SMED30016196

Overview
NameSMED30016196
Smed IDSMED30016196
Length (bp)822
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016196 (SMED30016196) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016196 (SMED30016196) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016196 (SMED30016196) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016196 (SMED30016196) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016196

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 25

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016196SMESG000059283.1 SmedASXL_004050SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016196SMESG000059283.1 dd_Smed_v4_62_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig25354newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig43639newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig43639uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig25563newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig25563uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 SMESG000045115.1 Contig22490uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 SMESG000045115.1 Contig22490newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig50106newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016196SMESG000059283.1 Contig50106uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 2 cellSMED30016196SMESG000059283.1 dd_Smed_v6_62_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016196SMESG000059283.1 dd_Smed_v6_62_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016196 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000130:226505..227366 -4033
Homology
BLAST of SMED30016196 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 82.0333 bits (201), Expect = 1.097e-18
Identity = 53/177 (29.94%), Postives = 84/177 (47.46%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDC---TESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C       +         C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 155          

HSP 2 Score: 80.8777 bits (198), Expect = 3.285e-18
Identity = 48/138 (34.78%), Postives = 73/138 (52.90%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP                      ++    CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTG------------GGRGRGMRSRGRDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 117          
BLAST of SMED30016196 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 82.4185 bits (202), Expect = 1.436e-18
Identity = 55/143 (38.46%), Postives = 79/143 (55.24%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-----CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R          RG Q  +      CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 134          

HSP 2 Score: 78.1814 bits (191), Expect = 4.554e-17
Identity = 54/194 (27.84%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                        +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30016196 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 82.0333 bits (201), Expect = 1.569e-18
Identity = 52/138 (37.68%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R            +     CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVS--SSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 127          

HSP 2 Score: 80.8777 bits (198), Expect = 3.774e-18
Identity = 54/187 (28.88%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK-------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                 +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 165          
BLAST of SMED30016196 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 82.0333 bits (201), Expect = 1.753e-18
Identity = 55/143 (38.46%), Postives = 78/143 (54.55%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-----CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R          RG Q  +      CY C ESGH++++C  Q         CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQED----VEACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 136          

HSP 2 Score: 78.1814 bits (191), Expect = 5.056e-17
Identity = 54/194 (27.84%), Postives = 84/194 (43.30%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                        +  S      C+ CGESGH++++C                        +    CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDL---------------------QEDVEACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 174          
BLAST of SMED30016196 vs. Ensembl Human
Match: CNBP (CCHC-type zinc finger nucleic acid binding protein [Source:HGNC Symbol;Acc:HGNC:13164])

HSP 1 Score: 81.6481 bits (200), Expect = 1.999e-18
Identity = 52/138 (37.68%), Postives = 75/138 (54.35%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R            +     CY C ESGH++++C  Q         CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVS--SSLPDICYRCGESGHLAKDCDLQED----VEACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 129          

HSP 2 Score: 80.8777 bits (198), Expect = 4.954e-18
Identity = 54/187 (28.88%), Postives = 84/187 (44.92%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK-------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                 +  S      C+ CGESGH++++C                        +    CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDCDL---------------------QEDVEACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 167          
BLAST of SMED30016196 vs. Ensembl Celegans
Match: K08D12.3 (pep chromosome:WBcel235:IV:1710265:1711127:1 gene:WBGene00019537.1 transcript:K08D12.3a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:K08D12.3)

HSP 1 Score: 62.3882 bits (150), Expect = 7.076e-12
Identity = 58/153 (37.91%), Postives = 75/153 (49.02%), Query Frame = 1
Query:  220 CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGES------GHMARDC------------NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQS--EKKCYKCNKIGHMSREC 618
            C+ C + GH+SR CP   S GG R                G+ CYNC E+GH SR+CPK  S G +  G    G        GH +RDC               G + R     KCYNC ++GH+SREC    S  EK+CY+C + GH+SR+C
Sbjct:    6 CYKCQQPGHISRNCPNGESDGGRRG------------GGGGSTCYNCQETGHFSRDCPKGGSGGGQRGGGGGGGSCYNCGGRGHYSRDCPSARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISRECTESGSAEEKRCYQCQETGHISRDC 146          

HSP 2 Score: 60.8474 bits (146), Expect = 2.393e-11
Identity = 59/165 (35.76%), Postives = 78/165 (47.27%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCT---ESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNG--------------CYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN 558
            MS R   CY C + GH+SR+C           G     C+NC E+GH SR+CP+ GS GG R GG         G +           GH SR+CP  RS G                   CY CG SGH++R+C + GS      + +CY C + GH+SR+CP+
Sbjct:    1 MSDR--NCYKCQQPGHISRNCPNGESDGGRRGGGGGSTCYNCQETGHFSRDCPKGGSGGGQRGGGGGGGSCYNCGGR-----------GHYSRDCPSARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISRECTESGS----AEEKRCYQCQETGHISRDCPS 148          

HSP 3 Score: 48.9062 bits (115), Expect = 3.615e-7
Identity = 44/119 (36.97%), Postives = 57/119 (47.90%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRS-----NGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQN----GHMSRECPNGQSE------------------KKCYKCNKIGHMSRECNE 624
            CY C + GH+SR CP   S+G R      + CY C E+GH +RDC + GS   Q           N    GH SR+CP+ +SE                  +KCY C + GH+SREC E
Sbjct:    6 CYKCQQPGHISRNCPNGESDGGRRGGGGGSTCYNCQETGHFSRDCPKGGSGGGQRGGGGGGGSCYNCGGRGHYSRDCPSARSEGGSGGYGGRGGEGRSFGGQKCYNCGRSGHISRECTE 124          
BLAST of SMED30016196 vs. Ensembl Celegans
Match: glh-4 (ATP-dependent RNA helicase glh-4 [Source:UniProtKB/Swiss-Prot;Acc:O76743])

HSP 1 Score: 52.7582 bits (125), Expect = 1.561e-7
Identity = 44/143 (30.77%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  202 GPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN----GQSEKKCYKCNKIGHMSREC 618
            G R   C NCGE GH+S+EC +                           C NC + GH + +C + R   PR   C  CG  GH A DC+Q      +  +  C NC Q GH +++C N     +  + C +C + GH   EC
Sbjct:  566 GERPRGCHNCGEEGHISKECDKPKVPRF--------------------PCRNCEQLGHFASDCDQPRV--PRGP-CRNCGIEGHFAVDCDQP-----KVPRGPCRNCGQEGHFAKDCQNERVRMEPTEPCRRCAEEGHWGYEC 680          
BLAST of SMED30016196 vs. Ensembl Celegans
Match: glh-4 (ATP-dependent RNA helicase glh-4 [Source:UniProtKB/Swiss-Prot;Acc:O76743])

HSP 1 Score: 52.7582 bits (125), Expect = 1.561e-7
Identity = 44/143 (30.77%), Postives = 61/143 (42.66%), Query Frame = 1
Query:  202 GPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN----GQSEKKCYKCNKIGHMSREC 618
            G R   C NCGE GH+S+EC +                           C NC + GH + +C + R   PR   C  CG  GH A DC+Q      +  +  C NC Q GH +++C N     +  + C +C + GH   EC
Sbjct:  566 GERPRGCHNCGEEGHISKECDKPKVPRF--------------------PCRNCEQLGHFASDCDQPRV--PRGP-CRNCGIEGHFAVDCDQP-----KVPRGPCRNCGQEGHFAKDCQNERVRMEPTEPCRRCAEEGHWGYEC 680          
BLAST of SMED30016196 vs. Ensembl Celegans
Match: glh-1 (ATP-dependent RNA helicase glh-1 [Source:UniProtKB/Swiss-Prot;Acc:P34689])

HSP 1 Score: 50.8322 bits (120), Expect = 5.622e-7
Identity = 46/127 (36.22%), Postives = 60/127 (47.24%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQN---------------XXXXXXXXXXXXXXXXXXXXNQRG-TECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDC 468
            C+NC + GH S DC E +K    PR   C+NC + GH SREC +                G        G+   G    G +RG  +C+NC   GH S ECP+     PR  GC+ CGE GH + +C
Sbjct:  160 CFNCQQPGHRSSDCPEPRKERE-PR--VCYNCQQPGHTSRECTEERKPREGRTGGFGGGAGFGNNGGNDGFGGDGGFGGGEERGPMKCFNCKGEGHRSAECPEP----PR--GCFNCGEQGHRSNEC 277          
BLAST of SMED30016196 vs. Ensembl Celegans
Match: glh-2 (ATP-dependent RNA helicase glh-2 [Source:UniProtKB/Swiss-Prot;Acc:Q966L9])

HSP 1 Score: 50.8322 bits (120), Expect = 6.486e-7
Identity = 43/142 (30.28%), Postives = 59/142 (41.55%), Query Frame = 1
Query:  202 GPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQ---VKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            G R+  CFNC + GH S +CP+       R                   CYNC + GH SR+CP++R      NG       G+                +   +KC+NC   GH S ECP  +  + C+ C + GH S EC
Sbjct:  367 GERNNNCFNCQQPGHRSNDCPEPKKEREPRV------------------CYNCQQPGHNSRDCPEERKPREGRNGFTSGFGGGNDGGFGGGNAEGFGNNEERGPMKCFNCKGEGHRSAECP--EPPRGCFNCGEQGHRSNEC 488          
BLAST of SMED30016196 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0303464)

HSP 1 Score: 77.411 bits (189), Expect = 3.846e-17
Identity = 57/190 (30.00%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  121 SRRMECYNCGKDGHMSRDCTESKKSGSGPRSGA----------------------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S    CY C + GH +RDC+     G G   G                       C+ C + GH +R CP+                           CY C+  GH+S++C   +++ P    CY+C ++GH  R+C  E  + R    V CY CN+ GH+S+ CP  ++ K CY C K GH+ REC+E
Sbjct:    2 SMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEE-----------------------AERCYRCNGIGHISKDC--TQADNP---TCYRCNKTGHWVRNC-PEAVNERGPTNVSCYKCNRTGHISKNCP--ETSKTCYGCGKSGHLRRECDE 160          

HSP 2 Score: 62.7734 bits (151), Expect = 9.198e-12
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRG---TECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDN 489
            CY C   GH+S+DCT++           C+ C ++GH  R CP+                     N+RG     CY C+ +GH+S+ CP+       S  CY CG+SGH+ R+C+++G  N
Sbjct:   77 CYRCNGIGHISKDCTQADNP-------TCYRCNKTGHWVRNCPE-------------------AVNERGPTNVSCYKCNRTGHISKNCPET------SKTCYGCGKSGHLRRECDEKGGRN 165          
BLAST of SMED30016196 vs. Ensembl Fly
Match: CNBP (gene:FBgn0034802 transcript:FBtr0071994)

HSP 1 Score: 77.411 bits (189), Expect = 3.846e-17
Identity = 57/190 (30.00%), Postives = 83/190 (43.68%), Query Frame = 1
Query:  121 SRRMECYNCGKDGHMSRDCTESKKSGSGPRSGA----------------------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S    CY C + GH +RDC+     G G   G                       C+ C + GH +R CP+                           CY C+  GH+S++C   +++ P    CY+C ++GH  R+C  E  + R    V CY CN+ GH+S+ CP  ++ K CY C K GH+ REC+E
Sbjct:    2 SMSATCYKCNRPGHFARDCSLGGGGGPGGVGGGGGGGGGGMRGNDGGGMRRNREKCYKCNQFGHFARACPEE-----------------------AERCYRCNGIGHISKDC--TQADNP---TCYRCNKTGHWVRNC-PEAVNERGPTNVSCYKCNRTGHISKNCP--ETSKTCYGCGKSGHLRRECDE 160          

HSP 2 Score: 62.7734 bits (151), Expect = 9.198e-12
Identity = 39/121 (32.23%), Postives = 59/121 (48.76%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRG---TECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDN 489
            CY C   GH+S+DCT++           C+ C ++GH  R CP+                     N+RG     CY C+ +GH+S+ CP+       S  CY CG+SGH+ R+C+++G  N
Sbjct:   77 CYRCNGIGHISKDCTQADNP-------TCYRCNKTGHWVRNCPE-------------------AVNERGPTNVSCYKCNRTGHISKNCPET------SKTCYGCGKSGHLRRECDEKGGRN 165          
BLAST of SMED30016196 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 86.2705 bits (212), Expect = 2.516e-20
Identity = 56/174 (32.18%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKSGSGP----RSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            M     EC+ CG+ GH  ++C  + +         +   C+ CGE GH++R+C Q                           CYNCH SGH+SR+C + +    R   CY CG++GH+ARDC+     N Q    KCY+C   GH+ + C     + KCY+C +IGH++ +C++
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTE-----------------------DACYNCHRSGHISRDCKEPKKE--REQCCYNCGKAGHVARDCDHA---NEQ----KCYSCGGFGHIQKLC----DKVKCYRCGEIGHVAVQCSK 138          

