V-type proton ATPase proteolipid subunit

Overview
NameV-type proton ATPase proteolipid subunit
Smed IDSMED30016201
Length (bp)917
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-type proton ATPase proteolipid subunit (SMED30016201) t-SNE clustered cells

Violin plots show distribution of expression levels for V-type proton ATPase proteolipid subunit (SMED30016201) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-type proton ATPase proteolipid subunit (SMED30016201) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-type proton ATPase proteolipid subunit (SMED30016201) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016201

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016201h1SMcG0013352 Contig429GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016201h1SMcG0018139 Contig429GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30016201h1SMcG0013352 Contig49505newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016201h1SMcG0013352 Contig49505uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
nervous systemSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016201h1SMcG0013352 dd_Smed_v4_253_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016201h1SMcG0013352 Contig20062uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016201h1SMcG0013352 Contig20062newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
intestinal phagocyteSMED30016201h1SMcG0013352 dd_Smed_v6_253_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016201h1SMcG0013352 dd_Smed_v6_253_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Human
Match: ATP6V0C (ATPase H+ transporting V0 subunit c [Source:HGNC Symbol;Acc:HGNC:855])

HSP 1 Score: 197.208 bits (500), Expect = 8.170e-63
Identity = 125/150 (83.33%), Postives = 132/150 (88.00%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            S P Y  FF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPE IMKSIIPVVMAGIIAIYGLVVAVLIA  L+  + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 SGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Human
Match: ATP6V0C (ATPase H+ transporting V0 subunit c [Source:HGNC Symbol;Acc:HGNC:855])

HSP 1 Score: 142.51 bits (358), Expect = 3.862e-42
Identity = 97/112 (86.61%), Postives = 101/112 (90.18%), Query Frame = 2
Query:  194 MAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            M+VMRPE IMKSIIPVVMAGIIAIYGLVVAVLIA  L+  + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 112          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Human
Match: ATP6V0C (ATPase H+ transporting V0 subunit c [Source:HGNC Symbol;Acc:HGNC:855])

HSP 1 Score: 142.51 bits (358), Expect = 3.862e-42
Identity = 97/112 (86.61%), Postives = 101/112 (90.18%), Query Frame = 2
Query:  194 MAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            M+VMRPE IMKSIIPVVMAGIIAIYGLVVAVLIA  L+  + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSVMRPEQIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDDISLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 112          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Match: vha-3 (V-type proton ATPase 16 kDa proteolipid subunit 2/3 [Source:RefSeq peptide;Acc:NP_500188])

HSP 1 Score: 171.014 bits (432), Expect = 6.418e-53
Identity = 104/149 (69.80%), Postives = 118/149 (79.19%), Query Frame = 2
Query:   92 YTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSS---LKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            Y PFFG MG  SA +F  LGAAYGTAKS  GI SM VMRPELIMKS+IPV+MAGII IYGLVVA+++  K+ S+     +     +L AGL+ GL GL AG+AIGIVGDAGVRGTAQQPRLFVGMILILIF+EVLGLYG+IVALIL T 
Sbjct:   13 YAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS 161          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Match: vha-3 (V-type proton ATPase 16 kDa proteolipid subunit 2/3 [Source:RefSeq peptide;Acc:NP_500188])

HSP 1 Score: 171.014 bits (432), Expect = 6.418e-53
Identity = 104/149 (69.80%), Postives = 118/149 (79.19%), Query Frame = 2
Query:   92 YTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSS---LKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            Y PFFG MG  SA +F  LGAAYGTAKS  GI SM VMRPELIMKS+IPV+MAGII IYGLVVA+++  K+ S+     +     +L AGL+ GL GL AG+AIGIVGDAGVRGTAQQPRLFVGMILILIF+EVLGLYG+IVALIL T 
Sbjct:   13 YAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS 161          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Match: vha-2 (V-type proton ATPase 16 kDa proteolipid subunit 2 [Source:UniProtKB/Swiss-Prot;Acc:C0HLB3])

HSP 1 Score: 171.014 bits (432), Expect = 6.418e-53
Identity = 104/149 (69.80%), Postives = 118/149 (79.19%), Query Frame = 2
Query:   92 YTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSS---LKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            Y PFFG MG  SA +F  LGAAYGTAKS  GI SM VMRPELIMKS+IPV+MAGII IYGLVVA+++  K+ S+     +     +L AGL+ GL GL AG+AIGIVGDAGVRGTAQQPRLFVGMILILIF+EVLGLYG+IVALIL T 
Sbjct:   13 YAPFFGYMGAASAQIFTVLGAAYGTAKSAVGICSMGVMRPELIMKSVIPVIMAGIIGIYGLVVAMVLKGKVTSASAGYDLNKGFAHLAAGLTCGLCGLGAGYAIGIVGDAGVRGTAQQPRLFVGMILILIFSEVLGLYGMIVALILGTS 161          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Match: vha-1 (V-type proton ATPase 16 kDa proteolipid subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21898])

