Septin-5

Overview
NameSeptin-5
Smed IDSMED30016193
Length (bp)2205
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Septin-5 (SMED30016193) t-SNE clustered cells

Violin plots show distribution of expression levels for Septin-5 (SMED30016193) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Septin-5 (SMED30016193) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Septin-5 (SMED30016193) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016193

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30016193SMESG000076922.1 dd_Smed_v4_1717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016193SMESG000076922.1 dd_Smed_v4_1717_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016193SMESG000076922.1 dd_Smed_v4_1717_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 412.535 bits (1059), Expect = 8.779e-137
Identity = 203/399 (50.88%), Postives = 279/399 (69.92%), Query Frame = 1
Query:   97 SKKEDGDDSFKFTSRPPLASST--------IRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            S+ +  D+   F +  PL+ S         +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   63 SRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 458          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 412.535 bits (1059), Expect = 8.779e-137
Identity = 203/399 (50.88%), Postives = 279/399 (69.92%), Query Frame = 1
Query:   97 SKKEDGDDSFKFTSRPPLASST--------IRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            S+ +  D+   F +  PL+ S         +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   63 SRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 458          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 412.92 bits (1060), Expect = 1.558e-136
Identity = 203/399 (50.88%), Postives = 279/399 (69.92%), Query Frame = 1
Query:   97 SKKEDGDDSFKFTSRPPLASST--------IRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            S+ +  D+   F +  PL+ S         +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   97 SRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 492          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 412.92 bits (1060), Expect = 1.558e-136
Identity = 203/399 (50.88%), Postives = 279/399 (69.92%), Query Frame = 1
Query:   97 SKKEDGDDSFKFTSRPPLASST--------IRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            S+ +  D+   F +  PL+ S         +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   97 SRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 492          
BLAST of Septin-5 vs. Ensembl Human
Match: SEPTIN4 (septin 4 [Source:HGNC Symbol;Acc:HGNC:9165])

HSP 1 Score: 408.297 bits (1048), Expect = 2.458e-136
Identity = 197/363 (54.27%), Postives = 265/363 (73.00%), Query Frame = 1
Query:  181 AKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            A +D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   19 AGDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 378          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-59 (pep chromosome:WBcel235:I:13629227:13633494:1 gene:WBGene00006793.1 transcript:W09C5.2.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-59)

HSP 1 Score: 281.952 bits (720), Expect = 6.705e-87
Identity = 149/352 (42.33%), Postives = 226/352 (64.20%), Query Frame = 1
Query:  157 STIRSNGSAKNDE-LK----------LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYT-EPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINR-KNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDA--EIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR-GQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDT 1164
            S+  +N S++NDE L+           GFAN P Q+ R+AVK GF+FTLM+VG SGLGKSTF+N+L    I     ++++      ST ++E+  ++L E  V L LT+VDTPGFGD ++  +CW+PIV Y++  F++ F +E  I+R + I D  VH CLYFI P+GHG+KP+D+ELMK LH +VNIVP+I+KAD LT  EL  FK++++ D E  +I  Y+ P    + ED +  + A  ++R ALPF+++GSN++ + D G+K+R R+Y WG  EVEN +H +F  LR  I+RT++ D+ DVT ++ YEN+R  Q+  +    +N D +  +  +       +D+  +T
Sbjct:    2 SSRTANSSSRNDESLRTGQHKENPNYWGFANFPNQVFRRAVKNGFDFTLMVVGRSGLGKSTFINTLFLAEINNLNEKESAPTHPHPSTVRVEEKLVKLVENSVSLNLTLVDTPGFGDAVNNSKCWEPIVNYVESKFFEQFCEETRIDRGEKIVDKCVHLCLYFIEPSGHGLKPIDIELMKHLHGRVNIVPVISKADCLTRDELLRFKKQIVKDAETAEIKLYKFP----ELEDPYTDKVAIEKLRKALPFAIIGSNMLKEKD-GKKIRYREYPWGTVEVENMQHNDFLTLRDMIIRTNLIDMIDVTRNVHYENFRFRQMEGLPKNEKNRDPFTHLEEERRQKEQDLDEKRNT 348          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 230.335 bits (586), Expect = 1.291e-67
Identity = 122/317 (38.49%), Postives = 194/317 (61.20%), Query Frame = 1
Query:  127 KFTSRPPLASSTIRSNGSAKNDELKL----GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDM-INSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINR--KNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            K T   P A S I+S        ++L    GF +LP Q+ +KAV+ GF F LM VGE+G GK+T + SL N  +  EP +   + + + + TK      ++ E G++++L +V+T GFGD LD  +  K IV+Y++  F  Y ++E    R  +   D+R+H CLYFISPTGHG+K +D+  ++ L  +VN++P+IAK+D+  + EL  FK K++ +L+  +I+ Y  P     +++     + E+  ++PF+VVGS   V  ++G+ +R RQY WGI EVEN  HC+F  LR  +LRT++ +++  T++ LYENYR
Sbjct:   51 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTK------DVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPT----DDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 357          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731095:14733877:-1 gene:WBGene00006795.1 transcript:Y50E8A.4c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 230.335 bits (586), Expect = 1.650e-67
Identity = 122/317 (38.49%), Postives = 194/317 (61.20%), Query Frame = 1
Query:  127 KFTSRPPLASSTIRSNGSAKNDELKL----GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDM-INSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINR--KNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            K T   P A S I+S        ++L    GF +LP Q+ +KAV+ GF F LM VGE+G GK+T + SL N  +  EP +   + + + + TK      ++ E G++++L +V+T GFGD LD  +  K IV+Y++  F  Y ++E    R  +   D+R+H CLYFISPTGHG+K +D+  ++ L  +VN++P+IAK+D+  + EL  FK K++ +L+  +I+ Y  P     +++     + E+  ++PF+VVGS   V  ++G+ +R RQY WGI EVEN  HC+F  LR  +LRT++ +++  T++ LYENYR
Sbjct:   51 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTK------DVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPT----DDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 357          
BLAST of Septin-5 vs. Ensembl Celegans
Match: unc-61 (pep chromosome:WBcel235:V:14731136:14734237:-1 gene:WBGene00006795.1 transcript:Y50E8A.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:unc-61)