HSP 2 Score: 82.4185 bits (202), Expect = 5.269e-19
Identity = 52/166 (31.33%), Postives = 84/166 (50.60%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            + + CY CG+ GH++RDC +++         AC+NC  SGH+SR+C +                      +R   CYNC ++GH++R+C     +      CY CG  GH+ + C+          +VKCY C + GH++ +C    +E  CY C K GH++R+C+
Sbjct:   36 KDLFCYRCGEQGHIARDCEQTED--------ACYNCHRSGHISRDCKE-------------------PKKEREQCCYNCGKAGHVARDC-----DHANEQKCYSCGGFGHIQKLCD----------KVKCYRCGEIGHVAVQCSKA-TEVNCYNCGKTGHLARDCS 158          
BLAST of SMED30016196 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 86.2705 bits (212), Expect = 2.516e-20
Identity = 56/174 (32.18%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKSGSGP----RSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            M     EC+ CG+ GH  ++C  + +         +   C+ CGE GH++R+C Q                           CYNCH SGH+SR+C + +    R   CY CG++GH+ARDC+     N Q    KCY+C   GH+ + C     + KCY+C +IGH++ +C++
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTE-----------------------DACYNCHRSGHISRDCKEPKKE--REQCCYNCGKAGHVARDCDHA---NEQ----KCYSCGGFGHIQKLC----DKVKCYRCGEIGHVAVQCSK 138          

HSP 2 Score: 82.4185 bits (202), Expect = 5.269e-19
Identity = 52/166 (31.33%), Postives = 84/166 (50.60%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            + + CY CG+ GH++RDC +++         AC+NC  SGH+SR+C +                      +R   CYNC ++GH++R+C     +      CY CG  GH+ + C+          +VKCY C + GH++ +C    +E  CY C K GH++R+C+
Sbjct:   36 KDLFCYRCGEQGHIARDCEQTED--------ACYNCHRSGHISRDCKE-------------------PKKEREQCCYNCGKAGHVARDC-----DHANEQKCYSCGGFGHIQKLCD----------KVKCYRCGEIGHVAVQCSKA-TEVNCYNCGKTGHLARDCS 158          
BLAST of SMED30016196 vs. Ensembl Zebrafish
Match: cnbpa (CCHC-type zinc finger, nucleic acid binding protein a [Source:ZFIN;Acc:ZDB-GENE-030131-5045])

HSP 1 Score: 86.2705 bits (212), Expect = 2.516e-20
Identity = 56/174 (32.18%), Postives = 86/174 (49.43%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKSGSGP----RSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            M     EC+ CG+ GH  ++C  + +         +   C+ CGE GH++R+C Q                           CYNCH SGH+SR+C + +    R   CY CG++GH+ARDC+     N Q    KCY+C   GH+ + C     + KCY+C +IGH++ +C++
Sbjct:    1 MDMSTSECFGCGRSGHWIKNCPNAGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTE-----------------------DACYNCHRSGHISRDCKEPKKE--REQCCYNCGKAGHVARDCDHA---NEQ----KCYSCGGFGHIQKLC----DKVKCYRCGEIGHVAVQCSK 138          

HSP 2 Score: 82.4185 bits (202), Expect = 5.269e-19
Identity = 52/166 (31.33%), Postives = 84/166 (50.60%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            + + CY CG+ GH++RDC +++         AC+NC  SGH+SR+C +                      +R   CYNC ++GH++R+C     +      CY CG  GH+ + C+          +VKCY C + GH++ +C    +E  CY C K GH++R+C+
Sbjct:   36 KDLFCYRCGEQGHIARDCEQTED--------ACYNCHRSGHISRDCKE-------------------PKKEREQCCYNCGKAGHVARDC-----DHANEQKCYSCGGFGHIQKLCD----------KVKCYRCGEIGHVAVQCSKA-TEVNCYNCGKTGHLARDCS 158          
BLAST of SMED30016196 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 82.0333 bits (201), Expect = 8.974e-19
Identity = 56/178 (31.46%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGA----CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE-----------GSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH  ++C  + +     R       C+ CGE GH++R+C +                           CYNC   GH+SR+C + +    R   CY CG++GHMARDC+             G   +   +VKCY C + GH++ +C    SE  CY C K GH+++EC 
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE-----------------------DACYNCGRGGHISRDCKEPKKE--REQVCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGCEKVKCYRCGEIGHVAVQCSKA-SEVNCYNCGKSGHVAKECT 156          

HSP 2 Score: 73.559 bits (179), Expect = 1.141e-15
Identity = 48/136 (35.29%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            S  CF CG +GH  + CP              R     RG  +   CY C E GH++R+C +        + CY CG  GH++RDC +     ++ER+  CYNC + GHM+R+C +  +E+KCY C   GH+ + C
Sbjct:    3 SNECFGCGRTGHWIKNCPN-----------AGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE------DACYNCGRGGHISRDCKEP----KKEREQVCYNCGKAGHMARDCDHA-NEQKCYSCGGFGHIQKGC 116          

HSP 3 Score: 56.6102 bits (135), Expect = 1.587e-9
Identity = 37/120 (30.83%), Postives = 54/120 (45.00%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            R   CYNCGK GHM+RDC  + +         C++CG  GH+ + C +                          +CY C E GH++ +C K          CY CG+SGH+A++C  E +
Sbjct:   78 REQVCYNCGKAGHMARDCDHANEQ-------KCYSCGGFGHIQKGCEK-------------------------VKCYRCGEIGHVAVQCSK-----ASEVNCYNCGKSGHVAKECTIEAT 160          
BLAST of SMED30016196 vs. Ensembl Zebrafish
Match: cnbpb (CCHC-type zinc finger, nucleic acid binding protein b [Source:ZFIN;Acc:ZDB-GENE-030131-7782])

HSP 1 Score: 82.0333 bits (201), Expect = 8.974e-19
Identity = 56/178 (31.46%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGA----CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE-----------GSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH  ++C  + +     R       C+ CGE GH++R+C +                           CYNC   GH+SR+C + +    R   CY CG++GHMARDC+             G   +   +VKCY C + GH++ +C    SE  CY C K GH+++EC 
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE-----------------------DACYNCGRGGHISRDCKEPKKE--REQVCYNCGKAGHMARDCDHANEQKCYSCGGFGHIQKGCEKVKCYRCGEIGHVAVQCSKA-SEVNCYNCGKSGHVAKECT 156          

HSP 2 Score: 73.559 bits (179), Expect = 1.141e-15
Identity = 48/136 (35.29%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            S  CF CG +GH  + CP              R     RG  +   CY C E GH++R+C +        + CY CG  GH++RDC +     ++ER+  CYNC + GHM+R+C +  +E+KCY C   GH+ + C
Sbjct:    3 SNECFGCGRTGHWIKNCPN-----------AGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE------DACYNCGRGGHISRDCKEP----KKEREQVCYNCGKAGHMARDCDHA-NEQKCYSCGGFGHIQKGC 116          

HSP 3 Score: 56.6102 bits (135), Expect = 1.587e-9
Identity = 37/120 (30.83%), Postives = 54/120 (45.00%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            R   CYNCGK GHM+RDC  + +         C++CG  GH+ + C +                          +CY C E GH++ +C K          CY CG+SGH+A++C  E +
Sbjct:   78 REQVCYNCGKAGHMARDCDHANEQ-------KCYSCGGFGHIQKGCEK-------------------------VKCYRCGEIGHVAVQCSK-----ASEVNCYNCGKSGHVAKECTIEAT 160          
BLAST of SMED30016196 vs. Ensembl Xenopus
Match: rfc4 (Xenopus tropicalis terminal uridylyl transferase 7 (tut7), mRNA. [Source:RefSeq mRNA;Acc:NM_001310103])

HSP 1 Score: 50.8322 bits (120), Expect = 1.421e-6
Identity = 35/141 (24.82%), Postives = 55/141 (39.01%), Query Frame = 1
Query:  202 GPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEG-----------SDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKC 588
             P    C  CG+ GH  ++CP        +      +      NQR TE   +       SR   KQ SN P+     K  +    A + N+E            S++R+ R+ +C+ C +  H+ +ECP  +     Y C
Sbjct: 1125 APNDRCCRICGKIGHFMKDCPMRRKVRRRKNENAGNQRYPETRNQRMTEEAASKGAENETSRLDGKQTSNTPK-----KPKQGARGANEANREKPQRLPTEKWRRSEDREPREKRCFLCGKEDHIKKECPQYKGAVGKYNC 1260          
BLAST of SMED30016196 vs. Ensembl Mouse
Match: Zcchc13 (zinc finger, CCHC domain containing 13 [Source:MGI Symbol;Acc:MGI:1922314])

HSP 1 Score: 83.1889 bits (204), Expect = 3.636e-19
Identity = 57/192 (29.69%), Postives = 89/192 (46.35%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESK-------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE-----------GSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            MSS+   C+ CG  GH +R+C +               +  +  +S  C+ CGE+GH +++C                       +     CYNC   GH++++C + +    R   CY C + GH+ARDCN++           G   +   Q+KCY C +NGHM+  C    SE  CY+C + GH++REC
Sbjct:    1 MSSK--SCFKCGHSGHWARECPKGGTRGRTARGRTRGPQCSTANQSDVCYRCGETGHYAKDC-----------------------DLLQDTCYNCGRRGHIAKDCTQAKRE--REQCCYICSQPGHLARDCNRQEEQKCYTCGEFGHIQKDCTQIKCYRCGENGHMAVNCSK-TSEVSCYRCGESGHLAREC 164          

HSP 2 Score: 82.8037 bits (203), Expect = 5.064e-19
Identity = 56/138 (40.58%), Postives = 81/138 (58.70%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S +CF CG SGH +RECP+ G+RG   RG           NQ    CY C E+GH +++C   +      + CY CG  GH+A+DC Q     ++ER+  CY C+Q GH++R+C N Q E+KCY C + GH+ ++C +
Sbjct:    3 SKSCFKCGHSGHWARECPKGGTRGRTARGRTRGPQCSTA-NQSDV-CYRCGETGHYAKDCDLLQ------DTCYNCGRRGHIAKDCTQA----KREREQCCYICSQPGHLARDC-NRQEEQKCYTCGEFGHIQKDCTQ 127          

HSP 3 Score: 79.337 bits (194), Expect = 9.590e-18
Identity = 46/140 (32.86%), Postives = 74/140 (52.86%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECP 555
            CYNCG+ GH+++DCT++K+     R   C+ C + GH++R+C                        Q   +CY C E GH+ ++C + +        CY+CGE+GHMA +C++         +V CY C ++GH++RECP
Sbjct:   67 CYNCGRRGHIAKDCTQAKRE----REQCCYICSQPGHLARDC----------------------NRQEEQKCYTCGEFGHIQKDCTQIK--------CYRCGENGHMAVNCSKTS-------EVSCYRCGESGHLARECP 165          

HSP 4 Score: 58.9214 bits (141), Expect = 3.085e-10
Identity = 42/139 (30.22%), Postives = 61/139 (43.88%), Query Frame = 1
Query:   67 FVCIRIGIHIFD*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            + C R G    D ++    R   CY C + GH++RDC   ++         C+ CGE GH+ ++C Q                          +CY C E+GHM+  C K          CY+CGESGH+AR+C  E +
Sbjct:   68 YNCGRRGHIAKDCTQAKREREQCCYICSQPGHLARDCNRQEEQ-------KCYTCGEFGHIQKDCTQ-------------------------IKCYRCGENGHMAVNCSK-----TSEVSCYRCGESGHLARECPIEAT 169          
BLAST of SMED30016196 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 82.8037 bits (203), Expect = 5.236e-19
Identity = 52/138 (37.68%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R            +     CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFQFVSSSLPDI-CYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 128          