HSP 1 Score: 157.918 bits (398), Expect = 9.971e-48
Identity = 101/154 (65.58%), Postives = 125/154 (81.17%), Query Frame = 2
Query:   68 ILQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD---SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALIL 520
            +L+  + +Y PFFG +GVTSAM F A G+AYGTAK+GTGIASMAV RP+L+MK+IIPVVMAGI+AIYGLVVAV+++ K++   ++  + N+      GL  GL GL AG+AIGI GDAGVR  +QQPR+FVGMILILIFAEVLGLYG+IVALIL
Sbjct:   13 LLKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARPDLVMKAIIPVVMAGIVAIYGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGAGYAIGIAGDAGVRALSQQPRMFVGMILILIFAEVLGLYGMIVALIL 166          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Match: vha-1 (V-type proton ATPase 16 kDa proteolipid subunit 1 [Source:UniProtKB/Swiss-Prot;Acc:Q21898])

HSP 1 Score: 157.918 bits (398), Expect = 9.971e-48
Identity = 101/154 (65.58%), Postives = 125/154 (81.17%), Query Frame = 2
Query:   68 ILQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD---SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALIL 520
            +L+  + +Y PFFG +GVTSAM F A G+AYGTAK+GTGIASMAV RP+L+MK+IIPVVMAGI+AIYGLVVAV+++ K++   ++  + N+      GL  GL GL AG+AIGI GDAGVR  +QQPR+FVGMILILIFAEVLGLYG+IVALIL
Sbjct:   13 LLKNEQAMYGPFFGSLGVTSAMAFAAAGSAYGTAKAGTGIASMAVARPDLVMKAIIPVVMAGIVAIYGLVVAVIVSGKVEPAGANYTINNAFSQFAGGLVCGLCGLGAGYAIGIAGDAGVRALSQQPRMFVGMILILIFAEVLGLYGMIVALIL 166          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Match: Vha16-1 (gene:FBgn0262736 transcript:FBtr0086153)

HSP 1 Score: 191.815 bits (486), Expect = 6.228e-61
Identity = 122/152 (80.26%), Postives = 131/152 (86.18%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD--SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
              PIY PFFGVMG  SA++F ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L+  S   +     +LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVA+ L TK
Sbjct:    8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Match: Vha16-1 (gene:FBgn0262736 transcript:FBtr0086152)

HSP 1 Score: 191.815 bits (486), Expect = 6.228e-61
Identity = 122/152 (80.26%), Postives = 131/152 (86.18%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD--SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
              PIY PFFGVMG  SA++F ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L+  S   +     +LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVA+ L TK
Sbjct:    8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Match: Vha16-1 (gene:FBgn0262736 transcript:FBtr0086151)

HSP 1 Score: 191.815 bits (486), Expect = 6.228e-61
Identity = 122/152 (80.26%), Postives = 131/152 (86.18%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD--SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
              PIY PFFGVMG  SA++F ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L+  S   +     +LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVA+ L TK
Sbjct:    8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Match: Vha16-1 (gene:FBgn0262736 transcript:FBtr0086150)

HSP 1 Score: 191.815 bits (486), Expect = 6.228e-61
Identity = 122/152 (80.26%), Postives = 131/152 (86.18%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD--SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
              PIY PFFGVMG  SA++F ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L+  S   +     +LGAGL+VG SGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVA+ L TK
Sbjct:    8 DNPIYGPFFGVMGAASAIIFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAGALEEPSKYSLYRGFIHLGAGLAVGFSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 159          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Match: Vha16-3 (gene:FBgn0028667 transcript:FBtr0076090)

HSP 1 Score: 190.274 bits (482), Expect = 1.947e-60
Identity = 118/150 (78.67%), Postives = 128/150 (85.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
             +P Y+ FFG MG  SA++F ALGAAYGTAKSGTGIA+MAVMRPELIMKSIIPVVMAGIIAIYGLVV+VLIA  L  S  +     +L AGLSVG +GLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVA+ L TK
Sbjct:    9 DKPAYSFFFGSMGAASAIIFSALGAAYGTAKSGTGIAAMAVMRPELIMKSIIPVVMAGIIAIYGLVVSVLIAGSLSDSYTIRKGYIHLAAGLSVGFAGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAIYLYTK 158          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Zebrafish
Match: atp6v0ca (ATPase H+ transporting V0 subunit ca [Source:ZFIN;Acc:ZDB-GENE-020419-23])

HSP 1 Score: 204.142 bits (518), Expect = 9.520e-66
Identity = 126/153 (82.35%), Postives = 135/153 (88.24%), Query Frame = 2
Query:   71 LQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +    P Y+PFF VMG +SAMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MDTQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNIGDKISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Zebrafish
Match: atp6v0ca (ATPase H+ transporting V0 subunit ca [Source:ZFIN;Acc:ZDB-GENE-020419-23])

HSP 1 Score: 204.142 bits (518), Expect = 9.520e-66
Identity = 126/153 (82.35%), Postives = 135/153 (88.24%), Query Frame = 2
Query:   71 LQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +    P Y+PFF VMG +SAMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MDTQNPQYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNIGDKISLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Zebrafish
Match: atp6v0cb (ATPase H+ transporting V0 subunit cb [Source:ZFIN;Acc:ZDB-GENE-030131-4127])