HSP 1 Score: 231.106 bits (588), Expect = 3.862e-67
Identity = 122/317 (38.49%), Postives = 194/317 (61.20%), Query Frame = 1
Query:  127 KFTSRPPLASSTIRSNGSAKNDELKL----GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDM-INSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINR--KNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            K T   P A S I+S        ++L    GF +LP Q+ +KAV+ GF F LM VGE+G GK+T + SL N  +  EP +   + + + + TK      ++ E G++++L +V+T GFGD LD  +  K IV+Y++  F  Y ++E    R  +   D+R+H CLYFISPTGHG+K +D+  ++ L  +VN++P+IAK+D+  + EL  FK K++ +L+  +I+ Y  P     +++     + E+  ++PF+VVGS   V  ++G+ +R RQY WGI EVEN  HC+F  LR  +LRT++ +++  T++ LYENYR
Sbjct:  120 KPTIAAPTAPSPIKSLSDHTGRVMQLNGHVGFDSLPHQLVKKAVEAGFQFNLMCVGETGTGKTTLIESLFNMKLDFEPCNHELKTVELRTCTK------DVAEGGIRVKLRLVETAGFGDQLDKDKSAKVIVDYLESQFETYLQEELKPRRMLQYFNDSRIHACLYFISPTGHGLKALDLVTLRELAKRVNVIPVIAKSDTTCKDELLRFKAKILSELKSQKIDIYTFPT----DDETVSTTNKEMNKSVPFAVVGSIDFVKKENGQMVRARQYPWGIVEVENESHCDFVKLREALLRTNVDEMRQRTHESLYENYR 426          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074371)

HSP 1 Score: 375.555 bits (963), Expect = 4.825e-124
Identity = 176/350 (50.29%), Postives = 251/350 (71.71%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII----QVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +GFA LPEQ+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y   +  + E+ I  TTK+EK  ++++E+GV+LRLT+VDTPGFGD ++C + W+   +YIDE F QYF DE  +NR+NIQDNRVHCCLYF+ P GH ++ +D++L++ LH KVNIV +I KAD L + E++  K +++ DLE   I  YQ P C SDE+D+F+ QD E++A++PF+VVGSN I++  +G+K+RGRQY WG+  VE+ +H +F  LRTF++ THMQDLKD T D+ YEN+R Q I    Q  +  R   +  +I+S     A+    I +T  LL +KDEEI+R+Q +L++MQ ++
Sbjct:   14 IGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEV-AGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAA----ISETDRLLLQKDEEIRRMQDMLTQMQEKL 358          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074368)