HSP 2 Score: 80.4925 bits (197), Expect = 3.687e-18
Identity = 54/188 (28.72%), Postives = 85/188 (45.21%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                  +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 166          
BLAST of SMED30016196 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 82.4185 bits (202), Expect = 9.856e-19
Identity = 55/143 (38.46%), Postives = 79/143 (55.24%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-----CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R          RG Q  +      CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 134          

HSP 2 Score: 78.1814 bits (191), Expect = 3.127e-17
Identity = 54/194 (27.84%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                        +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30016196 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 82.4185 bits (202), Expect = 9.856e-19
Identity = 55/143 (38.46%), Postives = 79/143 (55.24%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-----CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R          RG Q  +      CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 134          

HSP 2 Score: 78.1814 bits (191), Expect = 3.127e-17
Identity = 54/194 (27.84%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                        +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30016196 vs. Ensembl Mouse
Match: Cnbp (cellular nucleic acid binding protein [Source:MGI Symbol;Acc:MGI:88431])

HSP 1 Score: 82.0333 bits (201), Expect = 1.077e-18
Identity = 52/138 (37.68%), Postives = 76/138 (55.07%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R            +     CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVS--SSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 127          

HSP 2 Score: 80.8777 bits (198), Expect = 2.591e-18
Identity = 54/187 (28.88%), Postives = 85/187 (45.45%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK-------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                 +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 165          
BLAST of SMED30016196 vs. UniProt/SwissProt
Match: sp|Q04832|HEXP_LEIMA (DNA-binding protein HEXBP OS=Leishmania major OX=5664 GN=HEXBP PE=4 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.863e-32
Identity = 75/181 (41.44%), Postives = 104/181 (57.46%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 624
            +R  ++  M C+ CG+ GHMSRDC  S K G+  +   C+ CG+ GH+SR+CP +        G    R   + G      CY C ++GH+SR+CP  +   +G     CYKCG++GH++RDC   Q G     +R  KCY C ++GHMSRECP     G  ++ CYKC K GH+SREC E
Sbjct:   62 ARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGA-AKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR--KCYKCGESGHMSRECPSAGSTGSGDRACYKCGKPGHISRECPE 239          

HSP 2 Score: 115.931 bits (289), Expect = 1.184e-29
Identity = 77/196 (39.29%), Postives = 102/196 (52.04%), Query Frame = 1
Query:  112 KMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGA--CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNG-----------------CYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------SEKKCYKCNKIGHMSREC 618
            K   R   C+ CG++GHMSR+C    +SG+   +GA  CF CGE+GHMSR+CP +   G                  +G ECY C + GH+SR+CP  +       G                 CYKCG++GH++RDC   Q G     +R   CY C   GH+SR+CPNGQ       ++KCYKC + GHMSREC
Sbjct:   37 KGDERSTTCFRCGEEGHMSRECPNEARSGA---AGAMTCFRCGEAGHMSRDCPNSAKPGA----------------AKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT--CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSREC 211          

HSP 3 Score: 109.768 bits (273), Expect = 2.467e-27
Identity = 70/197 (35.53%), Postives = 100/197 (50.76%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGP------RSGA---------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQS---------EKKCYKCNKIGHMSREC 618
            ++  +++  ECY CG++GH+SRDC  S+    G       RSGA         C+ CG++GH+SR+CP                            CY C ++GH+SR+CP  +   +G     CYKCGESGHM+R+C   GS    +R   CY C + GH+SRECP             ++ CYKC + GH+SR+C
Sbjct:   89 AKPGAAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT---------------CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSTGSGDRA--CYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDC 268          

HSP 4 Score: 95.1301 bits (235), Expect = 7.752e-22
Identity = 56/144 (38.89%), Postives = 73/144 (50.69%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV---KCYNCNQNGHMSRECPN 558
            CY CG  GH+SRDC   +   SG     C+ CG++GH+SR+CP                           +CY C ESGHMSRECP   S G     CYKCG+ GH++R+C + G      R      CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR---------------KCYKCGESGHMSRECPSAGSTGSGDRACYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPS 270          

HSP 5 Score: 92.4337 bits (228), Expect = 8.177e-21
Identity = 58/158 (36.71%), Postives = 81/158 (51.27%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQ-RSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ---------------------SEKKCYKCNKIGHMSREC 618
            S +C NCG+ GH +RECP+                 D +G++R T C+ C E GHMSRECP + RS    +  C++CGE+GHM+RDC          +  +CY C Q GH+SR+CP+ Q                      ++ CYKC   GH+SR+C
Sbjct:   15 STSCRNCGKEGHYARECPE----------------ADSKGDERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPG-AAKGFECYKCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYSGDRTCYKCGDAGHISRDC 155          

HSP 6 Score: 61.6178 bits (148), Expect = 8.044e-10
Identity = 41/87 (47.13%), Postives = 54/87 (62.07%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECP 393
            +CY CG+ GHMSR+C  +  +GSG R  AC+ CG+ GH+SRECP+ G   G  RGG +R             CY C E+GH+SR+CP
Sbjct:  197 KCYKCGESGHMSRECPSAGSTGSGDR--ACYKCGKPGHISRECPEAGGSYGGSRGGGDRT------------CYKCGEAGHISRDCP 269          

HSP 7 Score: 58.5362 bits (140), Expect = 9.482e-9
Identity = 33/84 (39.29%), Postives = 43/84 (51.19%), Query Frame = 1
Query:  418 SNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN-----GQSEKKCYKCNKIGHMSRECNE*SYLGDKAFF 654
            S  C  CG+ GH AR+C +  S    ER   C+ C + GHMSRECPN           C++C + GHMSR+C   +  G    F
Sbjct:   15 STSCRNCGKEGHYARECPEADSKG-DERSTTCFRCGEEGHMSRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGF 97          
BLAST of SMED30016196 vs. UniProt/SwissProt
Match: sp|P53849|GIS2_YEAST (Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1)

HSP 1 Score: 100.908 bits (250), Expect = 3.481e-25
Identity = 69/188 (36.70%), Postives = 98/188 (52.13%), Query Frame = 1
Query:   58 KILFVCIRIGIHIFD*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSN-GCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            K  +VC +IG H+   +    S R+ CYNC K GH+  DCT  +          C+NCGE+GH+  EC                             C+NC+++GH+SRECP+ +     S   CYKCG   HMA+DC +E   +     +KCY C Q GHMSR+C   Q+++ CY CN+ GH+S++C
Sbjct:    4 KACYVCGKIG-HL---AEDCDSERL-CYNCNKPGHVQTDCTMPRTV----EFKQCYNCGETGHVRSECTVQ-------------------------RCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGIS----GLKCYTCGQAGHMSRDC---QNDRLCYNCNETGHISKDC 150          

HSP 2 Score: 79.7221 bits (195), Expect = 3.643e-17
Identity = 48/143 (33.57%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG 561
            +CYNCG+ GH+  +CT  +          CFNC ++GH+SRECP+        +                  CY C    HM+++C K+  +G     CY CG++GHM+RDC  +           CYNCN+ GH+S++CP  
Sbjct:   48 QCYNCGETGHVRSECTVQR----------CFNCNQTGHISRECPEPKKTSRFSK----------------VSCYKCGGPNHMAKDCMKE--DGISGLKCYTCGQAGHMSRDCQNDRL---------CYNCNETGHISKDCPKA 153          

HSP 3 Score: 58.151 bits (139), Expect = 3.140e-9
Identity = 33/92 (35.87%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            CY C + GH++ +C  +R        CY C + GH+  DC       R     +CYNC + GH+  EC    + ++C+ CN+ GH+SREC E
Sbjct:    6 CYVCGKIGHLAEDCDSERL-------CYNCNKPGHVQTDCTMP----RTVEFKQCYNCGETGHVRSEC----TVQRCFNCNQTGHISRECPE 82          
BLAST of SMED30016196 vs. UniProt/SwissProt
Match: sp|O65639|CSP1_ARATH (Cold shock protein 1 OS=Arabidopsis thaliana OX=3702 GN=CSP1 PE=1 SV=1)

HSP 1 Score: 99.7525 bits (247), Expect = 2.676e-23
Identity = 68/186 (36.56%), Postives = 94/186 (50.54%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGA-------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE------CYNCHESGHMSRECPKQ------RSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECP-----NGQSEKKCYKCNKIGHMSRECN 621
            CYNCG  GH +RDCT +   G+G + GA       C+ CG+ GH++R+C Q     G               +QRG        CY C + GH +R+C ++      RS G  S  CY CG  GH+ARDC  +    RQ  +  CY C  +GH++R+C       G ++  CYKC K GH +REC+
Sbjct:  134 CYNCGDTGHFARDCTSA---GNGDQRGATKGGNDGCYTCGDVGHVARDCTQKSVGNG---------------DQRGAVKGGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSGTCYSCGGVGHIARDCATK----RQPSR-GCYQCGGSGHLARDCDQRGSGGGGNDNACYKCGKEGHFARECS 296          

HSP 2 Score: 90.1225 bits (222), Expect = 7.513e-20
Identity = 59/148 (39.86%), Postives = 80/148 (54.05%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGA-------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN 558
            CY CG  GH++RDCT+ K  G+G + GA       C+ CG+ GH +R+C Q  + G  R GG                CY+C   GH++R+C  +R     S GCY+CG SGH+ARDC+Q GS         CY C + GH +REC +
Sbjct:  166 CYTCGDVGHVARDCTQ-KSVGNGDQRGAVKGGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSG-----------TCYSCGGVGHIARDCATKR---QPSRGCYQCGGSGHLARDCDQRGSGGGGNDNA-CYKCGKEGHFARECSS 297          

HSP 3 Score: 89.3521 bits (220), Expect = 1.508e-19
Identity = 59/186 (31.72%), Postives = 89/186 (47.85%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDC----TESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE------CYNCHESGHMSRECP-KQRSNGPR-------SNGCYKCGESGHMARDCNQEGSDNRQER----QVKCYNCNQNGHMSRECPNG-QSEKKCYKCNKIGHMSRECNE 624
            CYNCG+ GH+S+DC                  C+NCG++GH +R+C                      G+QRG        CY C + GH++R+C  K   NG +       ++GCY CG+ GH ARDC Q+ +             CY+C   GH++R+C    Q  + CY+C   GH++R+C++
Sbjct:  102 CYNCGELGHISKDCGIGGGGGGGERRSRGGEGCYNCGDTGHFARDCTS-----------------AGNGDQRGATKGGNDGCYTCGDVGHVARDCTQKSVGNGDQRGAVKGGNDGCYTCGDVGHFARDCTQKVAAGNVRSGGGGSGTCYSCGGVGHIARDCATKRQPSRGCYQCGGSGHLARDCDQ 270          
BLAST of SMED30016196 vs. UniProt/SwissProt
Match: sp|P36627|BYR3_SCHPO (Cellular nucleic acid-binding protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=byr3 PE=4 SV=1)

HSP 1 Score: 89.7373 bits (221), Expect = 1.049e-20
Identity = 59/172 (34.30%), Postives = 84/172 (48.84%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNG----------CYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            CYNC + GH + +CTE ++  +      C+ CG +GH+ R+CP + +                   ++G ECY C   GH++R+C   R+NG +S G          CY CG  GH ARDC            VKCY+C + GH S EC      + CYKCN+ GH++  C 
Sbjct:   38 CYNCNQTGHKASECTEPQQEKT------CYACGTAGHLVRDCPSSPNP------------------RQGAECYKCGRVGHIARDC---RTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTMG---------VKCYSCGKIGHRSFECQQASDGQLCYKCNQPGHIAVNCT 173          

HSP 2 Score: 87.4261 bits (215), Expect = 8.760e-20
Identity = 60/169 (35.50%), Postives = 80/169 (47.34%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNG-CYKCGESGHMARDCNQEGSDNR-----QERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            CYNCG++GH +R+CT         +   C+NC ++GH + EC +                      Q+   CY C  +GH+ R+CP   S  PR    CYKCG  GH+ARDC   G  +          + CY C   GH +R+C  G    KCY C KIGH S EC +
Sbjct:   19 CYNCGENGHQARECT---------KGSICYNCNQTGHKASECTEP---------------------QQEKTCYACGTAGHLVRDCPS--SPNPRQGAECYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDCTMG---VKCYSCGKIGHRSFECQQ 152          