HSP 1 Score: 202.601 bits (514), Expect = 3.997e-65
Identity = 125/149 (83.89%), Postives = 134/149 (89.93%), Query Frame = 2
Query:   83 EPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
             P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    5 SPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSISDKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Zebrafish
Match: atp6v0b (ATPase H+ transporting V0 subunit b [Source:ZFIN;Acc:ZDB-GENE-030131-443])

HSP 1 Score: 53.5286 bits (127), Expect = 4.360e-8
Identity = 47/156 (30.13%), Postives = 85/156 (54.49%), Query Frame = 2
Query:   95 TPF-FGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDS----------SLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +PF +  +G+  A+    +GAA+G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I+   ++          S   +      GAGL+VG S L  G  +GIVG       AQ   LFV ++++ IF   +GL+G+IVA++ ++K
Sbjct:   46 SPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNLAENFSGTTPETIGSKNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNANLFVRILIVEIFGSAIGLFGVIVAILQTSK 201          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Xenopus
Match: atp6v0c (ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [Source:NCBI gene;Acc:394488])

HSP 1 Score: 204.142 bits (518), Expect = 1.191e-65
Identity = 129/150 (86.00%), Postives = 135/150 (90.00%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            S P Y+ FF VMG +SAMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L SS+ +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    7 SAPEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 156          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Xenopus
Match: atp6v0c (ATPase, H+ transporting, lysosomal 16kDa, V0 subunit c [Source:NCBI gene;Acc:394488])

HSP 1 Score: 201.83 bits (512), Expect = 9.703e-65
Identity = 128/150 (85.33%), Postives = 135/150 (90.00%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            + P Y+ FF VMG +SAMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L SS+ +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    7 NAPEYSAFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTSSITLYKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 156          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Xenopus
Match: atp6v0b (ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b [Source:NCBI gene;Acc:549818])

HSP 1 Score: 55.0694 bits (131), Expect = 2.118e-8
Identity = 44/138 (31.88%), Postives = 75/138 (54.35%), Query Frame = 2
Query:  146 LGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDS----------SLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +GAA+G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I+   +           S          GAGL+VG S L  G  +GIVG       AQ P LFV ++++ IF   +GL+G+IVA++ ++K
Sbjct:   63 VGAAWGIYITGSSILGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEQFKGTTPEAIGSRNYHAGFSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSK 200          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Xenopus
Match: atp6v0b (ATPase, H+ transporting, lysosomal 21kDa, V0 subunit b [Source:NCBI gene;Acc:549818])

HSP 1 Score: 51.9878 bits (123), Expect = 2.553e-7
Identity = 43/134 (32.09%), Postives = 72/134 (53.73%), Query Frame = 2
Query:  146 LGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDS----------SLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALI 517
            +GAA+G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I+   +           S          GAGL+VG S L  G  +GIVG       AQ P LFV ++++ IF   +GL+G+IVA++
Sbjct:   64 VGAAWGIYITGSSILGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAEQFKGTTPEAIGSRNYHAGFSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAIL 197          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Mouse
Match: Atp6v0c (ATPase, H+ transporting, lysosomal V0 subunit C [Source:MGI Symbol;Acc:MGI:88116])

HSP 1 Score: 201.06 bits (510), Expect = 1.473e-64
Identity = 126/150 (84.00%), Postives = 134/150 (89.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            + P Y+ FFGVMG +SAMVF A+GAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Mouse
Match: Atp6v0c (ATPase, H+ transporting, lysosomal V0 subunit C [Source:MGI Symbol;Acc:MGI:88116])

HSP 1 Score: 201.06 bits (510), Expect = 1.473e-64
Identity = 126/150 (84.00%), Postives = 134/150 (89.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            + P Y+ FFGVMG +SAMVF A+GAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Mouse
Match: Atp6v0c (ATPase, H+ transporting, lysosomal V0 subunit C [Source:MGI Symbol;Acc:MGI:88116])

HSP 1 Score: 191.43 bits (485), Expect = 8.025e-61
Identity = 121/145 (83.45%), Postives = 129/145 (88.97%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAL 514
            + P Y+ FFGVMG +SAMVF A+GAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAL
Sbjct:    6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVAL 150          
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Match: sp|P63081|VATL_RAT (V-type proton ATPase 16 kDa proteolipid subunit OS=Rattus norvegicus OX=10116 GN=Atp6v0c PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.030e-63
Identity = 126/150 (84.00%), Postives = 134/150 (89.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            + P Y+ FFGVMG +SAMVF A+GAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Match: sp|P63082|VATL_MOUSE (V-type proton ATPase 16 kDa proteolipid subunit OS=Mus musculus OX=10090 GN=Atp6v0c PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.030e-63
Identity = 126/150 (84.00%), Postives = 134/150 (89.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            + P Y+ FFGVMG +SAMVF A+GAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 NNPEYSSFFGVMGASSAMVFSAMGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTDGITLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Match: sp|O18882|VATL_SHEEP (V-type proton ATPase 16 kDa proteolipid subunit OS=Ovis aries OX=9940 GN=ATP6V0C PE=2 SV=1)