HSP 1 Score: 377.096 bits (967), Expect = 8.575e-124
Identity = 181/371 (48.79%), Postives = 257/371 (69.27%), Query Frame = 1
Query:  139 RPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII----QVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            RPP+         S   D   +GFA LPEQ+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y   +  + E+ I  TTK+EK  ++++E+GV+LRLT+VDTPGFGD ++C + W+   +YIDE F QYF DE  +NR+NIQDNRVHCCLYF+ P GH ++ +D++L++ LH KVNIV +I KAD L + E++  K +++ DLE   I  YQ P C SDE+D+F+ QD E++A++PF+VVGSN I++  +G+K+RGRQY WG+  VE+ +H +F  LRTF++ THMQDLKD T D+ YEN+R Q I    Q  +  R   +  +I+S     A+    I +T  LL +KDEEI+R+Q +L++MQ ++
Sbjct:   47 RPPIYPKP--KTPSFDKDRDYIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEV-AGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAA----ISETDRLLLQKDEEIRRMQDMLTQMQEKL 410          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074366)

HSP 1 Score: 377.096 bits (967), Expect = 8.575e-124
Identity = 181/371 (48.79%), Postives = 257/371 (69.27%), Query Frame = 1
Query:  139 RPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII----QVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            RPP+         S   D   +GFA LPEQ+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y   +  + E+ I  TTK+EK  ++++E+GV+LRLT+VDTPGFGD ++C + W+   +YIDE F QYF DE  +NR+NIQDNRVHCCLYF+ P GH ++ +D++L++ LH KVNIV +I KAD L + E++  K +++ DLE   I  YQ P C SDE+D+F+ QD E++A++PF+VVGSN I++  +G+K+RGRQY WG+  VE+ +H +F  LRTF++ THMQDLKD T D+ YEN+R Q I    Q  +  R   +  +I+S     A+    I +T  LL +KDEEI+R+Q +L++MQ ++
Sbjct:   47 RPPIYPKP--KTPSFDKDRDYIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEV-AGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAA----ISETDRLLLQKDEEIRRMQDMLTQMQEKL 410          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074365)

HSP 1 Score: 377.096 bits (967), Expect = 8.575e-124
Identity = 181/371 (48.79%), Postives = 257/371 (69.27%), Query Frame = 1
Query:  139 RPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII----QVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            RPP+         S   D   +GFA LPEQ+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y   +  + E+ I  TTK+EK  ++++E+GV+LRLT+VDTPGFGD ++C + W+   +YIDE F QYF DE  +NR+NIQDNRVHCCLYF+ P GH ++ +D++L++ LH KVNIV +I KAD L + E++  K +++ DLE   I  YQ P C SDE+D+F+ QD E++A++PF+VVGSN I++  +G+K+RGRQY WG+  VE+ +H +F  LRTF++ THMQDLKD T D+ YEN+R Q I    Q  +  R   +  +I+S     A+    I +T  LL +KDEEI+R+Q +L++MQ ++
Sbjct:   47 RPPIYPKP--KTPSFDKDRDYIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEV-AGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAA----ISETDRLLLQKDEEIRRMQDMLTQMQEKL 410          
BLAST of Septin-5 vs. Ensembl Fly
Match: Sep4 (gene:FBgn0259923 transcript:FBtr0074369)

HSP 1 Score: 377.096 bits (967), Expect = 8.575e-124
Identity = 181/371 (48.79%), Postives = 257/371 (69.27%), Query Frame = 1
Query:  139 RPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII----QVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            RPP+         S   D   +GFA LPEQ+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y   +  + E+ I  TTK+EK  ++++E+GV+LRLT+VDTPGFGD ++C + W+   +YIDE F QYF DE  +NR+NIQDNRVHCCLYF+ P GH ++ +D++L++ LH KVNIV +I KAD L + E++  K +++ DLE   I  YQ P C SDE+D+F+ QD E++A++PF+VVGSN I++  +G+K+RGRQY WG+  VE+ +H +F  LRTF++ THMQDLKD T D+ YEN+R Q I    Q  +  R   +  +I+S     A+    I +T  LL +KDEEI+R+Q +L++MQ ++
Sbjct:   47 RPPIYPKP--KTPSFDKDRDYIGFATLPEQVHRKSVKRGFEFTLMVVGESGLGKSTLINSLFLGDLYKNRQMPNVEERIEKTTKVEKKTMDIEERGVRLRLTVVDTPGFGDAINCEDSWRVCTQYIDEQFRQYFTDESGLNRRNIQDNRVHCCLYFVPPWGHSLRQMDLDLIRRLHRKVNIVLVIGKADCLNKQEVRKLKERILQDLEDNHIQLYQFPECDSDEDDDFKQQDRELKASIPFAVVGSNTILEV-AGKKVRGRQYPWGVVNVEDPEHSDFIKLRTFLISTHMQDLKDTTQDVHYENFRAQCISQISQHALRERGKLKRDSISSTNGFDAA----ISETDRLLLQKDEEIRRMQDMLTQMQEKL 410          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept4a (septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87])