HSP 3 Score: 65.4698 bits (158), Expect = 9.673e-12
Identity = 38/96 (39.58%), Postives = 57/96 (59.38%), Query Frame = 1
Query:  340 GTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSREC---PNGQSEKKCYKCNKIGHMSREC 618
            G  CYNC E+GH +REC K        + CY C ++GH A +C    ++ +QE+   CY C   GH+ R+C   PN +   +CYKC ++GH++R+C
Sbjct:   16 GPRCYNCGENGHQARECTK-------GSICYNCNQTGHKASEC----TEPQQEK--TCYACGTAGHLVRDCPSSPNPRQGAECYKCGRVGHIARDC 98          

HSP 4 Score: 61.6178 bits (148), Expect = 2.813e-10
Identity = 36/76 (47.37%), Postives = 43/76 (56.58%), Query Frame = 1
Query:  391 PKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            P+    GPR   CY CGE+GH AR+C + GS         CYNCNQ GH + EC   Q EK CY C   GH+ R+C
Sbjct:   10 PQTTRPGPR---CYNCGENGHQARECTK-GSI--------CYNCNQTGHKASECTEPQQEKTCYACGTAGHLVRDC 73          

HSP 5 Score: 55.4546 bits (132), Expect = 4.355e-8
Identity = 48/144 (33.33%), Postives = 68/144 (47.22%), Query Frame = 1
Query:   58 KILFVCIRIGIHIFD*SRKMSSRR-MECYNCGKDGHMSRDC-TESKKSG---SGPRSGA-CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN 471
            K  + C   G  + D     + R+  ECY CG+ GH++RDC T  ++SG    G RS   C+ CG  GH +R+C                          G +CY+C + GH S EC +Q S+G     CYKC + GH+A +C 
Sbjct:   58 KTCYACGTAGHLVRDCPSSPNPRQGAECYKCGRVGHIARDCRTNGQQSGGRFGGHRSNMNCYACGSYGHQARDC------------------------TMGVKCYSCGKIGHRSFEC-QQASDGQL---CYKCNQPGHIAVNCT 173          
BLAST of SMED30016196 vs. UniProt/SwissProt
Match: sp|P62634|CNBP_RAT (Cellular nucleic acid-binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 6.895e-18
Identity = 55/143 (38.46%), Postives = 79/143 (55.24%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTE-----CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH +RECP  G RG   R          RG Q  +      CY C ESGH++++C  Q       + CY CG  GH+A+DC +     ++ER+  CYNC + GH++R+C +   E+KCY C + GH+ ++C +
Sbjct:    3 SNECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDCDLQE------DACYNCGRGGHIAKDCKEP----KREREQCCYNCGKPGHLARDCDHAD-EQKCYSCGEFGHIQKDCTK 134          

HSP 2 Score: 78.1814 bits (191), Expect = 2.187e-16
Identity = 54/194 (27.84%), Postives = 85/194 (43.81%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESK--------------------KSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCN-----------QEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH +R+C                        +  S      C+ CGESGH++++C                       + +   CYNC   GH++++C + +    R   CY CG+ GH+ARDC+           + G   +   +VKCY C + GH++  C    SE  CY+C + GH++REC 
Sbjct:    5 ECFKCGRSGHWARECPTGGGRGRGMRSRGRGGFTSDRGFQFVSSSLPDICYRCGESGHLAKDC-----------------------DLQEDACYNCGRGGHIAKDCKEPKRE--REQCCYNCGKPGHLARDCDHADEQKCYSCGEFGHIQKDCTKVKCYRCGETGHVAINCSK-TSEVNCYRCGESGHLARECT 172          
BLAST of SMED30016196 vs. TrEMBL
Match: A0A5K1VCT4 (Universal minicircle sequence binding protein - putative OS=Leishmania infantum OX=5671 GN=LINF_360022800 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.887e-31
Identity = 77/181 (42.54%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 624
            +R  ++  M C+ CG+ GHMSRDC  S K G+  +   C+NCG+ GH+SR+CP +        G    R   + G      CY C ++GH+SR+CP  +   +G     CYKCG++GH++RDC   Q G     +R  KCY C ++GHMSRECP    NG  ++ CYKC K GH+SREC E
Sbjct:   62 ARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGA-AKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR--KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPE 239          

HSP 2 Score: 115.931 bits (289), Expect = 4.327e-27
Identity = 82/209 (39.23%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  100 D*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXX-----------XXXXXXXXXXNQRGTECYNCHESGHMSRECP-------------KQRSNGPRSNG----CYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------SEKKCYKCNKIGHMSREC 618
            D  R  +     C NCGK+GH +R+C E+   G G RS  CF CGE GHM+RECP     G                  +     + G  +G ECYNC + GH+SR+CP             + RS      G    CYKCG++GH++RDC   Q G     +R   CY C   GH+SR+CPNGQ       ++KCYKC + GHMSREC
Sbjct:    6 DVKRPRTESSTSCRNCGKEGHYARECPEADSKGDG-RSTTCFRCGEEGHMTRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT--CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSREC 211          

HSP 3 Score: 112.464 bits (280), Expect = 8.760e-26
Identity = 71/197 (36.04%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSG------PRSGA---------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG---------QSEKKCYKCNKIGHMSREC 618
            ++  +++  ECYNCG++GH+SRDC  S+    G       RSGA         C+ CG++GH+SR+CP                            CY C ++GH+SR+CP  +   +G     CYKCGESGHM+R+C   GS+   +R   CY C + GH+SRECP             ++ CYKC + GH+SR+C
Sbjct:   89 AKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT---------------CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSNGSGDRT--CYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDC 268          

HSP 4 Score: 95.9005 bits (237), Expect = 1.191e-19
Identity = 57/144 (39.58%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV---KCYNCNQNGHMSRECPN 558
            CY CG  GH+SRDC   +   SG     C+ CG++GH+SR+CP                           +CY C ESGHMSRECP   SNG     CYKCG+ GH++R+C + G      R      CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR---------------KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPS 270          
BLAST of SMED30016196 vs. TrEMBL
Match: A4IDD5 (Putative universal minicircle sequence binding protein (UMSBP) OS=Leishmania infantum OX=5671 GN=HEXBP PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.887e-31
Identity = 77/181 (42.54%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 624
            +R  ++  M C+ CG+ GHMSRDC  S K G+  +   C+NCG+ GH+SR+CP +        G    R   + G      CY C ++GH+SR+CP  +   +G     CYKCG++GH++RDC   Q G     +R  KCY C ++GHMSRECP    NG  ++ CYKC K GH+SREC E
Sbjct:   62 ARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGA-AKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR--KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPE 239          

HSP 2 Score: 115.931 bits (289), Expect = 4.327e-27
Identity = 82/209 (39.23%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  100 D*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXX-----------XXXXXXXXXXNQRGTECYNCHESGHMSRECP-------------KQRSNGPRSNG----CYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------SEKKCYKCNKIGHMSREC 618
            D  R  +     C NCGK+GH +R+C E+   G G RS  CF CGE GHM+RECP     G                  +     + G  +G ECYNC + GH+SR+CP             + RS      G    CYKCG++GH++RDC   Q G     +R   CY C   GH+SR+CPNGQ       ++KCYKC + GHMSREC
Sbjct:    6 DVKRPRTESSTSCRNCGKEGHYARECPEADSKGDG-RSTTCFRCGEEGHMTRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT--CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSREC 211          

HSP 3 Score: 112.464 bits (280), Expect = 8.760e-26
Identity = 71/197 (36.04%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSG------PRSGA---------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG---------QSEKKCYKCNKIGHMSREC 618
            ++  +++  ECYNCG++GH+SRDC  S+    G       RSGA         C+ CG++GH+SR+CP                            CY C ++GH+SR+CP  +   +G     CYKCGESGHM+R+C   GS+   +R   CY C + GH+SRECP             ++ CYKC + GH+SR+C
Sbjct:   89 AKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT---------------CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSNGSGDRT--CYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDC 268          

HSP 4 Score: 95.9005 bits (237), Expect = 1.191e-19
Identity = 57/144 (39.58%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV---KCYNCNQNGHMSRECPN 558
            CY CG  GH+SRDC   +   SG     C+ CG++GH+SR+CP                           +CY C ESGHMSRECP   SNG     CYKCG+ GH++R+C + G      R      CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR---------------KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPS 270          
BLAST of SMED30016196 vs. TrEMBL
Match: E9BTN1 (Universal minicircle sequence binding protein (UMSBP), putative OS=Leishmania donovani (strain BPK282A1) OX=981087 GN=LDBPK_361720 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.887e-31
Identity = 77/181 (42.54%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 624
            +R  ++  M C+ CG+ GHMSRDC  S K G+  +   C+NCG+ GH+SR+CP +        G    R   + G      CY C ++GH+SR+CP  +   +G     CYKCG++GH++RDC   Q G     +R  KCY C ++GHMSRECP    NG  ++ CYKC K GH+SREC E
Sbjct:   62 ARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGA-AKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR--KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPE 239          

HSP 2 Score: 115.931 bits (289), Expect = 4.327e-27
Identity = 82/209 (39.23%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  100 D*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXX-----------XXXXXXXXXXNQRGTECYNCHESGHMSRECP-------------KQRSNGPRSNG----CYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------SEKKCYKCNKIGHMSREC 618
            D  R  +     C NCGK+GH +R+C E+   G G RS  CF CGE GHM+RECP     G                  +     + G  +G ECYNC + GH+SR+CP             + RS      G    CYKCG++GH++RDC   Q G     +R   CY C   GH+SR+CPNGQ       ++KCYKC + GHMSREC
Sbjct:    6 DVKRPRTESSTSCRNCGKEGHYARECPEADSKGDG-RSTTCFRCGEEGHMTRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT--CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSREC 211          

HSP 3 Score: 112.464 bits (280), Expect = 8.760e-26
Identity = 71/197 (36.04%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSG------PRSGA---------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG---------QSEKKCYKCNKIGHMSREC 618
            ++  +++  ECYNCG++GH+SRDC  S+    G       RSGA         C+ CG++GH+SR+CP                            CY C ++GH+SR+CP  +   +G     CYKCGESGHM+R+C   GS+   +R   CY C + GH+SRECP             ++ CYKC + GH+SR+C
Sbjct:   89 AKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT---------------CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSNGSGDRT--CYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDC 268          

HSP 4 Score: 95.9005 bits (237), Expect = 1.191e-19
Identity = 57/144 (39.58%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV---KCYNCNQNGHMSRECPN 558
            CY CG  GH+SRDC   +   SG     C+ CG++GH+SR+CP                           +CY C ESGHMSRECP   SNG     CYKCG+ GH++R+C + G      R      CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR---------------KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPS 270          
BLAST of SMED30016196 vs. TrEMBL
Match: A0A3Q8IQS7 (Universal minicircle sequence binding protein, putative OS=Leishmania donovani OX=5661 GN=CGC21_13175 PE=4 SV=1)

HSP 1 Score: 125.946 bits (315), Expect = 5.887e-31
Identity = 77/181 (42.54%), Postives = 106/181 (58.56%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 624
            +R  ++  M C+ CG+ GHMSRDC  S K G+  +   C+NCG+ GH+SR+CP +        G    R   + G      CY C ++GH+SR+CP  +   +G     CYKCG++GH++RDC   Q G     +R  KCY C ++GHMSRECP    NG  ++ CYKC K GH+SREC E
Sbjct:   62 ARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGA-AKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR--KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPE 239          

HSP 2 Score: 115.931 bits (289), Expect = 4.327e-27
Identity = 82/209 (39.23%), Postives = 105/209 (50.24%), Query Frame = 1
Query:  100 D*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXX-----------XXXXXXXXXXNQRGTECYNCHESGHMSRECP-------------KQRSNGPRSNG----CYKCGESGHMARDC--NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------SEKKCYKCNKIGHMSREC 618
            D  R  +     C NCGK+GH +R+C E+   G G RS  CF CGE GHM+RECP     G                  +     + G  +G ECYNC + GH+SR+CP             + RS      G    CYKCG++GH++RDC   Q G     +R   CY C   GH+SR+CPNGQ       ++KCYKC + GHMSREC
Sbjct:    6 DVKRPRTESSTSCRNCGKEGHYARECPEADSKGDG-RSTTCFRCGEEGHMTRECPNEARSGAAGAMTCFRCGEAGHMSRDCPNSAKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT--CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSREC 211          