HSP 1 Score: 198.749 bits (504), Expect = 1.113e-62
Identity = 125/150 (83.33%), Postives = 133/150 (88.67%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            S P Y  FF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPE+IMKSIIPVVMAGIIAIYGLVVAVLIA  L+  + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    6 SGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Match: sp|P23956|VATL_BOVIN (V-type proton ATPase 16 kDa proteolipid subunit OS=Bos taurus OX=9913 GN=ATP6V0C PE=1 SV=1)

HSP 1 Score: 197.593 bits (501), Expect = 2.541e-62
Identity = 127/155 (81.94%), Postives = 135/155 (87.10%), Query Frame = 2
Query:   77 MSE----PIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            MSE    P Y  FF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPE+IMKSIIPVVMAGIIAIYGLVVAVLIA  L+  + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSEAKNGPEYASFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDGISLYRSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 155          
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Match: sp|Q03105|VATL_TORMA (V-type proton ATPase 16 kDa proteolipid subunit OS=Torpedo marmorata OX=7788 PE=1 SV=1)

HSP 1 Score: 197.208 bits (500), Expect = 3.445e-62
Identity = 125/148 (84.46%), Postives = 133/148 (89.86%), Query Frame = 2
Query:   86 PIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            P Y+ FFGV+G ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L   + +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    7 PEYSAFFGVIGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSLTEDISLFKSFLQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 154          
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Match: A0A267DLB5 (V-type proton ATPase proteolipid subunit OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig030187g1 PE=3 SV=1)

HSP 1 Score: 211.846 bits (538), Expect = 1.831e-65
Identity = 122/151 (80.79%), Postives = 141/151 (93.38%), Query Frame = 2
Query:   71 LQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILS 523
            + +++P+YTPFFGVMG ++AMVFCALGAAYGTAKSGTGIA+MAV+RPELIMKS++PVVMAGIIAIYGLVVAVLI+Q +     +E SL++LGAGL+VGLSGLA+G+AIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYG IVALILS
Sbjct:    1 MTINDPLYTPFFGVMGASAAMVFCALGAAYGTAKSGTGIANMAVLRPELIMKSVVPVVMAGIIAIYGLVVAVLISQNMTPDYTVEKSLRHLGAGLAVGLSGLASGYAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGFIVALILS 151          
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Match: A0A448WK92 (V-type proton ATPase proteolipid subunit OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS7258 PE=3 SV=1)

HSP 1 Score: 211.46 bits (537), Expect = 4.343e-65
Identity = 132/149 (88.59%), Postives = 138/149 (92.62%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILST 526
            S+PIYTPFF VMG TS+MVFCALGAAYGTAKSG+GI SM VMRPELIMKSI+PVVMAGI+AIYGLVVAVLIAQ   S + ME SLK LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILST
Sbjct:   24 SDPIYTPFFSVMGATSSMVFCALGAAYGTAKSGSGICSMGVMRPELIMKSIVPVVMAGIVAIYGLVVAVLIAQSGQSKI-MEKSLKQLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILST 171          
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Match: A0A3B3XBH1 (V-type proton ATPase proteolipid subunit OS=Poecilia mexicana OX=48701 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.071e-63
Identity = 126/151 (83.44%), Postives = 136/151 (90.07%), Query Frame = 2
Query:   77 MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            MS P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +  ++ +  S  +L AGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSSPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISDNISLYKSFCHLAAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 151          
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Match: A0A3B3UP06 (V-type proton ATPase proteolipid subunit OS=Poecilia latipinna OX=48699 PE=3 SV=1)

HSP 1 Score: 207.223 bits (526), Expect = 1.071e-63
Identity = 126/151 (83.44%), Postives = 136/151 (90.07%), Query Frame = 2
Query:   77 MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            MS P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +  ++ +  S  +L AGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSSPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISDNISLYKSFCHLAAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 151          
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Match: A0A1A7WUY8 (V-type proton ATPase proteolipid subunit (Fragment) OS=Iconisemion striatum OX=60296 GN=Nfu_g_1_022957 PE=3 SV=1)

HSP 1 Score: 206.838 bits (525), Expect = 1.619e-63
Identity = 127/152 (83.55%), Postives = 137/152 (90.13%), Query Frame = 2
Query:   74 QMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +MS P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    2 RMSSPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISDKITLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Cavefish
Match: atp6v0cb (V-type proton ATPase 16 kDa proteolipid subunit-like [Source:NCBI gene;Acc:103036123])

HSP 1 Score: 205.682 bits (522), Expect = 2.006e-66
Identity = 126/150 (84.00%), Postives = 137/150 (91.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            ++P+Y+PFF VMG +SAMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA    S + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILST+
Sbjct:    5 AQPMYSPFFAVMGASSAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANSTTSDVTLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTR 154          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Cavefish
Match: atp6v0ca (V-type proton ATPase 16 kDa proteolipid subunit [Source:NCBI gene;Acc:103027532])

