTAVEVTMNQDGTGFMAADRNFKGTTKNDLVYVESSPDYCLMDRTAGSLGTAGRVCNKSSRGMDGCEVMCCGRGYDTTRVKRVSKCECKFKWCCAVECRDCEDTVDVHTC 352          
BLAST of Wnt5 vs. Ensembl Cavefish
Match: wnt2bb (wingless-type MMTV integration site family, member 2Bb [Source:ZFIN;Acc:ZDB-GENE-060824-6])

HSP 1 Score: 244.202 bits (622), Expect = 1.354e-74
Identity = 127/359 (35.38%), Postives = 196/359 (54.60%), Query Frame = 1
Query:  151 TFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDE--NRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
             F  LL++  +   + ++WW +               +L  + IC  + G    Q  +C K+ D M ++S G +  I ECQ Q ++ +WNCS +  +  V+G     S++EAAF +AIS+AGVV+AI R+C +G+L  C C      +  D   ++ WGGC DN+ Y   FAK+FID +E+     R        +VNLHNN  GRM+V +   + CKCHGVSGSC+LR+CW  +  F + G ++ +KY+ A +V  N+ GT     +   +    ++L+Y++NSPDYC + +      T+GR C    + ++ CE +CC R Y T   +   KC CKF WCC ++C+ C     +H C
Sbjct:  211 AFIILLLI--LTPRVDSSWWYI--------------GALGARVICDNIPGLVNKQRQLCQKHPDVMQSISEGGQEWIRECQHQFRHHRWNCSTLDRDHTVFGRVMQRSSREAAFVYAISSAGVVYAITRACSQGELKPCNCDPHKLGKARDERGEFDWGGCSDNINYGIKFAKDFIDAKERTVKDARA-------LVNLHNNRCGRMSVKRFMKLECKCHGVSGSCTLRTCWLAMSDFRKTGDYLRKKYNGAIEVTVNQDGTGFTVANKDFRNATKNDLVYFENSPDYCLMDKAAGSLGTAGRICNKSSRGTDGCEVMCCGRGYDTTRVKRITKCECKFKWCCAVECKDCEEAVDIHTC 546          
BLAST of Wnt5 vs. Ensembl Cavefish
Match: wnt4 (wingless-type MMTV integration site family, member 4 [Source:NCBI gene;Acc:30123])

HSP 1 Score: 229.18 bits (583), Expect = 1.737e-71
Identity = 119/303 (39.27%), Postives = 175/303 (57.76%), Query Frame = 1
Query:  325 CTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLAN-IMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQP---DELIYYKNSPDYCELSRVHSGFI-TSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            C +  + M AV  GA++ I+ECQ Q + R+WNCS      V+G      T+EAAF +AIS A V  A+ R+C  G+L  CGC D N        + W GC DN+ Y   F+++F+DIRE      RG    +N  ++NLHNN AGR A+     V CKCHGVSGSC +++CWK +PPF ++G+ + +K+D A +V   + GT  + +     + +P   ++L+Y   SPD+C+      G + T GR C    K  + CE +CC R + T   EV ++C CKF WCC +KC+ C ++ ++H C
Sbjct:   31 CKRNVEVMDAVRRGAQLAIDECQYQFRNRRWNCSTLETVPVFGKVVTQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-DRNVHGVSPDGFQWSGCSDNIAYGVAFSQSFVDIRE------RGKGQSSNRALMNLHNNEAGRKAILNHMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVEQRKIGT-TKVLVPRNSQFKPHTDEDLVYLDPSPDFCDHDPRTPGMLGTVGRYCNKTSKAIDGCELMCCGRGFHTEEVEVVDRCSCKFHWCCYVKCKQCRKMVEMHTC 325          
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010914.1 (pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 gene:ENSPMAG00000009890.1 transcript:ENSPMAT00000010914.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.352 bits (747), Expect = 5.026e-96
Identity = 153/357 (42.86%), Postives = 209/357 (58.54%), Query Frame = 1
Query:  199 ATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSF--------------PRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQP---DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            + WW++ + P   Q P  E   L  + +C +L G S  Q  +C  Y DH+P ++ GAR+ + ECQ Q + R+WNCS      V+G  T+  ++E AFAHAIS AGV HA++R+C+EG+L+TCGCS   RP +L RDWLWGGCGDNL+Y Y FA+ F+D RE+E                  R S + +  ++NLHNN AGR AVY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A   R  R+     K+    +K  P    +L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F   V E+C+CKF WCC +KC+ C  +    VC
Sbjct:   25 SEWWSLALSPM--QRP--EAYLLSAQPLC-QLVGLSPGQRKLCHLYQDHVPHIADGARLAVRECQHQFRTRRWNCSAGEGDSVFGRLTHIGSRETAFAHAISAAGVAHAVSRACREGELATCGCSRAPRPRELQRDWLWGGCGDNLEYGYRFAREFVDAREREQGGQQQQQQQQQQQQLAARHSVEHSRTLMNLHNNEAGRRAVYGLADVACKCHGVSGSCSLKTCWLQLADFRKVGKFLKEKYDSASAARAGRR----AKLEPANRKFSPPSAGDLVYLDASPDYCVRNETTGSLGTIGRSCNKTSEGMDGCELMCCGRGYDHFKATVVERCNCKFHWCCYVKCKKCTSVVDRFVC 372          
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Match: wnt3 (wingless-type MMTV integration site family, member 3 [Source:ZFIN;Acc:ZDB-GENE-081003-1])