HSP 1 Score: 402.519 bits (1033), Expect = 7.880e-133
Identity = 193/363 (53.17%), Postives = 260/363 (71.63%), Query Frame = 1
Query:  172 NGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQ--VRMTRRNNDRYATINSKTESTASSIDDIV-----DTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            + +   D+  +GFA LP Q+ RK+VKKGF FTLM+ GESGLGKST VNSL    +Y + +  ++E+ I  T +I KH + ++EKGVKLRLTIVDTPGFGD ++  E W+ IV+YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH KVNIVP++AK DSLT  E++  K K+ +++E++ I  YQ P C SDEEDEF+ Q  E++ ++PF+V+GSN+ V+S  GR+ RGRQY WG+ EVEN +H +F  LR  ++RTHMQDLKDVT +  YENYR Q IQ   RM  R   R  ++NS+   + S +   +     +T  L+ EKDEE++R+Q VL ++Q Q+
Sbjct:  107 DSAEDQDKEYVGFATLPNQVHRKSVKKGFAFTLMVAGESGLGKSTLVNSLFLTDLYKDRKMPNAEERIAQTVEITKHTVAIEEKGVKLRLTIVDTPGFGDAVNNTESWRAIVDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPIDVEFMKILHEKVNIVPVLAKTDSLTPEEVRKMKMKIREEIERFDIMIYQFPECESDEEDEFKLQQQELKDSVPFAVIGSNVQVES-QGRRFRGRQYPWGLVEVENPEHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCIQNMTRMVVRERKR--SLNSRLRESPSDLPVPLVPVDTETERLIWEKDEELRRMQEVLERIQEQM 466          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept5a (septin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7868])

HSP 1 Score: 398.667 bits (1023), Expect = 2.679e-132
Identity = 190/362 (52.49%), Postives = 258/362 (71.27%), Query Frame = 1
Query:  154 SSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            S +++S  S   D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECW+PI +YID+ F QYF+DE  +NRKNI DNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P+I+KAD LT +E+K  K +V D++E++ I  YQ P C SDEE+EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR   IQ   ++   D     +S          D V+T  L++ KDEE++R+Q +L KMQ Q+
Sbjct:   50 SRSMKSEDS--EDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWRPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLISKADCLTPTEVKKLKDRVRDEIERFGIKVYQFPECDSDEEEEFKQMDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQDNRT--DSPLPILPLPTPD-VETEKLIKMKDEELKRMQEMLEKMQQQM 405          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept5b (septin 5b [Source:ZFIN;Acc:ZDB-GENE-040808-43])

HSP 1 Score: 387.111 bits (993), Expect = 1.862e-128
Identity = 188/370 (50.81%), Postives = 259/370 (70.00%), Query Frame = 1
Query:  130 FTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
             TS     S T++S    + +   +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST +NSL    +Y + +  ++E+ I+ T +I KH ++++EKGVKL+LTIVDTPGFGD ++  E W+ I +YI++ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDVE MK L  KVNIVP+I+KAD LT +E++  K +V +++EK+ I  YQ P C SDE++E + QD E++ + PF+V+GSN IV+   G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKD+T D  YENYR Q IQ   ++   D    + S       S  D V+T  L++ KDEE++R+Q +L KMQ Q+
Sbjct:    1 MTSSARYKSRTVKSEDGEEKE--YVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLINSLFLTDLYKDRKLLNAEERISQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTESWRTITDYIEQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVEFMKALQDKVNIVPLISKADCLTPAEMRKMKDRVREEIEKFGIKVYQFPDCDSDEDEELKQQDRELKESTPFAVIGSNTIVEV-KGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDITCDAHYENYRAQCIQQMTSKLTQDN--RVESPIPILPLSTPD-VETEKLIKMKDEELRRMQEMLQKMQQQM 364          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: BX640522.1 (septin 4b [Source:NCBI gene;Acc:100003446])