HSP 1 Score: 202.601 bits (514), Expect = 3.616e-65
Identity = 125/153 (81.70%), Postives = 135/153 (88.24%), Query Frame = 2
Query:   71 LQMSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +    P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSAESPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISEKVTLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Cavefish
Match: atp6v0b (ATPase H+ transporting V0 subunit b [Source:NCBI gene;Acc:103033629])

HSP 1 Score: 53.5286 bits (127), Expect = 3.425e-8
Identity = 48/156 (30.77%), Postives = 85/156 (54.49%), Query Frame = 2
Query:   95 TPF-FGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDS----------SLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +PF +  +G+  A+    +GAA+G   +G+ I    V  P +  K++I ++    +AIYG+++A++I+   +S          +   +      GAGL+VG S L  G  +GIVG       AQ   LFV ++++ IF   +GL+G+IVA++ ++K
Sbjct:   46 SPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLISIIFCEAVAIYGIIMAIVISNMAESFSGTTPETIGARNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNGSLFVKILIVEIFGSAIGLFGIIVAILQTSK 201          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Sea Lamprey
Match: atp6v0ca (ATPase H+ transporting V0 subunit ca [Source:ZFIN;Acc:ZDB-GENE-020419-23])

HSP 1 Score: 182.57 bits (462), Expect = 2.644e-58
Identity = 117/133 (87.97%), Postives = 123/133 (92.48%), Query Frame = 2
Query:  131 MVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            MVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  L  ++ +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANGLTENITLFKSFMHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 133          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Yeast
Match: VMA3 (Proteolipid subunit c of the V0 domain of vacuolar H(+)-ATPase; dicyclohexylcarbodiimide binding subunit; required for vacuolar acidification and important for copper and iron metal ion homeostasis [Source:SGD;Acc:S000000753])

HSP 1 Score: 169.088 bits (427), Expect = 6.289e-53
Identity = 106/156 (67.95%), Postives = 128/156 (82.05%), Query Frame = 2
Query:   77 MSE--PIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK*MQ 538
            M+E  P+Y PFFG +G  SA++F +LGAAYGTAKSG GI +  V+RP+L+ K+I+PV+MAGIIAIYGLVV+VL+   L     +      LGAGLSVGLSGLAAGFAIGIVGDAGVRG++QQPRLFVGMILILIFAEVLGLYGLIVAL+L+++  Q
Sbjct:    1 MTELCPVYAPFFGAIGCASAIIFTSLGAAYGTAKSGVGICATCVLRPDLLFKNIVPVIMAGIIAIYGLVVSVLVCYSLGQKQALYTGFIQLGAGLSVGLSGLAAGFAIGIVGDAGVRGSSQQPRLFVGMILILIFAEVLGLYGLIVALLLNSRATQ 156          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Yeast
Match: VMA11 (Vacuolar ATPase V0 domain subunit c'; involved in proton transport activity; hydrophobic integral membrane protein (proteolipid) containing four transmembrane segments; N and C termini are in the vacuolar lumen [Source:SGD;Acc:S000006155])

HSP 1 Score: 154.451 bits (389), Expect = 3.804e-47
Identity = 93/150 (62.00%), Postives = 113/150 (75.33%), Query Frame = 2
Query:   86 PIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLD--SSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            P+Y PFFG  G  +AMV   LGAA GTAKSG GIA +   +PELIMKS+IPVVM+GI+AIYGLVVAVLIA  L       + N   +L  GL VG + L++G+AIG+VGD GVR    QPRLFVG++LILIF+EVLGLYG+IVALIL+T+
Sbjct:   12 PLYAPFFGFAGCAAAMVLSCLGAAIGTAKSGIGIAGIGTFKPELIMKSLIPVVMSGILAIYGLVVAVLIAGNLSPTEDYTLFNGFMHLSCGLCVGFACLSSGYAIGMVGDVGVRKYMHQPRLFVGIVLILIFSEVLGLYGMIVALILNTR 161          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Nematostella
Match: EDO45670 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RS13])

HSP 1 Score: 196.438 bits (498), Expect = 3.223e-63
Identity = 124/150 (82.67%), Postives = 131/150 (87.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
             +P Y  FFGVMG T+AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLI   +     +  S   LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALIL+TK
Sbjct:    5 DQPSYVAFFGVMGATAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIGSSISKDYTLYKSFLDLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILTTK 154          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Nematostella
Match: EDO28376 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6M9])

HSP 1 Score: 88.1965 bits (217), Expect = 1.242e-22
Identity = 45/46 (97.83%), Postives = 46/46 (100.00%), Query Frame = 2
Query:  392 IGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            IGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALIL+TK
Sbjct:    6 IGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILTTK 51          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Nematostella
Match: EDO46167 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RQU4])