HSP 1 Score: 228.794 bits (582), Expect = 1.453e-71
Identity = 116/324 (35.80%), Postives = 172/324 (53.09%), Query Frame = 1
Query:  280 ICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPD----------ELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +C  + G    Q   C  Y + MP+V+ G R+GI+ECQ Q + R+WNC+ +     ++G     +T+EA+F HA+S+AGV  A+ R+C +G  + CGC +++R E     W WGGC ++  +    ++ F D RE            A   +N HNN AGR+++       CKCHG+SGSC +++CW   P F  +G H+  KYD A ++   R     R+  G  + L+P           +L+YY+ SP++CE S       T GR C L     + C+ LCC+R Y T T    EKC C F WCC + CQ C R+  +H C
Sbjct:   44 LCASIPGLVPKQLRFCRNYQELMPSVAEGVRLGIQECQHQFRGRRWNCTTMTEGPAIFGPVLERATREASFVHAVSSAGVGFAVTRACADGTSTICGCDNKHRGEP-SGGWKWGGCSEDADFGVMVSREFADARENRPD--------ARSAMNRHNNEAGRVSILDFMQRKCKCHGLSGSCEVKTCWWAQPSFRTVGDHLKDKYDSASEMLVERH----RESRGWVETLRPKYPLFKPPAERDLVYYETSPNFCEPSAETGSLGTHGRPCNLTSHGIDGCDLLCCSRGYNTHTERRREKCKCVFHWCCYVSCQECARVYDIHTC 354          
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Match: wnt1 (wingless-type MMTV integration site family, member 1 [Source:NCBI gene;Acc:30128])

HSP 1 Score: 165.622 bits (418), Expect = 1.814e-48
Identity = 94/268 (35.07%), Postives = 131/268 (48.88%), Query Frame = 1
Query:  475 KEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVR-FNRKGT------------------HLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFI-TSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +E AF HA+ +A + H +AR+C EG +++C C D  R      DW WGGC DNL +   FA+          +  RG  D A  +++ HN  AG   V       CKCHG+SGSC+L++CW +LPPF  +G  + +++D A QV  + R+G                   HLR      K     +L+Y   SP++C        +  T GR C         CE LCC R + +    V E+C C F WCC + CQ C R+E VH C
Sbjct:    6 RETAFIHAVMSAALAHGVARACSEGSIASCTC-DYGRRGRGGPDWEWGGCSDNLPFGTRFARELA-----AGAGERGGRD-ARALMDRHNEEAGMRTVDSEMRRECKCHGMSGSCALKTCWLRLPPFRAVGDRLKERFDGATQVADYGREGNRASKDSDRGGGGSGGGGGHLRPADPAHKPPGGRDLVYVDESPEFCHADTAGLSWPGTRGRVCVRGSPGLGGCELLCCGRGWTSREARVSERCLCTFHWCCTVTCQNCTRVETVHEC 266          
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001922.1 (pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 gene:ENSPMAG00000001738.1 transcript:ENSPMAT00000001922.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 142.51 bits (358), Expect = 3.368e-39
Identity = 89/321 (27.73%), Postives = 147/321 (45.79%), Query Frame = 1
Query:  280 ICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIM--VNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLR----KISGHRKKLQP--DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            IC ++ G +  Q  +C    D +  +  GA++GI ECQ Q ++ +WNC+      V+G     + +   F    S  G+   I + C+ G      CS   R  +    WL     D  ++    +  F+ I     ++   ++DLA +M  V     ++    + +   + CKCHGVSGSC+ ++CW  LP F ++G+ +  KY+    V       ++R    K+   R   +P   EL++ + SP+YCE         T GR C      ++ C+ LCC R Y T       +C+CKF WCC ++C  C    + + C
Sbjct:    6 ICNKIPGLAPRQRALCQSRPDVIIVIGEGAQLGISECQYQFRFGRWNCTALGERTVFGQELKVAIRSTHFTDIQSGGGLFERIHQRCRYGAHELSLCSQLTRGREGPHPWLRMTPLDE-QFGQKTSSTFLKIVYIHYNYR--NSDLAQLMQKVPYRRFHSTDQVLEEKMKLECKCHGVSGSCTTKTCWTTLPKFREVGYALKDKYEHTVHVEPVSGSRYMRPMFLKVKKSRSYRKPLDTELVFTERSPNYCEEDPATGSAGTRGRLCNRTSPHADGCDLLCCGRGYNTHQYTRAWQCNCKFHWCCYVRCSTCSERTEEYTC 323          
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Match: wnt10a (wingless-type MMTV integration site family, member 10a [Source:NCBI gene;Acc:30171])

HSP 1 Score: 132.494 bits (332), Expect = 9.651e-36
Identity = 92/303 (30.36%), Postives = 139/303 (45.87%), Query Frame = 1
Query:  475 KEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENR--------------------------------PEDLHRD---WLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVR-FNRKGT------------------HLRKISGHRKKLQPD-ELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +E AFA+A++ AGV+HA+A +C  GKL TCGC ++ +                                P D       W WGGC  +L++   F+++F+D RE        S D+ +    LHNN  GR  V +     CKCHG SGSC L++CW+  P F  +G  +  ++ +A  +   NR G                      +++G R +   D EL+Y++ SP +CE         T GR C      ++ CE +CC R +   +    E+C+CKF WCC + C+ C     V+VC
Sbjct:    3 RETAFAYALAAAGVMHAVASACSLGKLKTCGCDEKLKGDEEAFRVKLIKLKMQMLSQGKAAANGVLPHVPADAPGSPDTWEWGGCSHDLEFGEKFSRDFLDSRET-------SRDI-HARTRLHNNRVGRRVVLEHKRRKCKCHGTSGSCQLKTCWQVSPDFRTVGDTLRDRFHLAAFLAPHNRHGVPALALVSGGGHHHHHQGSSSAQVTGRRYRPPDDGELLYFERSPTFCERGAGSEWPGTQGRVCNRTSSGADGCESMCCGRGHNQISESRMERCNCKFHWCCYVVCEECHSSAWVNVC 297          
BLAST of Wnt5 vs. Ensembl Nematostella
Match: WNT5 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IHW1])