HSP 1 Score: 379.407 bits (973), Expect = 1.176e-124
Identity = 191/368 (51.90%), Postives = 261/368 (70.92%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQ--VRMTRRNNDR-YATINSKTE---STASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVDNSSTM 1275
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ I  T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWK + +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH KVNIVP++AKAD+LT  E+K  K K+ +++E+Y I  YQ P C SDE++EF+ QD E++ ++PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHMQDLKDVT +  YENYR   IQ   RM  +  +R   T  S T+    TA  + D  +T  L++EKDEE+++     ++ Q  ++    VD    M
Sbjct:   26 DKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERITQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNTECWKSVADYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHEKVNIVPVLAKADTLTPLEVKKKKIKIREEIEQYGIKIYQFPDCDSDEDEEFKQQDQELKDSIPFAVIGSNTVVEA-KGKRVRGRLYPWGIVEVENPAHCDFVKLRNMLVRTHMQDLKDVTRETHYENYRAHCIQSMTRMVVKERNRNKLTRESGTDFPIPTAPGVSD-SETEKLIREKDEEVRQPPHTQTQEQECVTQE-CVDQECVM 390          
BLAST of Septin-5 vs. Ensembl Zebrafish
Match: sept2 (septin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-911])

HSP 1 Score: 344.354 bits (882), Expect = 7.012e-112
Identity = 170/371 (45.82%), Postives = 255/371 (68.73%), Query Frame = 1
Query:  154 SSTIRSNGSAKNDELK--LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVD 1260
            +  ++  G   N E    +GFANLP Q+ RK+VKKGF FTLM+VGESGLGKST +NSL    +Y E     + + I  T +IE   +E++E+GVKLRLT+VDTPG+GD ++ ++C+  I+ YID+ F +Y  DE  +NR++I DNRVHCC YFISP GHG+KP+DV+ MK +H+KVN+VP+IAKAD+LT  E +  KR+++D+++++ I  Y  P   SDE+++F+ Q   ++A++PF+VVGSN  +++  G+K+RGR Y WG+ EVEN +H +F  LRT ++ THMQDL++VT DL YEN+R + ++ R  R ++  Y    S  +       + +D   +L EK+ E++R+Q +++KMQ Q+   G  D
Sbjct:    4 ADKLKQQGQFTNPETPGYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLINSLFLTDLYPERVIPGAAEKIERTVQIEASTVEIEERGVKLRLTVVDTPGYGDAINSQDCFNTIISYIDDQFERYLHDESGLNRRHIVDNRVHCCFYFISPLGHGLKPLDVQFMKAIHNKVNVVPVIAKADTLTLRERERLKRRILDEIDEHGIKIYHLPDAESDEDEDFKEQTRILKASIPFAVVGSNQQIEA-KGKKVRGRLYPWGVVEVENPEHNDFLKLRTMLI-THMQDLQEVTQDLHYENFRSERLK-RGGRLSSHGYILPLSPAKGPEP---EEMDKDMILLEKEAELRRMQEMIAKMQAQMQKQGDED 368          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: cbx5 (chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727])

HSP 1 Score: 395.971 bits (1016), Expect = 3.231e-131
Identity = 190/348 (54.60%), Postives = 255/348 (73.28%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSK------TESTASSIDDI---VDTSNLLQEKDEEIQRIQAVL 1218
            +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ I+ T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDV  MK LH KVNIVP+IAKAD L   E++  K ++ +++EK+ I  YQ P C SDE+D+F+ QD E++ + PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHM DLKDVT D+ YENYR Q IQ +MT RN +R+ T +SK       ES    +       +T  L++ KDEE++R+Q +L
Sbjct:   50 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVAFMKALHEKVNIVPLIAKADCLIPGEIRKLKDRIREEIEKFGIKVYQFPECDSDEDDDFKQQDRELKESAPFAVIGSNTVVEA-KGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAQCIQ-QMT-RNEERHNTASSKLTQDNRIESPIPILPLPTPDAETEKLIKMKDEELRRMQEML 394          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: cbx5 (chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727])