HSP 1 Score: 48.1358 bits (113), Expect = 9.222e-7
Identity = 44/158 (27.85%), Postives = 85/158 (53.80%), Query Frame = 2
Query:   95 TPF-FGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQK-----LDSSLKMEN-------SLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +P+ +  +G+  A+    +GAA+G   +G  I    V  P +  K+++ ++    +AIYG++++++++       L++  K  N         K  GAG++VG   LA G  +G+VG       AQ   LFV ++++ IF   +GL+G+I+A+I ++ 
Sbjct:   49 SPYMWACLGIAIAIALSVVGAAWGILLTGASICGGGVKAPRIKAKNLVSIIFCEAVAIYGIIMSIVLSNSVTVSPLEAFEKPGNLMQLYTAGYKIFGAGMTVGFCNLACGICVGLVGSGAALADAQNGALFVKILIVEIFGSAIGLFGVIIAIIQASD 206          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Medaka
Match: ATP6V0C (V-type proton ATPase 16 kDa proteolipid subunit [Source:NCBI gene;Acc:101160850])

HSP 1 Score: 202.216 bits (513), Expect = 3.920e-65
Identity = 125/149 (83.89%), Postives = 135/149 (90.60%), Query Frame = 2
Query:   83 EPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
             P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +  ++ +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    5 SPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNVAENISLFKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 153          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Medaka
Match: ATP6V0C (V-type proton ATPase 16 kDa proteolipid subunit [Source:NCBI gene;Acc:101159507])

HSP 1 Score: 201.83 bits (512), Expect = 5.314e-65
Identity = 125/150 (83.33%), Postives = 134/150 (89.33%), Query Frame = 2
Query:   80 SEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
              P Y+PFF VMG ++AMVF ALGAAYGTAKSGTGIA+M+VMRPELIMKSIIPVVMAGIIAIYGLVVAVLIA  +   + +  S  +LGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    5 ESPEYSPFFAVMGASAAMVFSALGAAYGTAKSGTGIAAMSVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIANNISERVSLYKSFLHLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 154          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Medaka
Match: atp6v0b (ATPase H+ transporting V0 subunit b [Source:NCBI gene;Acc:101162246])

HSP 1 Score: 55.4546 bits (132), Expect = 9.932e-9
Identity = 48/156 (30.77%), Postives = 86/156 (55.13%), Query Frame = 2
Query:   95 TPF-FGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLI---AQKLDSSL-------KMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +PF +  +G+  A+    +GAA+G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I   A++   +          +      GAGL+VG S L  G  +GIVG       AQ P LFV ++++ IF   +GL+G+IVA++ ++K
Sbjct:   51 SPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAERFSGTTPETIGARNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSK 206          
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Medaka
Match: atp6v0b (ATPase H+ transporting V0 subunit b [Source:NCBI gene;Acc:101162246])

HSP 1 Score: 55.4546 bits (132), Expect = 9.932e-9
Identity = 48/156 (30.77%), Postives = 86/156 (55.13%), Query Frame = 2
Query:   95 TPF-FGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLI---AQKLDSSL-------KMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            +PF +  +G+  A+    +GAA+G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I   A++   +          +      GAGL+VG S L  G  +GIVG       AQ P LFV ++++ IF   +GL+G+IVA++ ++K
Sbjct:   51 SPFMWANLGIGLAISLSVVGAAWGIYITGSSIIGGGVKAPRIKTKNLVSIIFCEAVAIYGIIMAIVISNMAERFSGTTPETIGARNYQAGYSMFGAGLTVGFSNLFCGICVGIVGSGAALADAQNPSLFVKILIVEIFGSAIGLFGVIVAILQTSK 206          
BLAST of V-type proton ATPase proteolipid subunit vs. Planmine SMEST
Match: SMESG000068628.1 (SMESG000068628.1)

HSP 1 Score: 252.292 bits (643), Expect = 7.159e-85
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 2
Query:   77 MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYXXXXXXXXXXXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 529
            MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK
Sbjct:    1 MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYLGAGLSVGLSGLAAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILSTK 151          
BLAST of V-type proton ATPase proteolipid subunit vs. Planmine SMEST
Match: SMESG000042238.1 (SMESG000042238.1)