HSP 1 Score: 276.559 bits (706), Expect = 9.577e-90
Identity = 141/345 (40.87%), Postives = 196/345 (56.81%), Query Frame = 1
Query:  229 WKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIP--HNSDVYGGFTY--YSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRK----------GTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            W    PH          +C+ L G +++Q  +C K  DHM +V +GA++ I+ECQ Q +Y +WNCSIP    S ++   T    +T+EAA  +AIS+AGVV A+AR+C EG LSTC CS E RP DL++++ WGGCGDN++YA  F + F++  E            A  ++NLHNNN GR  V  +S V CKCHGV GSC+L++CW+QL  F +IG+ +  KYD A QV   RK            H  +      +   DEL+Y   SPD+C  +  H    T GR+C  +    + C  LCC+R Y+        +C CKF WCCK+KC+ CI+    H+CN
Sbjct:   14 WSVNIPHQAYIISVQPGLCMNLGGLTREQIDLCQKNIDHMASVGLGAKMAIQECQFQYQYEKWNCSIPDAEKSSLFERITSKDVATREAALTYAISSAGVVWALARACTEGNLSTCSCSRERRPLDLNKEYQWGGCGDNIEYAVKFGREFMEAGEDHRPTEEDRKKYARTLMNLHNNNLGRRVVKDISVVECKCHGVCGSCNLKTCWRQLVEFREIGNALHDKYDAAVQVALKRKEGRSLLLPMRSRHYSQRKAKSAQETRDELVYIDKSPDFCSKNAAHGAQGTRGRKCIKESLGKDGCNLLCCSRGYKMKKEVQATRCRCKFHWCCKVKCKTCIKNVTTHICN 358          
BLAST of Wnt5 vs. Ensembl Nematostella
Match: WNT16 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694])

HSP 1 Score: 241.506 bits (615), Expect = 1.421e-76
Identity = 123/313 (39.30%), Postives = 181/313 (57.83%), Query Frame = 1
Query:  283 CLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFT-REVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            C R+ G S  Q  +C +  D +P+VS GA IGI EC++Q KY +WNCS  ++  V+G     + KE+AF +AI++AGVVHA+ +SC +G L+ C C  +    +  + W WGGC DN+ Y  W +K F+D  EK     R S   A  M+NLHNN AGR AV  +  V C+CHGVS SC++++C K LP F ++G  +  +Y  A +  + ++   L++    + ++    L+Y   SP+YC   +      TSGREC  +    + C+ LCC   Y T T R VH  CHC+FIWCC + C+ C ++   + C
Sbjct:   18 CSRVPGLSLQQLRMCLQKPDVIPSVSQGANIGIHECKKQFKYERWNCSTSNDPTVFGTLLKIAHKESAFVYAITSAGVVHAVGKSCSKGNLTECSCESKRGARNQPKGWEWGGCSDNVNYGVWLSKTFVDAPEKADRRAR-SQRKARAMMNLHNNEAGREAVLALMRVQCRCHGVSSSCAVKTCSKSLPKFEEVGEALKAEYKDAIRAVYIKRKRKLKRKDNKKLRIPSSSLVYLDESPNYCYRDKKLGIDGTSGRECNKNSSGVDGCDLLCCGSGYNTQTVRSVHS-CHCRFIWCCNVVCKKCEKIFDRYTC 328          
BLAST of Wnt5 vs. Ensembl Nematostella
Match: WNT2 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5])

HSP 1 Score: 242.276 bits (617), Expect = 1.459e-76
Identity = 127/314 (40.45%), Postives = 177/314 (56.37%), Query Frame = 1
Query:  262 SLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSE-RCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIR 1197
            +L  K +C  ++G    Q  +C    D M ++  GA++G+EECQ Q + ++WNCS +  ++ V+G     +++E AF +AIS+AGVVH + RSC  G+L  C C   N+     + + WGGC DN++Y   FAK F+D RE E          A  ++NLHNN+ GR  V    S+ CKCHGVSGSCS+R+CWK +  F  +G H+ +KY  A QV   + G  L       KK   D+L+Y ++SP+YC +        TSGREC      +   C  LCC R + T   E   KCHCKF WCC +KCQ C R
Sbjct:   35 ALGAKVMCNSITGLISIQRQMCLDNPDVMVSIGKGAKLGVEECQHQFRDQRWNCSTVNGDATVFGKVMRRASRETAFVYAISSAGVVHEVTRSCSLGELKDCSC--RNKKGRSRKGFEWGGCSDNIQYGLNFAKAFVDSREVEKD--------ARALMNLHNNHVGRRVVKTNMSLDCKCHGVSGSCSVRTCWKSISSFRIVGQHLREKYTTAVQVTVGQSGGELTNAEVSYKKPSRDDLVYLEDSPNYCMVDSNTGSLGTSGRECNGSASDTTGACSLLCCGRGFNTIQIEEEYKCHCKFHWCCYVKCQTCRR 338          
BLAST of Wnt5 vs. Ensembl Nematostella
Match: WNT3 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5])

HSP 1 Score: 231.876 bits (590), Expect = 1.513e-72
Identity = 124/361 (34.35%), Postives = 196/361 (54.29%), Query Frame = 1
Query:  148 VTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCS-IPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQV--RFNRKGT-HLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            V   +++ + S++++  A WWT+      +  P   K S+    +C     ++  Q  +C K  D M  V+ GA+ G+ EC+ Q + R+WNCS I  +  ++        +EAAF HA++ AGV H++  +C +G++ +C C D N      + W W GC  N+K+  WF+K F + RE+         DL  IM N HN+ AGR A+ ++    CKCHG+SGSCS+++CW Q   F QIG H+  KYD A ++  + NR+G   L+    H KK    +LIY++ SP+YC+ +       TSGR+C       + CE LCC R +     ++   C+C F WCC++KC+ C  +  ++ C
Sbjct:    3 VIITAIVPLISLLVSSEAVWWTLGTQLSVSSDP--AKKSM----LCYVTRQFNSRQQEVCRKNPDLMEHVAHGAKYGVHECRHQFRNRRWNCSTIRESGSLFESVLSKGCREAAFVHAVTAAGVAHSVTDACSKGRIESCDC-DRNLSGRSSKGWTWSGCNSNIKFGVWFSKQFTEARER-------GGDLRQIM-NRHNSRAGRKALEELVWRKCKCHGLSGSCSMKTCWMQQANFRQIGDHLKVKYDSAVEMTTKVNRRGKKRLKPKYSHFKKPSDKDLIYFETSPNYCDKNVTVGSLGTSGRQCNYTSNGIDGCELLCCGRGHNIQQAKITRNCNCVFKWCCEVKCERCKEVVNIYTC 348          
BLAST of Wnt5 vs. Ensembl Nematostella
Match: EDO31000 (Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54])