HSP 3 Score: 112.464 bits (280), Expect = 8.760e-26
Identity = 71/197 (36.04%), Postives = 102/197 (51.78%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSG------PRSGA---------CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRS--NGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG---------QSEKKCYKCNKIGHMSREC 618
            ++  +++  ECYNCG++GH+SRDC  S+    G       RSGA         C+ CG++GH+SR+CP                            CY C ++GH+SR+CP  +   +G     CYKCGESGHM+R+C   GS+   +R   CY C + GH+SRECP             ++ CYKC + GH+SR+C
Sbjct:   89 AKPGAAKGFECYNCGQEGHLSRDCPSSQGGSRGGYGQKRGRSGAQGGYGGDRTCYKCGDAGHISRDCPNGQGGYSGAGDRT---------------CYKCGDAGHISRDCPNGQGGYSGAGDRKCYKCGESGHMSRECPSAGSNGSGDRT--CYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDC 268          

HSP 4 Score: 95.9005 bits (237), Expect = 1.191e-19
Identity = 57/144 (39.58%), Postives = 74/144 (51.39%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV---KCYNCNQNGHMSRECPN 558
            CY CG  GH+SRDC   +   SG     C+ CG++GH+SR+CP                           +CY C ESGHMSRECP   SNG     CYKCG+ GH++R+C + G      R      CY C + GH+SR+CP+
Sbjct:  142 CYKCGDAGHISRDCPNGQGGYSGAGDRTCYKCGDAGHISRDCPNGQGGYSGAGDR---------------KCYKCGESGHMSRECPSAGSNGSGDRTCYKCGKPGHISRECPEAGGSYGGSRGGGDRTCYKCGEAGHISRDCPS 270          
BLAST of SMED30016196 vs. TrEMBL
Match: W6KZI3 (Uncharacterized protein OS=Phytomonas sp. isolate Hart1 OX=134013 GN=GSHART1_T00002991001 PE=4 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 2.332e-30
Identity = 78/180 (43.33%), Postives = 109/180 (60.56%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDC-NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQS--------EKKCYKCNKIGHMSREC 618
            ++  S+  + CY CG+ GHMSRDC    K+G+     +C+NCGESGHMSR+CP+    G   R G    GD          CY+C E+GH+SR+CP +R  G     C+KCGE+GHM+R+C NQ+G  N       CYNC ++GH+SRECP+ +S         + C+KC ++GH +REC
Sbjct:   64 AKAGSAGNISCYRCGESGHMSRDCPNPAKAGAAGVI-SCYNCGESGHMSRDCPKRSRLGKRDRDGGNAGGDR--------SCYSCGEAGHISRDCPTKRYRGSSDKTCFKCGEAGHMSRECPNQQGGGNGDR---SCYNCGKSGHISRECPDERSGNYQRNGGNRTCHKCGEMGHFAREC 231          

HSP 2 Score: 105.916 bits (263), Expect = 1.195e-23
Identity = 67/173 (38.73%), Postives = 85/173 (49.13%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSN-GCYKCGESGHMARDCNQEGSDNRQER-------QVKCYNCNQNGHMSRECPN----GQSEKKCYKCNKIGHMSREC 618
            C+ CG  GH +R+C  S    +      CF CGE GH SR+C      G                      CY C ESGHMSR+CP     G      CY CGESGHM+RDC +     +++R          CY+C + GH+SR+CP     G S+K C+KC + GHMSREC
Sbjct:   19 CHKCGNPGHFARECPNSDDRNAAGNDNTCFKCGEKGHYSRDCTNPAKAGSAGN----------------ISCYRCGESGHMSRDCPNPAKAGAAGVISCYNCGESGHMSRDCPKRSRLGKRDRDGGNAGGDRSCYSCGEAGHISRDCPTKRYRGSSDKTCFKCGEAGHMSREC 175          

HSP 3 Score: 98.5969 bits (244), Expect = 6.798e-21
Identity = 61/151 (40.40%), Postives = 82/151 (54.30%), Query Frame = 1
Query:  130 MECYNCGKDGHMSRDCTESKKSGSGPRSG-------ACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQER--QVKCYNCNQNGHMSRECP 555
            + CYNCG+ GHMSRDC +  + G   R G       +C++CGE+GH+SR+CP    RG   +                  C+ C E+GHMSRECP Q+  G     CY CG+SGH++R+C  E S N Q       C+ C + GH +RECP
Sbjct:   99 ISCYNCGESGHMSRDCPKRSRLGKRDRDGGNAGGDRSCYSCGEAGHISRDCPTKRYRGSSDKT-----------------CFKCGEAGHMSRECPNQQGGGNGDRSCYNCGKSGHISRECPDERSGNYQRNGGNRTCHKCGEMGHFARECP 232          

HSP 4 Score: 82.4185 bits (202), Expect = 6.344e-15
Identity = 57/161 (35.40%), Postives = 72/161 (44.72%), Query Frame = 1
Query:  220 CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSN-GCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECP-------------NGQSEKKCYKCNKIGHMSRECNE*SYLG--DKAFF 654
            C  CG  GH +RECP +  R                       C+ C E GH SR+C      G   N  CY+CGESGHM+RDC            + CYNC ++GHMSR+CP             N   ++ CY C + GH+SR+C    Y G  DK  F
Sbjct:   19 CHKCGNPGHFARECPNSDDRNAAGND---------------NTCFKCGEKGHYSRDCTNPAKAGSAGNISCYRCGESGHMSRDCPNPAKAG-AAGVISCYNCGESGHMSRDCPKRSRLGKRDRDGGNAGGDRSCYSCGEAGHISRDCPTKRYRGSSDKTCF 163          

HSP 5 Score: 58.151 bits (139), Expect = 3.022e-6
Identity = 38/95 (40.00%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  109 RKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECP 393
            R   S    C+ CG+ GHMSR+C   +  G+G RS  C+NCG+SGH+SRECP               R  + + N     C+ C E GH +RECP
Sbjct:  153 RYRGSSDKTCFKCGEAGHMSRECPNQQGGGNGDRS--CYNCGKSGHISRECPD-------------ERSGNYQRNGGNRTCHKCGEMGHFARECP 232          
BLAST of SMED30016196 vs. Ensembl Cavefish
Match: cnbpa (cellular nucleic acid-binding protein-like [Source:NCBI gene;Acc:103024401])

HSP 1 Score: 92.8189 bits (229), Expect = 7.532e-23
Identity = 59/184 (32.07%), Postives = 87/184 (47.28%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKSGSGP----RSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE-----------GSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            M     EC+ CG+ GH  ++C  + +         +   C+ CGE GH++R+C Q                     +     CYNCH SGH+SR+C + +    R   CY CG++GH+ARDC+             G   +   +VKCY C + GH++ +C    SE  CY C K GH++REC 
Sbjct:    1 MDMSSSECFGCGRSGHWVKNCPNAGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTEDGEAL--------------SPFSQTCYNCHRSGHISRDCKEPKKE--REQCCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKLCDKVKCYRCGEIGHVAVQCSKA-SEVNCYNCGKTGHLARECT 167          

HSP 2 Score: 77.411 bits (189), Expect = 4.951e-17
Identity = 50/141 (35.46%), Postives = 74/141 (52.48%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQR---SNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            S  CF CG SGH  + CP              R     RG  +   CY C E GH++R+C +     +  P S  CY C  SGH++RDC +     ++ER+  CYNC + GH++R+C +  +E+KCY C   GH+ + C++
Sbjct:    5 SSECFGCGRSGHWVKNCPN-----------AGRGRGRGRGRGKDLFCYRCGEQGHIARDCEQTEDGEALSPFSQTCYNCHRSGHISRDCKEP----KKEREQCCYNCGKAGHVARDCDHA-NEQKCYSCGGFGHIQKLCDK 129          

HSP 3 Score: 56.6102 bits (135), Expect = 1.358e-9
Identity = 36/116 (31.03%), Postives = 53/116 (45.69%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            CYNCGK GH++RDC  + +         C++CG  GH+ + C +                          +CY C E GH++ +C K          CY CG++GH+AR+C  E S
Sbjct:   93 CYNCGKAGHVARDCDHANEQ-------KCYSCGGFGHIQKLCDK-------------------------VKCYRCGEIGHVAVQCSK-----ASEVNCYNCGKTGHLARECTIEAS 171          
BLAST of SMED30016196 vs. Ensembl Cavefish
Match: ENSAMXT00000005562.2 (cellular nucleic acid-binding protein [Source:NCBI gene;Acc:103027392])

HSP 1 Score: 81.2629 bits (199), Expect = 1.415e-18
Identity = 55/178 (30.90%), Postives = 83/178 (46.63%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGA----CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE-----------GSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH  ++C  + +     R       C+ CGE GH++R+C +                           CYNC   GH+SR+C + +    R   CY CG++GH+ARDC+             G   +   +VKCY C + GH++ +C    SE  CY C K GH+++EC 
Sbjct:    5 ECFGCGRTGHWIKNCPNAGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE-----------------------DACYNCGRGGHISRDCKEPKKE--REQVCYNCGKAGHVARDCDHANEQKCYSCGGFGHIQKGCEKVKCYRCGEIGHVAVQCSKA-SEVNCYNCGKSGHLAKECT 156          

HSP 2 Score: 72.4034 bits (176), Expect = 2.851e-15
Identity = 47/136 (34.56%), Postives = 70/136 (51.47%), Query Frame = 1
Query:  211 SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            S  CF CG +GH  + CP              R     RG  +   CY C E GH++R+C +        + CY CG  GH++RDC +     ++ER+  CYNC + GH++R+C +  +E+KCY C   GH+ + C
Sbjct:    3 SNECFGCGRTGHWIKNCPN-----------AGRGRGKGRGRGKDLFCYRCGEPGHVARDCERTE------DACYNCGRGGHISRDCKEP----KKEREQVCYNCGKAGHVARDCDHA-NEQKCYSCGGFGHIQKGC 116          

HSP 3 Score: 55.8398 bits (133), Expect = 2.449e-9
Identity = 36/120 (30.00%), Postives = 54/120 (45.00%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            R   CYNCGK GH++RDC  + +         C++CG  GH+ + C +                          +CY C E GH++ +C K          CY CG+SGH+A++C  E +
Sbjct:   78 REQVCYNCGKAGHVARDCDHANEQ-------KCYSCGGFGHIQKGCEK-------------------------VKCYRCGEIGHVAVQCSK-----ASEVNCYNCGKSGHLAKECTIEAT 160          
BLAST of SMED30016196 vs. Ensembl Cavefish
Match: ENSAMXT00000046541.1 (zinc finger CCHC domain-containing protein 9 [Source:NCBI gene;Acc:103032950])

HSP 1 Score: 48.521 bits (114), Expect = 2.271e-6
Identity = 29/99 (29.29%), Postives = 46/99 (46.46%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRSNG-CYKCGESGHMARDCNQEGSDNRQERQ-VKCYNCNQNGHMSRECPNGQSEKK-----CYKCNKIGHMSRECNE 624
            C+NC + GH   +CP+   +     G CY+CG + H  + C  +      +    KC+ C Q GH+SR CP+           C+ C  + H  ++C E
Sbjct:  113 CFNCRKPGHGLADCPEADGDEELGRGICYRCGSTEHEIQRCRAKVDPALGDYPYAKCFICGQTGHLSRSCPDNPRGLYAAGGCCHVCGSVEHFQKDCPE 211          
BLAST of SMED30016196 vs. Ensembl Cavefish
Match: ENSAMXT00000047897.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:10959414:10969971:-1 gene:ENSAMXG00000029509.1 transcript:ENSAMXT00000047897.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 46.9802 bits (110), Expect = 3.267e-6
Identity = 29/83 (34.94%), Postives = 37/83 (44.58%), Query Frame = 1
Query:  394 KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVK--------CYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            K +   P  +GCYKCG  GH+ R+ N      R   + K        CY C   GH+ REC   ++  KC  C K GH    C
Sbjct:   34 KPKPKAPSQSGCYKCGAQGHIGRESNTNHVSGRARSKPKPKAPSQSGCYKCGAQGHIGRECIRSKNH-KCSHCGKRGHFDDLC 115          
BLAST of SMED30016196 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003739.1 (pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gene:ENSPMAG00000003418.1 transcript:ENSPMAT00000003739.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 2.280e-18
Identity = 56/140 (40.00%), Postives = 73/140 (52.14%), Query Frame = 1
Query:  220 CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQER--QVKCYNCNQNGHMSRECPN---GQSEKKCYKCNKIGHMSRECNE 624
            CF CG SGH +RECP          G        R G  RG  CY C E GH++RECP  +        CY CG+ GH+AR+C     + RQ+R     CY C + GH++REC +   G  + KCY C + GHM R+C +
Sbjct:    6 CFRCGGSGHWARECPNG-----AGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIARECPLPQDT------CYNCGKGGHIAREC----PEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCTK 130          