HSP 1 Score: 50.0618 bits (118), Expect = 3.947e-7
Identity = 39/135 (28.89%), Postives = 68/135 (50.37%), Query Frame = 2
Query:  146 LGAAYGTAKSGTGIASMAVMRPELIMKSIIPVVMAGIIAIYGLVVAVLIAQKL---DSSLKMENSLKYXXXXXXXXX--------XXXXXXXXIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALI 517
            LGAA G   +G+ I    V  P +  K+++ ++    +AIYG+++A++I+Q +   D S+   N LK   A              S L  G  +G+VG       +    LFV ++++ IF   +GL+G+IV ++
Sbjct:   64 LGAALGIYTTGSSILGAGVKTPRIRTKNLVSIIFCEAVAIYGIIMAIVISQNIASFDRSIASFNVLKANYAAAFRMFGAGLTVGLSNLVCGICVGVVGSGAALADSANASLFVKILIVEIFGSAIGLFGVIVGIL 198          
The following BLAST results are available for this feature:
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ATP6V0C8.170e-6383.33ATPase H+ transporting V0 subunit c [Source:HGNC S... [more]
ATP6V0C3.862e-4286.61ATPase H+ transporting V0 subunit c [Source:HGNC S... [more]
ATP6V0C3.862e-4286.61ATPase H+ transporting V0 subunit c [Source:HGNC S... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vha-36.418e-5369.80V-type proton ATPase 16 kDa proteolipid subunit 2/... [more]
vha-36.418e-5369.80V-type proton ATPase 16 kDa proteolipid subunit 2/... [more]
vha-26.418e-5369.80V-type proton ATPase 16 kDa proteolipid subunit 2 ... [more]
vha-19.971e-4865.58V-type proton ATPase 16 kDa proteolipid subunit 1 ... [more]
vha-19.971e-4865.58V-type proton ATPase 16 kDa proteolipid subunit 1 ... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vha16-16.228e-6180.26gene:FBgn0262736 transcript:FBtr0086153[more]
Vha16-16.228e-6180.26gene:FBgn0262736 transcript:FBtr0086152[more]
Vha16-16.228e-6180.26gene:FBgn0262736 transcript:FBtr0086151[more]
Vha16-16.228e-6180.26gene:FBgn0262736 transcript:FBtr0086150[more]
Vha16-31.947e-6078.67gene:FBgn0028667 transcript:FBtr0076090[more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6v0ca9.520e-6682.35ATPase H+ transporting V0 subunit ca [Source:ZFIN;... [more]
atp6v0ca9.520e-6682.35ATPase H+ transporting V0 subunit ca [Source:ZFIN;... [more]
atp6v0cb3.997e-6583.89ATPase H+ transporting V0 subunit cb [Source:ZFIN;... [more]
atp6v0b4.360e-830.13ATPase H+ transporting V0 subunit b [Source:ZFIN;A... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
atp6v0c1.191e-6586.00ATPase, H+ transporting, lysosomal 16kDa, V0 subun... [more]
atp6v0c9.703e-6585.33ATPase, H+ transporting, lysosomal 16kDa, V0 subun... [more]
atp6v0b2.118e-831.88ATPase, H+ transporting, lysosomal 21kDa, V0 subun... [more]
atp6v0b2.553e-732.09ATPase, H+ transporting, lysosomal 21kDa, V0 subun... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Atp6v0c1.473e-6484.00ATPase, H+ transporting, lysosomal V0 subunit C [S... [more]
Atp6v0c1.473e-6484.00ATPase, H+ transporting, lysosomal V0 subunit C [S... [more]
Atp6v0c8.025e-6183.45ATPase, H+ transporting, lysosomal V0 subunit C [S... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63081|VATL_RAT1.030e-6384.00V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
sp|P63082|VATL_MOUSE1.030e-6384.00V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
sp|O18882|VATL_SHEEP1.113e-6283.33V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
sp|P23956|VATL_BOVIN2.541e-6281.94V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
sp|Q03105|VATL_TORMA3.445e-6284.46V-type proton ATPase 16 kDa proteolipid subunit OS... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DLB51.831e-6580.79V-type proton ATPase proteolipid subunit OS=Macros... [more]
A0A448WK924.343e-6588.59V-type proton ATPase proteolipid subunit OS=Protop... [more]
A0A3B3XBH11.071e-6383.44V-type proton ATPase proteolipid subunit OS=Poecil... [more]
A0A3B3UP061.071e-6383.44V-type proton ATPase proteolipid subunit OS=Poecil... [more]
A0A1A7WUY81.619e-6383.55V-type proton ATPase proteolipid subunit (Fragment... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
atp6v0cb2.006e-6684.00V-type proton ATPase 16 kDa proteolipid subunit-li... [more]
atp6v0ca3.616e-6581.70V-type proton ATPase 16 kDa proteolipid subunit [S... [more]
atp6v0b3.425e-830.77ATPase H+ transporting V0 subunit b [Source:NCBI g... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
atp6v0ca2.644e-5887.97ATPase H+ transporting V0 subunit ca [Source:ZFIN;... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
VMA36.289e-5367.95Proteolipid subunit c of the V0 domain of vacuolar... [more]
VMA113.804e-4762.00Vacuolar ATPase V0 domain subunit c'; involved in ... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO456703.223e-6382.67Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283761.242e-2297.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO461679.222e-727.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ATP6V0C3.920e-6583.89V-type proton ATPase 16 kDa proteolipid subunit [S... [more]
ATP6V0C5.314e-6583.33V-type proton ATPase 16 kDa proteolipid subunit [S... [more]
atp6v0b9.932e-930.77ATPase H+ transporting V0 subunit b [Source:NCBI g... [more]
atp6v0b9.932e-930.77ATPase H+ transporting V0 subunit b [Source:NCBI g... [more]
back to top
BLAST of V-type proton ATPase proteolipid subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000068628.17.159e-85100.00SMESG000068628.1[more]
SMESG000042238.13.947e-728.89SMESG000042238.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016201 ID=SMED30016201|Name=V-type proton ATPase proteolipid subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=917bp
AAATAAATATACCTTGTTTTAATTATTTAAATAATTACGTTTTTGGAAGT
AATAATTCATTTTAATAATATTGCAAATGTCAGAACCTATTTATACTCCT
TTCTTTGGTGTCATGGGGGTAACCTCGGCTATGGTATTTTGCGCCCTAGG
TGCCGCTTATGGAACTGCTAAGTCAGGAACTGGAATTGCATCTATGGCCG
TGATGAGACCAGAATTAATCATGAAGTCCATTATTCCAGTTGTTATGGCG
GGTATTATAGCTATTTATGGACTAGTTGTTGCTGTTCTTATTGCGCAAAA
ATTGGACTCCAGTCTTAAAATGGAAAATTCTCTGAAATATCTTGGAGCCG
GATTAAGTGTTGGTCTCAGTGGTTTGGCAGCTGGCTTTGCAATCGGTATA
GTTGGTGATGCAGGTGTTCGAGGTACTGCACAACAACCTCGTCTATTCGT
CGGAATGATTCTTATTCTAATTTTTGCTGAAGTCCTTGGATTATATGGCT
TAATTGTTGCTTTAATATTGTCCACAAAGTAAATGCAAACAACTGAAATG
TGATTAACTTAAGCATAATTCGTTAAAAGTATCGCCATTATTTGTAAAAT
GTTAGAATATATTTTGACAATTTTATGTAATTTGTTATACGTATTTGCAA
TATCTTAGTTCTGTCAAATAATTTGATGTTTGTTAATATTGACCTCGCTG
ATGTTGATTATGGTAGTTAGTGGACTGTTATTAAAGCAATGTATTTATTT
ATATTGTAATTGGATTAATTATAAAATTGACAAGAAATTATTTTTTAATG
CATGGTTTCTCAGTGATAGTTTTTAGGAAATAGGTTATTTTTTCTGAAAT
CTATAAGTCCATTAATAATTTATTTGTAATATTTAATTTAAATAGATGAA
TTTATGACTTAAACAAA
back to top