HSP 1 Score: 228.024 bits (580), Expect = 5.549e-71
Identity = 123/363 (33.88%), Postives = 196/363 (53.99%), Query Frame = 1
Query:  148 VTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPH--NSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLST-CGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPD---ELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            +   + L++ S++ +  + W ++ +         S+K+  EI ++       +  Q  +C +    M +V  GA + + ECQ Q +YR WNC+      S V+G      T+EAAF HAIS+AGV +A+ ++C  G+L   CGC  + R +     + W GC D++ +   FA  F+D RE+ S    G    A +++NLHNN  GR+AV K   + CKCHGVSGSC++++CW+ LP F  +G ++ +K+D A +V +   G     +  +R K +P    +L+Y   SPD+CE +       T GR C    +  + C+ +CC R Y + T    E+C CKF WCC ++CQ C+R  +V  C
Sbjct:    6 IVILTQLVMASLVYS--SQWLSLALTGSNPNRFLSKKNCDEIGQL------LNHRQVQVCKRNIQVMDSVKDGASVALFECQHQFRYRPWNCTTVQFSRSPVFGNSINGGTREAAFVHAISSAGVAYAVTQACSSGRLGQKCGCDRKTRGQ--ADGFNWAGCSDDIDFGMTFATRFVDARERGS----GIGSPARVLMNLHNNRGGRLAVKKFMDLQCKCHGVSGSCNIKTCWRALPNFRIVGDYIKEKFDGATEVEYKLIGGKHVLVPKNR-KYKPHTQMDLVYLVQSPDFCEPNPKTGSLGTQGRICNRTSQAIDGCDLMCCGRGYVSRTEVRQEQCACKFFWCCHVRCQTCMRRVEVSYC 353          
BLAST of Wnt5 vs. Ensembl Medaka
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:100049184])

HSP 1 Score: 329.717 bits (844), Expect = 5.094e-110
Identity = 162/354 (45.76%), Postives = 221/354 (62.43%), Query Frame = 1
Query:  160 SLLIVDSIIIAIPA-TWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            + L  +S ++ + A +WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y   FA+ F+D RE+E ++PRGS + A  ++NLHNN AGR AVY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  +        P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   22 AFLTCNSQLLLVDANSWWSLGLTPI--QRP--EMYIIGAQPLCSQLSGLSQGQRKLCQLYQDHMTYIGDGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAISRACREGELSTCGCSRTARPRDLPRDWLWGGCGDNVYYGKRFAQEFVDAREREKNYPRGSREHARTLMNLHNNEAGRQAVYNLADVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRIGRKG-RLELLDKRFNPPTPEDLVYIDLSPDYCHRNETTGSLGTQGRFCNKTSEGMDGCELMCCGRGYDQFRVYKHERCHCKFHWCCYVKCKRCSTLVDQFVC 370          
BLAST of Wnt5 vs. Ensembl Medaka
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:100049184])

HSP 1 Score: 331.257 bits (848), Expect = 1.077e-109
Identity = 167/370 (45.14%), Postives = 226/370 (61.08%), Query Frame = 1
Query:  109 DMDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            D+ +L L   F+      LL+VD+       +WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y   FA+ F+D RE+E ++PRGS + A  ++NLHNN AGR AVY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  +        P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   78 DVRHLLLAAAFLTCN-SQLLLVDA------NSWWSLGLTPI--QRP--EMYIIGAQPLCSQLSGLSQGQRKLCQLYQDHMTYIGDGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAISRACREGELSTCGCSRTARPRDLPRDWLWGGCGDNVYYGKRFAQEFVDAREREKNYPRGSREHARTLMNLHNNEAGRQAVYNLADVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRIGRKG-RLELLDKRFNPPTPEDLVYIDLSPDYCHRNETTGSLGTQGRFCNKTSEGMDGCELMCCGRGYDQFRVYKHERCHCKFHWCCYVKCKRCSTLVDQFVC 435          
BLAST of Wnt5 vs. Ensembl Medaka
Match: wnt5b (Wnt family member 5B [Source:NCBI gene;Acc:100049184])

HSP 1 Score: 330.487 bits (846), Expect = 1.785e-109
Identity = 167/370 (45.14%), Postives = 226/370 (61.08%), Query Frame = 1
Query:  109 DMDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            D+ +L L   F+      LL+VD+       +WW++ + P   Q P  E   +  + +C +LSG S+ Q  +C  Y DHM  +  GA+ GI+ECQ Q + R+WNCS   N+ V+G      ++E AF +AIS AGVV+AI+R+C+EG+LSTCGCS   RP DL RDWLWGGCGDN+ Y   FA+ F+D RE+E ++PRGS + A  ++NLHNN AGR AVY ++ VACKCHGVSGSCSL++CW QL  F ++G  + +KYD A  +R  RKG  L  +        P++L+Y   SPDYC  +       T GR C    +  + CE +CC R Y  F    HE+CHCKF WCC +KC+ C  L    VC
Sbjct:   72 DVRHLLLAAAFLTCN-SQLLLVDA------NSWWSLGLTPI--QRP--EMYIIGAQPLCSQLSGLSQGQRKLCQLYQDHMTYIGDGAKTGIKECQYQFRQRRWNCSTVDNTSVFGRVMQIGSRETAFTYAISAAGVVNAISRACREGELSTCGCSRTARPRDLPRDWLWGGCGDNVYYGKRFAQEFVDAREREKNYPRGSREHARTLMNLHNNEAGRQAVYNLADVACKCHGVSGSCSLKTCWLQLADFRRVGEFLKEKYDSAAAMRIGRKG-RLELLDKRFNPPTPEDLVYIDLSPDYCHRNETTGSLGTQGRFCNKTSEGMDGCELMCCGRGYDQFRVYKHERCHCKFHWCCYVKCKRCSTLVDQFVC 429          
BLAST of Wnt5 vs. Ensembl Medaka
Match: wnt5a (protein Wnt-5a [Source:NCBI gene;Acc:101160069])