HSP 1 Score: 392.889 bits (1008), Expect = 3.714e-130
Identity = 184/339 (54.28%), Postives = 246/339 (72.57%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVL 1218
            +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ I+ T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDV  MK LH KVNIVP+IAKAD L   E++  K ++ +++EK+ I  YQ P C SDE+D+F+ QD E++ + PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHM DLKDVT D+ YENYR Q IQ   ++   D    I S          D  +T  L++ KDEE++R+Q +L
Sbjct:   50 VGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVAFMKALHEKVNIVPLIAKADCLIPGEIRKLKDRIREEIEKFGIKVYQFPECDSDEDDDFKQQDRELKESAPFAVIGSNTVVEA-KGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAQCIQQMTSKLTQDN--RIESPIPILPLPTPD-AETEKLIKMKDEELRRMQEML 384          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 393.275 bits (1009), Expect = 1.203e-129
Identity = 187/373 (50.13%), Postives = 257/373 (68.90%), Query Frame = 1
Query:  136 SRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQ---VRMTRRNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            SRP           S + D   +GFA LP QM RK VKKGF FTLM+ GESGLGKST +NSL    +Y +    S E+ +  T +I K  +++ EKGV+LRLT+VDTPG+GD ++   CWKP+ +YID+ F QYF+DE  +NR+N+QD RVHCCLYF+SP GHG++P+D+E ++ L  KVNIVPI+ KADSLT +EL+  K+++ D+++KY I  YQ P C  DE+++F+ QD E++ ++PF+V+GSN I++  +GR++RGR Y WG+ EVEN +HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ    R+ R  N    T  S T+    S+    D  T  L++EKDEE++R+  VL KMQ Q+
Sbjct:   64 SRPKSPWGRFDPYDSFEEDREYVGFATLPNQMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHILSPEERVTQTVEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIYQFPECDPDEDEDFKQQDIELKKSIPFAVIGSNTIIEV-NGRRVRGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCIQNLTQRVVRERNRNKLTRESGTDFPIPSMPPSPDHETQRLIREKDEELRRMHEVLQKMQRQM 435          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: cbx5 (chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727])

HSP 1 Score: 390.578 bits (1002), Expect = 3.019e-129
Identity = 190/377 (50.40%), Postives = 259/377 (68.70%), Query Frame = 1
Query:  154 SSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYAT----------------------INSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVL 1218
            S  ++++     ++  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ I+ T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDV  MK LH KVNIVP+IAKAD L   E++  K ++ +++EK+ I  YQ P C SDE+D+F+ QD E++ + PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHM DLKDVT D+ YENYR Q IQ +MTR N +R+ T                      I S          D  +T  L++ KDEE++R+Q +L
Sbjct:    9 SKLLKTDEKEDQEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVAFMKALHEKVNIVPLIAKADCLIPGEIRKLKDRIREEIEKFGIKVYQFPECDSDEDDDFKQQDRELKESAPFAVIGSNTVVEA-KGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAQCIQ-QMTR-NEERHNTASRQPLMARHPQTLYKLTQDNRIESPIPILPLPTPD-AETEKLIKMKDEELRRMQEML 381          
BLAST of Septin-5 vs. Ensembl Xenopus
Match: metap1d (methionyl aminopeptidase type 1D (mitochondrial) [Source:Xenbase;Acc:XB-GENE-960806])

HSP 1 Score: 392.889 bits (1008), Expect = 5.476e-129
Identity = 187/373 (50.13%), Postives = 257/373 (68.90%), Query Frame = 1
Query:  136 SRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQ---VRMTRRNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            SRP           S + D   +GFA LP QM RK VKKGF FTLM+ GESGLGKST +NSL    +Y +    S E+ +  T +I K  +++ EKGV+LRLT+VDTPG+GD ++   CWKP+ +YID+ F QYF+DE  +NR+N+QD RVHCCLYF+SP GHG++P+D+E ++ L  KVNIVPI+ KADSLT +EL+  K+++ D+++KY I  YQ P C  DE+++F+ QD E++ ++PF+V+GSN I++  +GR++RGR Y WG+ EVEN +HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ    R+ R  N    T  S T+    S+    D  T  L++EKDEE++R+  VL KMQ Q+
Sbjct:   98 SRPKSPWGRFDPYDSFEEDREYVGFATLPNQMHRKYVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYRDRHILSPEERVTQTVEIVKQTVDIQEKGVRLRLTVVDTPGYGDAINNEICWKPVADYIDQQFEQYFRDESGLNRRNLQDTRVHCCLYFLSPLGHGMRPMDIEFLQALQDKVNIVPILGKADSLTPTELQQKKQRIRDEIDKYGIRIYQFPECDPDEDEDFKQQDIELKKSIPFAVIGSNTIIEV-NGRRVRGRMYPWGVVEVENEEHCDFIKLRTMLIRTHMQDLKDVTRETHYENYRAQCIQNLTQRVVRERNRNKLTRESGTDFPIPSMPPSPDHETQRLIREKDEELRRMHEVLQKMQRQM 469          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 406.757 bits (1044), Expect = 8.632e-135
Identity = 198/376 (52.66%), Postives = 270/376 (71.81%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +SRP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   K K+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:   83 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQM 455          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 407.142 bits (1045), Expect = 1.412e-134
Identity = 198/376 (52.66%), Postives = 270/376 (71.81%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +SRP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   K K+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:  102 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQM 474          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 402.519 bits (1033), Expect = 2.893e-134
Identity = 196/370 (52.97%), Postives = 265/370 (71.62%), Query Frame = 1
Query:  151 ASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
             +S       A +D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   K K+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:    9 GNSVPEDGTEAGDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQM 375          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept4 (septin 4 [Source:MGI Symbol;Acc:MGI:1270156])