HSP 2 Score: 74.7146 bits (182), Expect = 3.376e-17
Identity = 51/150 (34.00%), Postives = 67/150 (44.67%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCT----------ESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSREC 552
            EC+ CG  GH +R+C                G   R   C+ CGE GH++RECP                            CYNC + GH++RECP+ R +      CY CG+ GH+AR+C+  G         KCY C Q GHM R+C
Sbjct:    5 ECFRCGGSGHWARECPNGAGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIARECPLPQ-----------------------DTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDN---KCYGCGQRGHMQRDC 128          

HSP 3 Score: 69.707 bits (169), Expect = 2.864e-15
Identity = 44/108 (40.74%), Postives = 59/108 (54.63%), Query Frame = 1
Query:  346 ECYNCHESGHMSRECP------------KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEK----KCYKCNKIGHMSRECN 621
            EC+ C  SGH +RECP              R    R +GCY+CGE GH+AR+C           Q  CYNC + GH++RECP G+ ++     CY C K GH++REC+
Sbjct:    5 ECFRCGGSGHWARECPNGAGGGRGPGGPVGRGGRGRGDGCYRCGEGGHIARECPLP--------QDTCYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECS 104          
BLAST of SMED30016196 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010393.1 (pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 gene:ENSPMAG00000009411.1 transcript:ENSPMAT00000010393.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.559 bits (179), Expect = 4.991e-17
Identity = 42/98 (42.86%), Postives = 58/98 (59.18%), Query Frame = 1
Query:  349 CYNCHESGHMSRECP-KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQ--VKCYNCNQNGHMSRECPN---GQSEKKCYKCNKIGHMSRECNE 624
            CY C E GH++RECP  Q S    +  CY CG+ GH+AR+C     + RQ+R     CY C + GH++REC +   G  + KCY C + GHM R+C +
Sbjct:   10 CYRCGEGGHIARECPLPQDSVSSNTAACYNCGKGGHIAREC----PEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDNKCYGCGQRGHMQRDCTK 103          

HSP 2 Score: 73.1738 bits (178), Expect = 6.528e-17
Identity = 44/113 (38.94%), Postives = 60/113 (53.10%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQ 474
            CY CG+ GH++R+C   + S S   + AC+NCG+ GH++RECP+     G                  G  CY C + GH++REC      GP  N CY CG+ GHM RDC +
Sbjct:   10 CYRCGEGGHIARECPLPQDSVS-SNTAACYNCGKGGHIARECPEGRQDRGG-----------------GPSCYTCGKQGHLAREC-SSGGGGPGDNKCYGCGQRGHMQRDCTK 103          

HSP 3 Score: 72.4034 bits (176), Expect = 1.537e-16
Identity = 41/112 (36.61%), Postives = 54/112 (48.21%), Query Frame = 1
Query:  217 ACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSREC 552
             C+ CGE GH++RECP                            CYNC + GH++RECP+ R +      CY CG+ GH+AR+C+  G         KCY C Q GHM R+C
Sbjct:    9 GCYRCGEGGHIARECPLPQDSVSSNT----------------AACYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECSSGGGGPGDN---KCYGCGQRGHMQRDC 101          

HSP 4 Score: 68.1662 bits (165), Expect = 4.950e-15
Identity = 32/72 (44.44%), Postives = 47/72 (65.28%), Query Frame = 1
Query:  418 SNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEK----KCYKCNKIGHMSRECN 621
            ++GCY+CGE GH+AR+C     D+       CYNC + GH++RECP G+ ++     CY C K GH++REC+
Sbjct:    7 TDGCYRCGEGGHIARECPLP-QDSVSSNTAACYNCGKGGHIARECPEGRQDRGGGPSCYTCGKQGHLARECS 77          

HSP 5 Score: 54.299 bits (129), Expect = 5.542e-10
Identity = 36/95 (37.89%), Postives = 50/95 (52.63%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKS-GSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPK 396
            +SS    CYNCGK GH++R+C E ++  G GP   +C+ CG+ GH++REC   G   GD                   +CY C + GHM R+C K
Sbjct:   30 VSSNTAACYNCGKGGHIARECPEGRQDRGGGP---SCYTCGKQGHLARECSSGGGGPGD------------------NKCYGCGQRGHMQRDCTK 103          
BLAST of SMED30016196 vs. Ensembl Yeast
Match: GIS2 (Translational activator for mRNAs with internal ribosome entry sites; associates with polysomes and binds to a specific subset of mRNAs; localizes to RNA processing bodies (P bodies) and to stress granules; may have a role in translation regulation under stress conditions; ortholog of human ZNF9/CNBP, a gene involved in myotonic dystrophy type 2 [Source:SGD;Acc:S000005199])

HSP 1 Score: 100.908 bits (250), Expect = 5.014e-27
Identity = 69/188 (36.70%), Postives = 98/188 (52.13%), Query Frame = 1
Query:   58 KILFVCIRIGIHIFD*SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSN-GCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            K  +VC +IG H+   +    S R+ CYNC K GH+  DCT  +          C+NCGE+GH+  EC                             C+NC+++GH+SRECP+ +     S   CYKCG   HMA+DC +E   +     +KCY C Q GHMSR+C   Q+++ CY CN+ GH+S++C
Sbjct:    4 KACYVCGKIG-HL---AEDCDSERL-CYNCNKPGHVQTDCTMPRTV----EFKQCYNCGETGHVRSECTVQ-------------------------RCFNCNQTGHISRECPEPKKTSRFSKVSCYKCGGPNHMAKDCMKEDGIS----GLKCYTCGQAGHMSRDC---QNDRLCYNCNETGHISKDC 150          

HSP 2 Score: 79.7221 bits (195), Expect = 5.246e-19
Identity = 48/143 (33.57%), Postives = 71/143 (49.65%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNG 561
            +CYNCG+ GH+  +CT  +          CFNC ++GH+SRECP+        +                  CY C    HM+++C K+  +G     CY CG++GHM+RDC  +           CYNCN+ GH+S++CP  
Sbjct:   48 QCYNCGETGHVRSECTVQR----------CFNCNQTGHISRECPEPKKTSRFSK----------------VSCYKCGGPNHMAKDCMKE--DGISGLKCYTCGQAGHMSRDCQNDRL---------CYNCNETGHISKDCPKA 153          

HSP 3 Score: 58.151 bits (139), Expect = 4.522e-11
Identity = 33/92 (35.87%), Postives = 49/92 (53.26%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            CY C + GH++ +C  +R        CY C + GH+  DC       R     +CYNC + GH+  EC    + ++C+ CN+ GH+SREC E
Sbjct:    6 CYVCGKIGHLAEDCDSERL-------CYNCNKPGHVQTDCTMP----RTVEFKQCYNCGETGHVRSEC----TVQRCFNCNQTGHISRECPE 82          

HSP 4 Score: 45.4394 bits (106), Expect = 1.283e-6
Identity = 20/46 (43.48%), Postives = 30/46 (65.22%), Query Frame = 1
Query:  130 MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQ 267
            ++CY CG+ GHMSRDC   +          C+NC E+GH+S++CP+
Sbjct:  116 LKCYTCGQAGHMSRDCQNDR---------LCYNCNETGHISKDCPK 152          
BLAST of SMED30016196 vs. Ensembl Nematostella
Match: EDO27708 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T8H9])

HSP 1 Score: 88.1965 bits (217), Expect = 1.001e-19
Identity = 56/149 (37.58%), Postives = 70/149 (46.98%), Query Frame = 1
Query:  220 CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDC----NQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ------------SEKKCYKCNKIGHMSREC 618
            C  CGESGH +R+CPQ G  G                      C+ C+E GH +RECP   S G   N C+KC ESGH AR+C       G          CY CN+ GH +RECPN +            S+  C+KC + GH +REC
Sbjct:   36 CRKCGESGHFARDCPQGGGGGSRT-------------------CHKCNEEGHFARECPNADSGG---NKCFKCNESGHFARECPNSGGGGGGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFAREC 162          

HSP 2 Score: 80.8777 bits (198), Expect = 2.813e-17
Identity = 53/153 (34.64%), Postives = 68/153 (44.44%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECP------KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQV------KCYNCNQNGHMSRECPN 558
            C  CG+ GH +RDC +    G G  S  C  C E GH +RECP                      +  G +C+ C+ESGH +RECP           G   + CYKC E+GH AR+C    S+              C+ C Q GH +RECPN
Sbjct:   36 CRKCGESGHFARDCPQ----GGGGGSRTCHKCNEEGHFARECPN--------------------ADSGGNKCFKCNESGHFARECPNSGGGGGGFGGGSSGSTCYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFARECPN 164          

HSP 3 Score: 65.0846 bits (157), Expect = 5.336e-12
Identity = 45/124 (36.29%), Postives = 64/124 (51.61%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPR--------SNGCYKCGESGHMARDCNQEGS 483
            C+ C ++GH +R+C  +   G+      CF C ESGH +RECP +G  GG   G              G+ CY C+E+GH +RECP   SNG           + C+KC ++GH AR+C  E +
Sbjct:   60 CHKCNEEGHFARECPNADSGGN-----KCFKCNESGHFARECPNSGGGGGGFGG-----------GSSGSTCYKCNETGHFARECPNAESNGGGFGGGGGSSDSTCFKCQQTGHFARECPNESA 167          
BLAST of SMED30016196 vs. Ensembl Nematostella
Match: EDO36176 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJG4])

HSP 1 Score: 67.3958 bits (163), Expect = 3.600e-14
Identity = 45/120 (37.50%), Postives = 63/120 (52.50%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPR----SGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEG 480
            +C+ CG+ GH SR+C      G   +     GAC  CG+ GH SRECP   S+  + +   +           G  C+ C + GH SRECP Q   G +S+ C+KCGE+GH +R+C   G
Sbjct:   21 DCHQCGEAGHFSRECPNKGNQGEPIKRMGGGGACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISG----GRNCHKCGQEGHFSRECPNQAIQG-QSDTCHKCGETGHYSRECPTLG 135          

HSP 2 Score: 64.6994 bits (156), Expect = 4.093e-13
Identity = 43/112 (38.39%), Postives = 59/112 (52.68%), Query Frame = 1
Query:  346 ECYNCHESGHMSRECPKQRSNGPR------SNGCYKCGESGHMARDCNQEGSDNRQERQV-----------KCYNCNQNGHMSRECPN----GQSEKKCYKCNKIGHMSREC 618
            +C+ C E+GH SRECP + + G           C+KCG+ GH +R+C  + S     + +            C+ C Q GH SRECPN    GQS+  C+KC + GH SREC
Sbjct:   21 DCHQCGEAGHFSRECPNKGNQGEPIKRMGGGGACHKCGKEGHFSRECPNQDSQRMNIQYLCQTHFSISGGRNCHKCGQEGHFSRECPNQAIQGQSD-TCHKCGETGHYSREC 131          
BLAST of SMED30016196 vs. Ensembl Nematostella
Match: EDO45618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSD8])

HSP 1 Score: 58.5362 bits (140), Expect = 3.832e-11
Identity = 27/96 (28.12%), Postives = 45/96 (46.88%), Query Frame = 1
Query:  352 YNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKK-----CYKCNKIGHMSRECNE 624
            ++C E GH + +CP+ +        CYKCG + H+ + C    +        KC+ C + GH+S  CP+           C +C  + H+ R+C E
Sbjct:    2 FHCRELGHRAADCPQTKKTSAGVGVCYKCGATSHITKHCKVTTTSESPFPFAKCFICGETGHLSSSCPDNPKGLYPEGGGCKECGSVEHLRRDCPE 97          

HSP 2 Score: 46.2098 bits (108), Expect = 7.572e-7
Identity = 29/101 (28.71%), Postives = 42/101 (41.58%), Query Frame = 1
Query:  106 SRKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSN 408
            ++K S+    CY CG   H+++ C  +  S S      CF CGE+GH+S  CP N                 +     G  C  C    H+ R+CP+   N
Sbjct:   17 TKKTSAGVGVCYKCGATSHITKHCKVTTTSESPFPFAKCFICGETGHLSSSCPDN----------------PKGLYPEGGGCKECGSVEHLRRDCPELERN 101          
BLAST of SMED30016196 vs. Ensembl Nematostella
Match: EDO28813 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T5E8])