HSP 1 Score: 305.834 bits (782), Expect = 1.228e-99
Identity = 151/341 (44.28%), Postives = 211/341 (61.88%), Query Frame = 1
Query:  202 TWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQP--DELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            TWW++ + P        E   +  + +C +L G S  Q  +C  Y DHM  +  GA+ GI ECQ Q ++R+WNCS   NS V+G      ++E AF +AIS AGVV+A++R+C+EG+L++CGCS   RP+DL RDWLWGGCGDNL Y   F+K F+D RE+E +  +GS + A  ++NLHNN AGR AV +++  +CKCHGVSGSCSL++CW QL  F ++G  + +KYD A  ++ N +G   R +  H K   P  D+L+Y   SPDYC  ++      T GR C    +  + CE +CC R Y  F  E+ E+CHCKF WCC +KC+ C +     VC
Sbjct:  114 TWWSLAMNPLL----IPEAYIIGAQPLCSQLVGLSPGQKKLCQLYQDHMQYIGEGAKTGIRECQYQFRHRRWNCSTVDNSSVFGRVMQIGSRETAFMYAISAAGVVNAVSRACREGELNSCGCSRAARPKDLPRDWLWGGCGDNLDYGCRFSKQFVDAREREKTPLKGSYESARKLMNLHNNEAGRRAVLELAHASCKCHGVSGSCSLKTCWLQLADFRKVGDLLKEKYDSAAAMKLNSRG---RMVQMHSKFNAPTGDDLVYIDPSPDYCLKNQSTGSLGTVGRLCNKTSEGMDGCELMCCGRGYDQFKAEIVERCHCKFHWCCYVKCKRCSKTVDQFVC 447          
BLAST of Wnt5 vs. Ensembl Medaka
Match: wnt4 (Wnt family member 4 [Source:NCBI gene;Acc:100301590])

HSP 1 Score: 245.358 bits (625), Expect = 2.131e-77
Identity = 127/356 (35.67%), Postives = 198/356 (55.62%), Query Frame = 1
Query:  163 LLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQP---DELIYYKNSPDYCELSRVHSGFI-TSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            L++  +++ A  + W  +  L        S   S+  +  C RL G  + Q  IC +  + M AV  GA++ I+ECQ Q + R+WNCS      V+       T+EAAF +AIS A V  A+ R+C  G+L  CGC D N        + W GC DN+ Y   F+++F+D+RE+     +G    +  ++NLHNN AGR A+     V CKCHGVSGSC +++CWK +PPF ++G+ + +K+D A +V   RK    + +     + +P   ++L+Y + SPD+C+      G + T GR+C    K  + CE +CC R ++T   EV ++C CKF WCC +KC+ C ++ ++H C
Sbjct:   11 LMLCCALLSANASNWLYLAKL--------SSVGSIRDEETCERLRGLIQRQVQICKRSVEVMDAVRRGAQLAIDECQFQFRNRRWNCSTLETLPVFSKAITQGTREAAFVYAISAASVAFAVTRACSSGELEKCGC-DHNVHGVSPEGFQWSGCSDNIAYGVAFSQSFVDVRERS----KGGQSSSQALMNLHNNEAGRKAILSNMRVECKCHGVSGSCEVKTCWKAMPPFRKVGNVIKEKFDGATEVE-QRKVGSTKVLVPRNSQFKPHTDEDLVYLQPSPDFCDFDPRTPGMLGTVGRQCNRTSKAIDGCELMCCGRGFQTQEVEVVDRCSCKFHWCCYVKCKQCRKIVEIHTC 352          
BLAST of Wnt5 vs. Planmine SMEST
Match: SMESG000055035.1 (SMESG000055035.1)

HSP 1 Score: 775.778 bits (2002), Expect = 0.000e+0
Identity = 370/370 (100.00%), Postives = 370/370 (100.00%), Query Frame = 1
Query:  112 MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN
Sbjct:    1 MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 370          
BLAST of Wnt5 vs. Planmine SMEST
Match: SMESG000002069.1 (SMESG000002069.1)