HSP 1 Score: 410.994 bits (1055), Expect = 3.562e-130
Identity = 198/376 (52.66%), Postives = 270/376 (71.81%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +SRP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   K K+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:  595 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQM 967          
BLAST of Septin-5 vs. Ensembl Mouse
Match: Sept5 (septin 5 [Source:MGI Symbol;Acc:MGI:1195461])

HSP 1 Score: 390.578 bits (1002), Expect = 1.029e-129
Identity = 182/343 (53.06%), Postives = 250/343 (72.89%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVL 1218
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST V+SL    +Y + +  S+E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +Y+D+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDV  MK LH KVNIVP+IAKAD L  SE++  K ++ ++++K+ I+ YQ P C SDE+++F+ QD E++ + PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHM DLKDVT D+ YENYR   IQ   ++   D  + + S          D  +T  L++ KDEE++R+Q +L
Sbjct:   21 DKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERINQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVNNSECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKDRIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEA-KGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD--SRMESPIPILPLPTPD-AETEKLIRMKDEELRRMQEML 359          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|O43236|SEPT4_HUMAN (Septin-4 OS=Homo sapiens OX=9606 GN=SEPTIN4 PE=1 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 1.305e-135
Identity = 203/399 (50.88%), Postives = 279/399 (69.92%), Query Frame = 1
Query:   97 SKKEDGDDSFKFTSRPPLASST--------IRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            S+ +  D+   F +  PL+ S         +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+  N
Sbjct:   82 SRPQSSDNQQYFCAPAPLSPSARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDHKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQMKEN 477          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q4R4X5|SEPT4_MACFA (Septin-4 OS=Macaca fascicularis OX=9541 GN=SEPTIN4 PE=2 SV=1)

HSP 1 Score: 410.223 bits (1053), Expect = 5.701e-135
Identity = 198/376 (52.66%), Postives = 271/376 (72.07%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            ++RP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:  102 SARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEILHKIQKQM 474          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q5R6R7|SEPT4_PONAB (Septin-4 OS=Pongo abelii OX=9601 GN=SEPTIN4 PE=2 SV=1)

HSP 1 Score: 409.838 bits (1052), Expect = 9.354e-135
Identity = 198/376 (52.66%), Postives = 271/376 (72.07%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            ++RP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   KRK+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:  102 SARPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKRKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDLPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQKQM 474          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|P28661|SEPT4_MOUSE (Septin-4 OS=Mus musculus OX=10090 GN=Septin4 PE=1 SV=1)

HSP 1 Score: 407.142 bits (1045), Expect = 9.876e-134
Identity = 198/376 (52.66%), Postives = 270/376 (71.81%), Query Frame = 1
Query:  133 TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR-----RNNDRYATINSKTESTASSIDDIVD--TSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +SRP      +    S+++D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +   +E+ I  T +I KH ++++EKGV+LRLTIVDTPGFGD ++  ECWKP+ EYID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH +VNIVPI+AKAD+LT  E+   K K+ +++E + I  YQ P C SDE+++F+ QD  ++ ++PF+V+GSN +V++  GR++RGR Y WGI EVEN  HC+F  LRT ++RTHMQDLKDVT +  YENYR Q IQ  MTR     RN ++  T  S T+    ++    D  T  L++EKDEE++R+Q +L K+Q Q+
Sbjct:  102 SSRPRSPWGKLDPYDSSEDDKEYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYRDRKLLGAEERIMQTVEITKHAVDIEEKGVRLRLTIVDTPGFGDAVNNTECWKPVAEYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHQRVNIVPILAKADTLTPPEVDRKKCKIREEIEHFGIKIYQFPDCDSDEDEDFKLQDQALKESIPFAVIGSNTVVEA-RGRRVRGRLYPWGIVEVENPGHCDFVKLRTMLVRTHMQDLKDVTRETHYENYRAQCIQ-SMTRLVVKERNRNKL-TRESGTDFPIPAVPPGTDPETEKLIREKDEELRRMQEMLHKIQRQM 474          
BLAST of Septin-5 vs. UniProt/SwissProt
Match: sp|Q9BGQ3|SEPT5_MACFA (Septin-5 OS=Macaca fascicularis OX=9541 GN=SEPTIN5 PE=2 SV=1)