protein sequence of SMED30016201-orf-1

>SMED30016201-orf-1 ID=SMED30016201-orf-1|Name=SMED30016201-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=152bp
MSEPIYTPFFGVMGVTSAMVFCALGAAYGTAKSGTGIASMAVMRPELIMK
SIIPVVMAGIIAIYGLVVAVLIAQKLDSSLKMENSLKYLGAGLSVGLSGL
AAGFAIGIVGDAGVRGTAQQPRLFVGMILILIFAEVLGLYGLIVALILST
K*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:1902600hydrogen ion transmembrane transport
GO:0015991ATP hydrolysis coupled proton transport
GO:0006810transport
GO:0006811ion transport
GO:0015992proton transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0000099neuron
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR011555ATPase_proteolipid_su_C_euk
IPR035921F/V-ATP_Csub_sf
IPR000245ATPase_proteolipid_csu
IPR002379ATPase_proteolipid_c-like_dom
Vocabulary: cellular component
TermDefinition
GO:0033179proton-transporting V-type ATPase, V0 domain
GO:0033177proton-transporting two-sector ATPase complex, proton-transporting domain
GO:0005773vacuole
GO:0005774vacuolar membrane
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0015078hydrogen ion transmembrane transporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000245V-ATPase proteolipid subunitPRINTSPR00122VACATPASEcoord: 100..126
score: 86.45
coord: 26..50
score: 80.32
coord: 52..76
score: 68.11
coord: 127..150
score: 82.02
IPR011555V-ATPase proteolipid subunit C, eukaryoticTIGRFAMTIGR01100TIGR01100coord: 9..114
e-value: 4.3E-48
score: 160.0
IPR002379V-ATPase proteolipid subunit C-like domainPFAMPF00137ATP-synt_Ccoord: 14..72
e-value: 6.4E-14
score: 52.0
coord: 89..148
e-value: 1.7E-22
score: 79.5
NoneNo IPR availableGENE3DG3DSA:1.20.120.610coord: 7..151
e-value: 5.9E-59
score: 199.9
NoneNo IPR availablePANTHERPTHR10263V-TYPE PROTON ATPASE PROTEOLIPID SUBUNITcoord: 3..151
NoneNo IPR availablePANTHERPTHR10263:SF5V-TYPE PROTON ATPASE 16 KDA PROTEOLIPID SUBUNITcoord: 3..151
NoneNo IPR availableCDDcd18175ATP-synt_Vo_c_ATP6C_rpt1coord: 9..76
e-value: 1.25336E-30
score: 103.384
NoneNo IPR availableCDDcd18176ATP-synt_Vo_c_ATP6C_rpt2coord: 89..149
e-value: 8.61154E-29
score: 98.7317
NoneNo IPR availableTMHMMTMhelixcoord: 10..31
NoneNo IPR availableTMHMMTMhelixcoord: 88..110
NoneNo IPR availableTMHMMTMhelixcoord: 123..145
NoneNo IPR availableTMHMMTMhelixcoord: 51..73
IPR035921F/V-ATP synthase subunit C superfamilySUPERFAMILYSSF81333F1F0 ATP synthase subunit Ccoord: 9..74
IPR035921F/V-ATP synthase subunit C superfamilySUPERFAMILYSSF81333F1F0 ATP synthase subunit Ccoord: 83..150