HSP 1 Score: 209.92 bits (533), Expect = 1.265e-63
Identity = 116/346 (33.53%), Postives = 185/346 (53.47%), Query Frame = 1
Query:  208 WTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHN-----SDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDENRPEDLHR--DWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYC--ELSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVC 1218
            W ++ LP    SP    +   IK+IC  +S  S  +  +C  Y + M ++  GA++G+ EC +Q KY +WNC+   +     ++     T  S KE AF  +I ++GVV++I  SC +G L  C C  +   +D     D+ WGGC D++K+    +  F+D  +++       +     ++N HNN  GR  V+K     CKCHGVSG+CSLR+CW+++  F +IG  + + Y+  ++V +N     L       ++    +L+Y  NS DYC  + S  H G  T GREC     + + C+ LCC+R + T+   V E C CKF WCC+++C++C R   V+ C
Sbjct:   28 WIVKTLPITFTSPFQPNN---IKQICSLISEESSKEKNLCLTYPNMMVSIVYGAKLGLVECAQQFKYERWNCTFNKSFPKIMTNHLHEMTTRSVKETAFLFSIWSSGVVYSITNSCSKGDLKECYCDPQRHGQDKDNVGDFTWGGCSDHIKFGMKVSTIFLDNYDRK-------DQTGQTLMNQHNNRVGRRVVWKTRLKKCKCHGVSGACSLRTCWQRMNDFRRIGDMLKKLYNKPQKVTYNPFQKSLTFSKNRFRRPSKKKLVYIDNSQDYCIQDPSIGHPG--TGGRECNYTSSQHDSCQELCCHRGHLTYEMVVEENCDCKFFWCCEVRCKICSRKVFVYRC 361          
BLAST of Wnt5 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.301e-50
Identity = 119/389 (30.59%), Postives = 181/389 (46.53%), Query Frame = 1
Query:  139 FVGVTFYSLLIVDSIIIAI-----PATWWTMEVLPWKNQSPHSEKDSLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTK----------------EAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDE--NRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECK----LDRKKSE-RCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            F+ +    LL++D I I +        ++T+  L         E    ++    +  +   K Q  IC ++   +P+V  G  IGI+ECQ Q     WNC+  HN  +   F   S K                E+AF  ++++A V H ++++C  G+   CGC       PED   ++ W GC DN+ +   F+K F+D   K       S  L    VNLHN++AG   V     + CKCHGVSGSC  ++C++ LP   ++G  + +K+  A  VR N     L  +     ++   +L Y K SP++C  +  +    T GR C     L+ +  E  C  LCC R + T    V EKC CKF+WCC ++CQ C  L+    CN
Sbjct:    2 FLKILVTVLLVIDIISIKVYVNSGRGMFFTLMKL--------QESTKFDLNNTNIFCNQLMKLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCA-GHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED---NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGL----VNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMN--DFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 372          
BLAST of Wnt5 vs. Planmine SMEST
Match: SMESG000067888.1 (SMESG000067888.1)

HSP 1 Score: 172.17 bits (435), Expect = 1.476e-49
Identity = 110/328 (33.54%), Postives = 160/328 (48.78%), Query Frame = 1
Query:  307 KDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNCSIPHNSDVYGGFTYYSTK----------------EAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDE--NRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECK----LDRKKSE-RCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            K Q  IC ++   +P+V  G  IGI+ECQ Q     WNC+  HN  +   F   S K                E+AF  ++++A V H ++++C  G+   CGC       PED   ++ W GC DN+ +   F+K F+D   K       S  L    VNLHN++AG   V     + CKCHGVSGSC  ++C++ LP   ++G  + +K+  A  VR N     L  +     ++   +L Y K SP++C  +  +    T GR C     L+ +  E  C  LCC R + T    V EKC CKF+WCC ++CQ C  L+    CN
Sbjct:   23 KLQRSICLRHVGLIPSVIHGVDIGIQECQHQFFNSYWNCA-GHNLSIPDRFVSQSKKKHRKTYLDNLINKGLPESAFLLSMTSAAVAHQVSKACSSGQNKYCGCDRTIYETPED---NFQWAGCSDNVHFGAAFSKRFLDSPHKRKIKRNPSVGL----VNLHNSHAGTKIVIDNMMMKCKCHGVSGSCETKTCYRALPDLRKVGDILKEKFSKAILVRMN--DFKLVPMHSGESRITEHDLTYLKRSPNFCYHNPSYGSLGTQGRLCNNTQVLEHEFVEGSCAHLCCKRGFSTKQFLVKEKCQCKFVWCCTVQCQTCEILKVESRCN 340          
BLAST of Wnt5 vs. Planmine SMEST
Match: SMESG000066476.1 (SMESG000066476.1)