HSP 1 Score: 57.3806 bits (137), Expect = 7.730e-11
Identity = 27/97 (27.84%), Postives = 45/97 (46.39%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKK-----CYKCNKIGHMSRECNE 624
            C++C E GH + +CP+ +        CYKC  + H+ + C    +        KC+ C + GH+S  CP+           C +C  + H+ R+C E
Sbjct:    1 CFHCRELGHRAADCPQTKKTSAGVGVCYKCRATSHITKHCKVTTTTESPFPFAKCFICGETGHLSSSCPDNPKGLYPEGGGCKECGSVEHLRRDCPE 97          

HSP 2 Score: 53.1434 bits (126), Expect = 2.586e-9
Identity = 34/126 (26.98%), Postives = 58/126 (46.03%), Query Frame = 1
Query:  136 CYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPK-QRSNGPRSNGCYKCGESGHMARDC-----NQEGSDNRQ 495
            C++C + GH + DC ++KK+ +G   G C+ C  + H+++ C    +                       +C+ C E+GH+S  CP   +   P   GC +CG   H+ RDC     N++G+   Q
Sbjct:    1 CFHCRELGHRAADCPQTKKTSAG--VGVCYKCRATSHITKHCKVTTTTESPFPF---------------AKCFICGETGHLSSSCPDNPKGLYPEGGGCKECGSVEHLRRDCPELERNKQGTVGIQ 109          
BLAST of SMED30016196 vs. Ensembl Nematostella
Match: EDO34570 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP17])

HSP 1 Score: 48.9062 bits (115), Expect = 6.049e-8
Identity = 34/135 (25.19%), Postives = 47/135 (34.81%), Query Frame = 1
Query:  220 CFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            CF CG +GH+   CP                            C  CH+ GH    CP +         C++CG +GH+   C            V C  C+Q GH    CP      +C++C   GH+   C  
Sbjct:    1 CFRCGAAGHVVARCPA-------------------------LACGYCHQVGHPISTCPVR-------GRCFRCGAAGHVVARCPAP--------AVPCGYCHQVGHPISTCP---VRGRCFRCGAAGHVVARCPA 92          
BLAST of SMED30016196 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 85.1149 bits (209), Expect = 4.667e-20
Identity = 56/170 (32.94%), Postives = 83/170 (48.82%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGP------RSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            EC+ CG+ GH  + C  +  +          +   C+ CG+ GHM+R+C Q                           CYNCH SGH+SR+C + +    R   CY CG++GHMARDC+     N Q    KCY+C   GH+ + C     + KCY+C +IGH++  C++
Sbjct:    8 ECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKELFCYRCGDQGHMARDCDQTEDA-----------------------CYNCHRSGHISRDCKEPKKE--REQLCYTCGKAGHMARDCDHA---NEQ----KCYSCGGFGHIQKLC----DKVKCYRCGEIGHVAVHCSK 141          

HSP 2 Score: 84.3445 bits (207), Expect = 1.116e-19
Identity = 54/166 (32.53%), Postives = 80/166 (48.19%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            + + CY CG  GHM+RDC +++         AC+NC  SGH+SR+C +                      +R   CY C ++GHM+R+C     +      CY CG  GH+ + C+          +VKCY C + GH++  C    SE  CY C K GH+++EC 
Sbjct:   39 KELFCYRCGDQGHMARDCDQTED--------ACYNCHRSGHISRDCKE-------------------PKKEREQLCYTCGKAGHMARDC-----DHANEQKCYSCGGFGHIQKLCD----------KVKCYRCGEIGHVAVHCSKA-SETNCYNCGKAGHLAKECT 161          

HSP 3 Score: 71.2478 bits (173), Expect = 6.694e-15
Identity = 39/103 (37.86%), Postives = 57/103 (55.34%), Query Frame = 1
Query:  343 TECYNCHESGHMSRECPKQRSNGP--------RSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSREC--PNGQSEKKCYKCNKIGHMSRECN 621
            +EC+ C   GH  + CP               +   CY+CG+ GHMARDC+Q         +  CYNC+++GH+SR+C  P  + E+ CY C K GHM+R+C+
Sbjct:    7 SECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKELFCYRCGDQGHMARDCDQ--------TEDACYNCHRSGHISRDCKEPKKEREQLCYTCGKAGHMARDCD 101          

HSP 4 Score: 55.0694 bits (131), Expect = 4.907e-9
Identity = 35/120 (29.17%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            R   CY CGK GHM+RDC  + +         C++CG  GH+ + C +                          +CY C E GH++  C K          CY CG++GH+A++C  E +
Sbjct:   83 REQLCYTCGKAGHMARDCDHANEQ-------KCYSCGGFGHIQKLCDK-------------------------VKCYRCGEIGHVAVHCSK-----ASETNCYNCGKAGHLAKECTIEAT 165          
BLAST of SMED30016196 vs. Ensembl Medaka
Match: cnbpa (CCHC-type zinc finger nucleic acid binding protein [Source:NCBI gene;Acc:101173222])

HSP 1 Score: 75.0998 bits (183), Expect = 1.616e-16
Identity = 52/167 (31.14%), Postives = 77/167 (46.11%), Query Frame = 1
Query:  133 ECYNCGKDGHMSRDCTESKKSGSGPRSG----ACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECN 621
            EC+ CG+ GH  + C  +  +    R      AC+NC  SGH+SR+C +                      +R   CY C ++GHM+R+C     +      CY CG  GH+ + C+          +VKCY C + GH++  C    SE  CY C K GH+++EC 
Sbjct:    8 ECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKACYNCHRSGHISRDCKE-------------------PKKEREQLCYTCGKAGHMARDC-----DHANEQKCYSCGGFGHIQKLCD----------KVKCYRCGEIGHVAVHCSKA-SETNCYNCGKAGHLAKECT 139          

HSP 2 Score: 62.7734 bits (151), Expect = 5.212e-12
Identity = 35/100 (35.00%), Postives = 54/100 (54.00%), Query Frame = 1
Query:  343 TECYNCHESGHMSRECPKQRSNGPRS------NGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            +EC+ C   GH  + CP       R         CY C  SGH++RDC +     ++ER+  CY C + GHM+R+C +  +E+KCY C   GH+ + C++
Sbjct:    7 SECFGCGRPGHWVKHCPNASGTRGRGRGRGRGKACYNCHRSGHISRDCKEP----KKEREQLCYTCGKAGHMARDCDHA-NEQKCYSCGGFGHIQKLCDK 101          

HSP 3 Score: 55.4546 bits (132), Expect = 2.866e-9
Identity = 35/120 (29.17%), Postives = 52/120 (43.33%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGS 483
            R   CY CGK GHM+RDC  + +         C++CG  GH+ + C +                          +CY C E GH++  C K          CY CG++GH+A++C  E +
Sbjct:   61 REQLCYTCGKAGHMARDCDHANEQ-------KCYSCGGFGHIQKLCDK-------------------------VKCYRCGEIGHVAVHCSK-----ASETNCYNCGKAGHLAKECTIEAT 143          
BLAST of SMED30016196 vs. Ensembl Medaka
Match: zcchc9 (zinc finger CCHC-type containing 9 [Source:NCBI gene;Acc:101166685])

HSP 1 Score: 50.447 bits (119), Expect = 4.956e-7
Identity = 31/114 (27.19%), Postives = 49/114 (42.98%), Query Frame = 1
Query:  349 CYNCHESGHMSRECPKQRSNGPRSNG-CYKCGESGHMARDCNQEGSDNRQERQ-VKCYNCNQNGHMSRECPNGQSEK-----KCYKCNKIGHMSRECNE*SYLGDKAFFVYMSN 669
            C+NC + GH   +CP+  ++     G CY+CG + H    C  +      +    KC+ C Q GH+SR CP+           C  C  + H  ++C E           ++SN
Sbjct:  120 CFNCRKPGHGLADCPEADADREMGRGICYRCGSTEHEIHKCRAKVDPALGDYPYAKCFICGQTGHLSRSCPDNPKGLYAEGGSCRLCGSVEHFQKDCPEHQAATHSVTLAWLSN 233          
BLAST of SMED30016196 vs. Planmine SMEST
Match: SMESG000059283.1 (SMESG000059283.1)

HSP 1 Score: 286.189 bits (731), Expect = 1.651e-98
Identity = 170/170 (100.00%), Postives = 170/170 (100.00%), Query Frame = 1
Query:  115 MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE
Sbjct:    1 MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 170          

HSP 2 Score: 89.7373 bits (221), Expect = 9.326e-22
Identity = 56/122 (45.90%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  109 RKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQ 474
            R+ + R  ECYNC + GHMSR+C   K+  +GPRS  C+ CGESGHM+R+C Q GS                   +R  +CYNC+++GHMSRECP    NG     CYKC + GHM+R+CN+
Sbjct:   70 RRGNQRGTECYNCHESGHMSRECP--KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQ---------------ERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 170          
BLAST of SMED30016196 vs. Planmine SMEST
Match: SMESG000059283.1 (SMESG000059283.1)

HSP 1 Score: 276.174 bits (705), Expect = 1.167e-94
Identity = 165/165 (100.00%), Postives = 165/165 (100.00%), Query Frame = 1
Query:  130 MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE
Sbjct:    1 MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 165          

HSP 2 Score: 89.3521 bits (220), Expect = 9.452e-22
Identity = 56/122 (45.90%), Postives = 74/122 (60.66%), Query Frame = 1
Query:  109 RKMSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQ 474
            R+ + R  ECYNC + GHMSR+C   K+  +GPRS  C+ CGESGHM+R+C Q GS                   +R  +CYNC+++GHMSRECP    NG     CYKC + GHM+R+CN+
Sbjct:   65 RRGNQRGTECYNCHESGHMSRECP--KQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQ---------------ERQVKCYNCNQNGHMSRECP----NGQSEKKCYKCNKIGHMSRECNE 165          
BLAST of SMED30016196 vs. Planmine SMEST
Match: SMESG000059266.1 (SMESG000059266.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.522e-54
Identity = 102/191 (53.40%), Postives = 127/191 (66.49%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQ--RSNGPRSNGCYKCGESGHMARDCNQEGSDNRQ----------------------ERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            R+++CYNCGKDGHM+RDCTE KKSGS  R+ ACFNCG +GH+S+ECP N   GG+RRGG                CYNC E+GH+S++C  Q  R N PR N CYKCGE+GH++R+C Q  S +RQ                      +RQ+KCYNC+QNGHMSRECPNG SEKKCYKCN  GH++R+C +
Sbjct:    6 RKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSS-----------VTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECPNGPSEKKCYKCNNPGHLARDCTD 185          

HSP 2 Score: 93.9745 bits (232), Expect = 2.759e-23
Identity = 55/123 (44.72%), Postives = 73/123 (59.35%), Query Frame = 1
Query:  130 MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXX-------XXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE 477
            + CYNCG+ GH+S+DC++     + PR   C+ CGE+GH+SR C QN S           + G   R  ++  GN R  +CYNCH++GHMSRECP    NGP    CYKC   GH+ARDC  +
Sbjct:   68 VTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECP----NGPSEKKCYKCNNPGHLARDCTDD 186          

HSP 3 Score: 61.2326 bits (147), Expect = 3.269e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  415 RSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN----------GQSEKKCYKCNKIGHMSRECNE*SY 633
            R   CY CG+ GHMARDC +       +R   C+NC  NGH+S+ECP+          G+S   CY C + GH+S++C++  Y
Sbjct:    6 RKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCSDQGY 88          
BLAST of SMED30016196 vs. Planmine SMEST
Match: SMESG000059254.1 (SMESG000059254.1)

HSP 1 Score: 174.866 bits (442), Expect = 1.522e-54
Identity = 102/191 (53.40%), Postives = 127/191 (66.49%), Query Frame = 1
Query:  124 RRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQ--RSNGPRSNGCYKCGESGHMARDCNQEGSDNRQ----------------------ERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSRECNE 624
            R+++CYNCGKDGHM+RDCTE KKSGS  R+ ACFNCG +GH+S+ECP N   GG+RRGG                CYNC E+GH+S++C  Q  R N PR N CYKCGE+GH++R+C Q  S +RQ                      +RQ+KCYNC+QNGHMSRECPNG SEKKCYKCN  GH++R+C +
Sbjct:    6 RKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSS-----------VTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECPNGPSEKKCYKCNNPGHLARDCTD 185          

HSP 2 Score: 93.9745 bits (232), Expect = 2.759e-23
Identity = 55/123 (44.72%), Postives = 73/123 (59.35%), Query Frame = 1
Query:  130 MECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXX-------XXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQE 477
            + CYNCG+ GH+S+DC++     + PR   C+ CGE+GH+SR C QN S           + G   R  ++  GN R  +CYNCH++GHMSRECP    NGP    CYKC   GH+ARDC  +
Sbjct:   68 VTCYNCGEAGHVSKDCSDQGYRDNAPRGNTCYKCGEAGHISRNCTQNWSGDRQMKCYKCNQLGHMSRDCNEDGGNDRQIKCYNCHQNGHMSRECP----NGPSEKKCYKCNNPGHLARDCTDD 186          

HSP 3 Score: 61.2326 bits (147), Expect = 3.269e-11
Identity = 33/83 (39.76%), Postives = 47/83 (56.63%), Query Frame = 1
Query:  415 RSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPN----------GQSEKKCYKCNKIGHMSRECNE*SY 633
            R   CY CG+ GHMARDC +       +R   C+NC  NGH+S+ECP+          G+S   CY C + GH+S++C++  Y
Sbjct:    6 RKLDCYNCGKDGHMARDCTEYKKSGSNQRTNACFNCGLNGHISKECPDNRRGGGNRRGGRSSVTCYNCGEAGHVSKDCSDQGY 88          
BLAST of SMED30016196 vs. Planmine SMEST
Match: SMESG000008610.1 (SMESG000008610.1)

HSP 1 Score: 96.2857 bits (238), Expect = 3.773e-24
Identity = 57/164 (34.76%), Postives = 81/164 (49.39%), Query Frame = 1
Query:  127 RMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECPQNXXXXXXXXXXXXXXXXXXXXNQRGTECYNCHESGHMSRECPKQRSNGPRSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQSEKKCYKCNKIGHMSREC 618
            R  CY CG++GH+++DC      GSG     C+NCG + H+ ++CP+                           CY C+  GH++R C    S       CYKC + GH+ARDCN    +    R   CY CN+ GH +R+CPN      C+ C ++GHM+REC
Sbjct:   57 RKSCYQCGREGHIAKDC------GSGDNQNGCYNCGGTDHLQKDCPEVIV----------------------KTCYRCNCKGHLARNCT---STIEDDRSCYKCNKKGHLARDCNNSYGNGSSNRHFVCYKCNEPGHYARDCPN--DSIICHNCQEVGHMAREC 187          
The following BLAST results are available for this feature:
BLAST of SMED30016196 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CNBP1.097e-1829.94CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.436e-1838.46CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.569e-1837.68CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.753e-1838.46CCHC-type zinc finger nucleic acid binding protein... [more]
CNBP1.999e-1837.68CCHC-type zinc finger nucleic acid binding protein... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
K08D12.37.076e-1237.91pep chromosome:WBcel235:IV:1710265:1711127:1 gene:... [more]
glh-41.561e-730.77ATP-dependent RNA helicase glh-4 [Source:UniProtK... [more]
glh-41.561e-730.77ATP-dependent RNA helicase glh-4 [Source:UniProtK... [more]
glh-15.622e-736.22ATP-dependent RNA helicase glh-1 [Source:UniProtK... [more]
glh-26.486e-730.28ATP-dependent RNA helicase glh-2 [Source:UniProtK... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CNBP3.846e-1730.00gene:FBgn0034802 transcript:FBtr0303464[more]
CNBP3.846e-1730.00gene:FBgn0034802 transcript:FBtr0071994[more]
back to top
BLAST of SMED30016196 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnbpa2.516e-2032.18CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa2.516e-2032.18CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpa2.516e-2032.18CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb8.974e-1931.46CCHC-type zinc finger, nucleic acid binding protei... [more]
cnbpb8.974e-1931.46CCHC-type zinc finger, nucleic acid binding protei... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
rfc41.421e-624.82Xenopus tropicalis terminal uridylyl transferase 7... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zcchc133.636e-1929.69zinc finger, CCHC domain containing 13 [Source:MGI... [more]
Cnbp5.236e-1937.68cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp9.856e-1938.46cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp9.856e-1938.46cellular nucleic acid binding protein [Source:MGI ... [more]
Cnbp1.077e-1837.68cellular nucleic acid binding protein [Source:MGI ... [more]
back to top
BLAST of SMED30016196 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q04832|HEXP_LEIMA3.863e-3241.44DNA-binding protein HEXBP OS=Leishmania major OX=5... [more]
sp|P53849|GIS2_YEAST3.481e-2536.70Zinc finger protein GIS2 OS=Saccharomyces cerevisi... [more]
sp|O65639|CSP1_ARATH2.676e-2336.56Cold shock protein 1 OS=Arabidopsis thaliana OX=37... [more]
sp|P36627|BYR3_SCHPO1.049e-2034.30Cellular nucleic acid-binding protein homolog OS=S... [more]
sp|P62634|CNBP_RAT6.895e-1838.46Cellular nucleic acid-binding protein OS=Rattus no... [more]
back to top
BLAST of SMED30016196 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K1VCT45.887e-3142.54Universal minicircle sequence binding protein - pu... [more]
A4IDD55.887e-3142.54Putative universal minicircle sequence binding pro... [more]
E9BTN15.887e-3142.54Universal minicircle sequence binding protein (UMS... [more]
A0A3Q8IQS75.887e-3142.54Universal minicircle sequence binding protein, put... [more]
W6KZI32.332e-3043.33Uncharacterized protein OS=Phytomonas sp. isolate ... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
cnbpa7.532e-2332.07cellular nucleic acid-binding protein-like [Source... [more]
ENSAMXT00000005562.21.415e-1830.90cellular nucleic acid-binding protein [Source:NCBI... [more]
ENSAMXT00000046541.12.271e-629.29zinc finger CCHC domain-containing protein 9 [Sour... [more]
ENSAMXT00000047897.13.267e-634.94pep primary_assembly:Astyanax_mexicanus-2.0:15:109... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000003739.12.280e-1840.00pep scaffold:Pmarinus_7.0:GL499243:411:1384:-1 gen... [more]
ENSPMAT00000010393.14.991e-1742.86pep scaffold:Pmarinus_7.0:GL485791:8073:10868:-1 g... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
GIS25.014e-2736.70Translational activator for mRNAs with internal ri... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO277081.001e-1937.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361763.600e-1437.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO456183.832e-1128.13Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO288137.730e-1127.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345706.049e-825.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30016196 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
cnbpa4.667e-2032.94CCHC-type zinc finger nucleic acid binding protein... [more]
cnbpa1.616e-1631.14CCHC-type zinc finger nucleic acid binding protein... [more]
zcchc94.956e-727.19zinc finger CCHC-type containing 9 [Source:NCBI ge... [more]
back to top
BLAST of SMED30016196 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000059283.11.651e-98100.00SMESG000059283.1[more]
SMESG000059283.11.167e-94100.00SMESG000059283.1[more]
SMESG000059266.11.522e-5453.40SMESG000059266.1[more]
SMESG000059254.11.522e-5453.40SMESG000059254.1[more]
SMESG000008610.13.773e-2434.76SMESG000008610.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016196 ID=SMED30016196|Name=SMED30016196|organism=Schmidtea mediterranea sexual|type=transcript|length=822bp
TTAAAAATATTGATAAAATTAATATAATATTTTATTCTTATAATTACATT
AAAAAATAAAATCCTGTTTGTTTGTATACGCATTGGAATTCACATATTTG
ATTAATCACGAAAAATGAGTTCAAGAAGAATGGAGTGTTACAATTGTGGT
AAAGATGGCCATATGTCAAGAGATTGTACTGAAAGTAAGAAGTCTGGATC
TGGTCCACGATCAGGAGCTTGCTTCAATTGCGGTGAAAGTGGTCATATGT
CTAGAGAATGCCCTCAAAATGGCAGTCGTGGAGGCGACCGTAGAGGAGGC
TATGAACGCAGAGGAGATGATAGACGAGGAAACCAAAGAGGTACTGAATG
TTATAACTGTCATGAAAGTGGACACATGTCGAGAGAATGTCCAAAACAAA
GAAGCAATGGCCCAAGAAGTAATGGCTGTTATAAATGTGGTGAAAGTGGC
CATATGGCTCGTGATTGTAACCAAGAAGGTAGTGATAATAGACAAGAAAG
ACAAGTTAAATGTTACAATTGTAATCAAAATGGCCATATGTCGAGAGAAT
GCCCCAATGGACAATCGGAAAAGAAGTGTTACAAGTGTAACAAAATTGGA
CATATGTCCAGAGAGTGCAACGAATAAAGTTATCTAGGAGATAAAGCATT
TTTTGTATATATGAGCAATAAATGTTTTTAAAATAAGTTTTAGCGTTTTC
GGTGTTAATTGGTTGTAATGACTGTACTTTTATTAATAAGTAGATTTATG
TACTATTTATAATAAATTCTTGTATCAGTCTTTAGTTATTTCATTGTAAA
TACAATTTAAAGTGTAAAAAAA
back to top

protein sequence of SMED30016196-orf-1

>SMED30016196-orf-1 ID=SMED30016196-orf-1|Name=SMED30016196-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=171bp
MSSRRMECYNCGKDGHMSRDCTESKKSGSGPRSGACFNCGESGHMSRECP
QNGSRGGDRRGGYERRGDDRRGNQRGTECYNCHESGHMSRECPKQRSNGP
RSNGCYKCGESGHMARDCNQEGSDNRQERQVKCYNCNQNGHMSRECPNGQ
SEKKCYKCNKIGHMSRECNE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000429neoblast
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR036875Znf_CCHC_sf
IPR001878Znf_CCHC
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0003676nucleic acid binding
GO:0003677DNA binding
GO:0003729mRNA binding
GO:0008494translation activator activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005829cytosol
Vocabulary: biological process
TermDefinition
GO:2000767positive regulation of cytoplasmic translation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001878Zinc finger, CCHC-typeSMARTSM00343c2hcfinal6coord: 154..170
e-value: 5.3E-4
score: 29.3
coord: 35..51
e-value: 5.7E-6
score: 35.8
coord: 104..120
e-value: 8.3E-5
score: 32.0
coord: 78..94
e-value: 1.7E-4
score: 30.9
coord: 132..148
e-value: 2.1E-5
score: 34.0
coord: 7..23
e-value: 1.6E-5
score: 34.4
IPR001878Zinc finger, CCHC-typePFAMPF00098zf-CCHCcoord: 153..169
e-value: 2.0E-6
score: 27.6
coord: 104..119
e-value: 1.5E-7
score: 31.1
coord: 35..51
e-value: 1.6E-8
score: 34.2
coord: 132..148
e-value: 3.8E-8
score: 33.1
coord: 79..94
e-value: 8.4E-6
score: 25.6
coord: 7..23
e-value: 7.5E-8
score: 32.1
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 132..148
score: 10.905
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 36..51
score: 11.416
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 154..170
score: 10.197
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 105..120
score: 11.252
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 79..94
score: 10.559
IPR001878Zinc finger, CCHC-typePROSITEPS50158ZF_CCHCcoord: 8..23
score: 11.285
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 100..127
e-value: 1.7E-7
score: 33.1
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 128..170
e-value: 3.0E-15
score: 57.6
NoneNo IPR availableGENE3DG3DSA:4.10.60.10coord: 32..60
e-value: 4.7E-9
score: 37.8
coord: 2..31
e-value: 4.6E-8
score: 34.6
coord: 67..99
e-value: 4.1E-9
score: 38.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 58..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 43..72
NoneNo IPR availablePANTHERPTHR23002:SF104coord: 6..97
coord: 101..169
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 33..124
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 6..97
NoneNo IPR availablePANTHERPTHR23002ZINC FINGER CCHC DOMAIN CONTAINING PROTEINcoord: 101..169
NoneNo IPR availablePANTHERPTHR23002:SF104coord: 33..124
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 69..121
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 4..53
IPR036875Zinc finger, CCHC-type superfamilySUPERFAMILYSSF57756Retrovirus zinc finger-like domainscoord: 124..169