HSP 1 Score: 170.244 bits (430), Expect = 3.942e-48
Identity = 110/353 (31.16%), Postives = 165/353 (46.74%), Query Frame = 1
Query:  265 LEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYRQWNC-----------SIPHNSDVY----------------GGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLSTCGCSDE--NRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSNDLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQIGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCELSRVHSGFITSGRECKLD-----RKKSERCEGLCCNRRYRTFTREVHEKCHCKFIWCCKIKCQVCIRLEQVHVCN 1221
            L   +IC R+    K+Q  +C +++  MP+V  G  +GI ECQ Q     WNC           S+   S+ Y                      ST E+AF  +I +AGV + + ++C +G  S CGC     + P+D    + W GC  N+ +   F++ F+D REK     R     +  + N+HNN+ GR +V     V CKCHGVSGSC +R+C + LP F  +G  + +++    QV F       +  S  ++     +++Y  +SPD+C          T+GR C        ++    C  LCC R Y   T    E+CHCKF WCCK+ C+ C R     +CN
Sbjct:   61 LSTSKICKRVL---KNQKPLCEEHFPLMPSVVSGFMLGINECQFQFANHVWNCQGHNKTNNQQISLLQMSNTYIQKKPKRDRKLRNTYMDQLIAKSTPESAFILSIISAGVSYQVTKACSQGVHSNCGCDRTVYDAPKD--SKFTWSGCSHNIHFGAAFSRRFLDAREK----IRLKKQTSAALTNMHNNHVGRESVINKMIVKCKCHGVSGSCEMRTCSRNLPSFRVVGDQLKERFRKIIQVDFFDNKLIPKYPS--KEMFAEVDMLYLNDSPDHCHHDFGKGTLGTNGRICNDTYNNTYQEPENSCYRLCCQRGYHIKTYIKDEQCHCKFKWCCKVICETCKRKVIDAICN 402          
The following BLAST results are available for this feature:
BLAST of Wnt5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
WNT5B4.994e-10944.64Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5B4.994e-10944.64Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5B4.994e-10944.64Wnt family member 5B [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A5.024e-10544.06Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
WNT5A7.622e-10544.06Wnt family member 5A [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of Wnt5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cwn-22.877e-9943.93pep chromosome:WBcel235:IV:10067824:10070251:1 gen... [more]
egl-208.380e-6432.41Wnt homolog [Source:UniProtKB/TrEMBL;Acc:G5EG05][more]
cwn-13.005e-6033.94pep chromosome:WBcel235:II:130983:133598:-1 gene:W... [more]
mom-24.044e-5328.80pep chromosome:WBcel235:V:8355988:8358185:1 gene:W... [more]
mom-24.044e-5328.80pep chromosome:WBcel235:V:8355953:8358185:1 gene:W... [more]
back to top
BLAST of Wnt5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt21.818e-5535.09gene:FBgn0004360 transcript:FBtr0339383[more]
Wnt22.343e-5535.09gene:FBgn0004360 transcript:FBtr0088512[more]
Wnt64.995e-4433.82gene:FBgn0031902 transcript:FBtr0334800[more]
Wnt64.995e-4433.82gene:FBgn0031902 transcript:FBtr0303251[more]
Wnt46.295e-4131.95gene:FBgn0010453 transcript:FBtr0334799[more]
back to top
BLAST of Wnt5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt5b1.081e-11244.76wingless-type MMTV integration site family, member... [more]
wnt5b1.081e-11244.76wingless-type MMTV integration site family, member... [more]
wnt5b1.081e-11244.76wingless-type MMTV integration site family, member... [more]
wnt5a3.151e-9842.47wingless-type MMTV integration site family, member... [more]
wnt2bb4.802e-7838.82wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt5b1.763e-10946.31Wnt family member 5B [Source:NCBI gene;Acc:448452][more]
wnt5b2.458e-10844.92Wnt family member 5B [Source:NCBI gene;Acc:448452][more]
wnt5b4.514e-10848.24Wnt family member 5B [Source:NCBI gene;Acc:448452][more]
ENSXETT00000050987.11.377e-10442.82Wnt family member 5A [Source:NCBI gene;Acc:1017343... [more]
ENSXETT00000050993.12.117e-10442.82Wnt family member 5A [Source:NCBI gene;Acc:1017343... [more]
back to top
BLAST of Wnt5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Wnt5b3.993e-10644.06wingless-type MMTV integration site family, member... [more]
Wnt5b3.993e-10644.06wingless-type MMTV integration site family, member... [more]
Wnt5b7.389e-10644.06wingless-type MMTV integration site family, member... [more]
Wnt5a1.193e-10543.42wingless-type MMTV integration site family, member... [more]
Wnt5a1.590e-10543.42wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92050|WNT5B_DANRE8.160e-11244.76Protein Wnt-5b OS=Danio rerio OX=7955 GN=wnt5b PE=... [more]
sp|O42122|WNT5B_ORYLA4.566e-10945.76Protein Wnt-5b OS=Oryzias latipes OX=8090 GN=wnt5b... [more]
sp|P33945|WNT5B_XENLA8.938e-10946.31Protein Wnt-5b OS=Xenopus laevis OX=8355 GN=wnt5b ... [more]
sp|Q9H1J7|WNT5B_HUMAN2.398e-10844.64Protein Wnt-5b OS=Homo sapiens OX=9606 GN=WNT5B PE... [more]
sp|Q06443|WNT5B_AMBME2.477e-10845.88Protein Wnt-5b OS=Ambystoma mexicanum OX=8296 GN=W... [more]
back to top
BLAST of Wnt5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3U5B00.000e+0100.00Protein Wnt OS=Schmidtea mediterranea OX=79327 PE=... [more]
T1D1170.000e+076.22Protein Wnt OS=Dendrocoelum lacteum OX=27895 PE=2 ... [more]
A0A1S6WN060.000e+083.63Protein Wnt OS=Dugesia japonica OX=6161 PE=2 SV=1[more]
Q86LV30.000e+082.26Protein Wnt OS=Girardia tigrina OX=6162 GN=wnt5 PE... [more]
A0A4Z2D4Q31.170e-13854.55Protein Wnt OS=Schistosoma japonicum OX=6182 GN=EW... [more]
back to top
BLAST of Wnt5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt5a1.212e-10543.33Wnt family member 5A [Source:NCBI gene;Acc:1030372... [more]
wnt5b3.021e-10342.82wingless-type MMTV integration site family, member... [more]
wnt2ba5.675e-7638.82protein Wnt-2b-like [Source:NCBI gene;Acc:10302962... [more]
wnt2bb1.354e-7435.38wingless-type MMTV integration site family, member... [more]
wnt41.737e-7139.27wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010914.15.026e-9642.86pep scaffold:Pmarinus_7.0:GL478525:6655:13730:-1 g... [more]
wnt31.453e-7135.80wingless-type MMTV integration site family, member... [more]
wnt11.814e-4835.07wingless-type MMTV integration site family, member... [more]
ENSPMAT00000001922.13.368e-3927.73pep scaffold:Pmarinus_7.0:GL482023:1913:9516:-1 ge... [more]
wnt10a9.651e-3630.36wingless-type MMTV integration site family, member... [more]
back to top
BLAST of Wnt5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Wnt5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
WNT59.577e-9040.87Protein Wnt [Source:UniProtKB/TrEMBL;Acc:Q5IHW1][more]
WNT161.421e-7639.30Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S694][more]
WNT21.459e-7640.45Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7S3E5][more]
WNT31.513e-7234.35Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7RXF5][more]
EDO310005.549e-7133.88Protein Wnt [Source:UniProtKB/TrEMBL;Acc:A7SZ54][more]
back to top
BLAST of Wnt5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wnt5b5.094e-11045.76Wnt family member 5B [Source:NCBI gene;Acc:1000491... [more]
wnt5b1.077e-10945.14Wnt family member 5B [Source:NCBI gene;Acc:1000491... [more]
wnt5b1.785e-10945.14Wnt family member 5B [Source:NCBI gene;Acc:1000491... [more]
wnt5a1.228e-9944.28protein Wnt-5a [Source:NCBI gene;Acc:101160069][more]
wnt42.131e-7735.67Wnt family member 4 [Source:NCBI gene;Acc:10030159... [more]
back to top
BLAST of Wnt5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000055035.10.000e+0100.00SMESG000055035.1[more]
SMESG000002069.11.265e-6333.53SMESG000002069.1[more]
SMESG000067888.11.301e-5030.59SMESG000067888.1[more]
SMESG000067888.11.476e-4933.54SMESG000067888.1[more]
SMESG000066476.13.942e-4831.16SMESG000066476.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30016207
GenBankACJ64864.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016207 ID=SMED30016207|Name=Wnt5|organism=Schmidtea mediterranea sexual|type=transcript|length=1332bp
AATTAGACTTAATCGGCTTGCTATTTTTTTGTCGTTATTGTGATTGTTGT
CAATCTTTTCTACTTTTTGTTTTGGTTGAATTTATACACCATTTCCAGAA
TATATCATGACATGGATTATTTGACATTGTGGAAATATTTCGTCGGGGTG
ACCTTTTACTCATTGCTCATTGTCGACAGTATAATCATTGCCATTCCAGC
AACATGGTGGACCATGGAGGTGCTGCCGTGGAAAAATCAATCTCCTCATT
CAGAAAAAGATTCCTTAGAAATCAAACGGATATGCTTGAGATTAAGCGGA
TATTCAAAGGATCAAGCTCTGATCTGTACCAAATATTACGATCACATGCC
AGCAGTCAGCATCGGAGCCAGAATTGGAATTGAAGAGTGTCAAAGGCAGC
TGAAATACAGACAGTGGAACTGCTCAATACCCCATAATTCAGATGTTTAC
GGTGGTTTCACTTATTATTCAACCAAAGAAGCTGCATTTGCTCATGCTAT
TTCTAATGCCGGTGTCGTTCATGCTATTGCAAGAAGTTGTAAAGAAGGAA
AACTATCAACTTGTGGTTGCAGTGATGAAAATAGACCCGAAGATTTGCAC
AGAGATTGGTTGTGGGGAGGTTGTGGAGACAACTTGAAATATGCATATTG
GTTTGCCAAAAATTTCATTGATATAAGAGAGAAAGAAAGCAGTTTTCCAA
GAGGTTCAAACGATTTGGCCAATATAATGGTGAACCTTCACAATAACAAT
GCTGGAAGAATGGCAGTTTACAAAATGTCTTCAGTCGCGTGTAAGTGTCA
CGGAGTTTCTGGGTCGTGCAGCTTGAGAAGTTGCTGGAAACAGTTGCCAC
CATTTATCCAAATTGGACATCATATGACTCAAAAGTATGATATGGCCAAA
CAAGTCAGATTTAATCGAAAAGGAACTCATCTAAGAAAGATTTCAGGTCA
TCGAAAGAAACTGCAGCCAGATGAATTAATTTATTATAAAAATTCTCCAG
ACTATTGTGAATTGAGTCGTGTCCATTCTGGATTTATTACTTCCGGTCGA
GAGTGCAAACTGGACCGGAAAAAATCCGAACGTTGTGAAGGATTGTGTTG
CAATCGTAGATATCGAACATTCACCAGAGAGGTTCATGAAAAATGCCACT
GCAAATTTATTTGGTGCTGCAAAATCAAATGCCAAGTTTGCATTCGACTG
GAACAAGTCCATGTCTGTAACTGACGACTTTTGAAATTAGATTTAGCATT
GTCGCATTATGGAATATATATTTATATATTTTCACTGCAATGGGTTCACA
AAATATTATTTATGTTCTTTGTATATTTCTCT
back to top

protein sequence of SMED30016207-orf-1

>SMED30016207-orf-1 ID=SMED30016207-orf-1|Name=SMED30016207-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=371bp
MDYLTLWKYFVGVTFYSLLIVDSIIIAIPATWWTMEVLPWKNQSPHSEKD
SLEIKRICLRLSGYSKDQALICTKYYDHMPAVSIGARIGIEECQRQLKYR
QWNCSIPHNSDVYGGFTYYSTKEAAFAHAISNAGVVHAIARSCKEGKLST
CGCSDENRPEDLHRDWLWGGCGDNLKYAYWFAKNFIDIREKESSFPRGSN
DLANIMVNLHNNNAGRMAVYKMSSVACKCHGVSGSCSLRSCWKQLPPFIQ
IGHHMTQKYDMAKQVRFNRKGTHLRKISGHRKKLQPDELIYYKNSPDYCE
LSRVHSGFITSGRECKLDRKKSERCEGLCCNRRYRTFTREVHEKCHCKFI
WCCKIKCQVCIRLEQVHVCN*
back to top
Aliases
The feature 'Wnt5' has the following synonyms
Synonym
Wnt5
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000044cephalic ganglia
PLANA:0000097ventral nerve cord
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR043158Wnt_C
IPR005817Wnt
IPR018161Wnt_CS
Vocabulary: biological process
TermDefinition
GO:0016055Wnt signaling pathway
GO:0007275multicellular organism development
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
GO:0005578proteinaceous extracellular matrix
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR005817WntPRINTSPR01349WNTPROTEINcoord: 141..154
score: 51.11
coord: 122..136
score: 57.65
coord: 288..299
score: 55.05
coord: 228..242
score: 76.34
coord: 166..178
score: 56.24
IPR005817WntSMARTSM00097wnt1_3coord: 60..370
e-value: 5.2E-118
score: 408.0
IPR005817WntPFAMPF00110wntcoord: 62..370
e-value: 1.8E-96
score: 323.4
IPR005817WntPANTHERPTHR12027WNT RELATEDcoord: 41..370
IPR043158Wnt, C-terminal domainGENE3DG3DSA:3.30.2460.20coord: 310..370
e-value: 2.6E-10
score: 42.2
NoneNo IPR availablePANTHERPTHR12027:SF77PROTEIN WNT-5coord: 41..370
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR018161Wnt protein, conserved sitePROSITEPS00246WNT1coord: 227..236