HSP 1 Score: 397.512 bits (1020), Expect = 1.910e-131
Identity = 184/350 (52.57%), Postives = 255/350 (72.86%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST V+SL    +Y + +  S+E+ I+ T +I KH ++++EKGVKL+LTIVDTPGFGD +D  ECWKPI +Y+D+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++PVDV  MK LH KVNIVP+IAKAD L  SE++  K ++ ++++K+ I+ YQ P C SDE+++F+ QD E++ + PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++RTHM DLKDVT D+ YENYR   IQ   ++   D  + + S          D  +T  L++ KDEE++R+Q +L +M+ Q+
Sbjct:   30 DKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVHSLFLTDLYKDRKLLSAEERISQTVEILKHTVDIEEKGVKLKLTIVDTPGFGDAVDNTECWKPITDYVDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPVDVGFMKALHEKVNIVPLIAKADCLVPSEIRKLKERIREEIDKFGIHVYQFPECDSDEDEDFKQQDRELKESAPFAVIGSNTVVEA-KGQRVRGRLYPWGIVEVENQAHCDFVKLRNMLIRTHMHDLKDVTCDVHYENYRAHCIQQMTSKLTQD--SRMESPIPILPLPTPD-AETEKLIRMKDEELRRMQEMLQRMKQQM 375          
BLAST of Septin-5 vs. TrEMBL
Match: S5XLH6 (Putative septin; Septin-5 OS=Schistosoma mansoni OX=6183 PE=2 SV=1)

HSP 1 Score: 478.404 bits (1230), Expect = 1.541e-159
Identity = 231/422 (54.74%), Postives = 302/422 (71.56%), Query Frame = 1
Query:   61 MQGIPRFNVSNKSK-KEDGDDS--FKFTSRPPLASSTIRSNGSAKNDEL---------------KLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKT-----ESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSV 1257
            M  IPRF VS K + K D +++   K  SR    SST    GS++ +++               +LGFANLPEQM RKAVKKGFNFTLM+VGESGLGKST +NSL  Q +Y +     + + I STT+IEK  IELDE+GVKLRLT+VDTPGFGD ++C +CWKPI +YID TF QYFKDEC +NRKNI D+RVHCCLYFISP GHG++ +DVE M+ L HKVNIVP+IAKAD+LT +EL+ FK ++M D ++Y+I+ Y+ P C SDEEDE +  D EI+A LPF+VVGSN ++D D  R+ RGRQY WG  EVENS+HC+F  LR F+L+THMQDLKD+T D+ YENYR + I  RM++R +DR   +N+       +   +  + IVD  +LL++K+EE+QR+Q ++SKMQ Q+  N +V
Sbjct:    1 MANIPRFGVSAKYRGKVDAEETNTTKSGSRYFSGSSTNSHTGSSRAEDVSRSDSVYSSNIEEDARLGFANLPEQMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFVQDLYKDREIIEANNRIQSTTQIEKRQIELDERGVKLRLTVVDTPGFGDAVNCNDCWKPIEDYIDSTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQIDVEFMRRLQHKVNIVPVIAKADALTANELRAFKERIMTDFDRYKIDIYRLPECDSDEEDEIKRLDKEIKAVLPFAVVGSNCVIDLDGSRRARGRQYPWGSVEVENSRHCDFTKLRIFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRQSDRREGVNTGALARLEKEGGTGFEAIVDQDSLLKQKEEELQRMQQLMSKMQEQLKRNTNV 422          
BLAST of Septin-5 vs. TrEMBL
Match: A0A1I8HW14 (Septin-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig006654g1 PE=3 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 3.974e-157
Identity = 232/418 (55.50%), Postives = 308/418 (73.68%), Query Frame = 1
Query:   61 MQGIPRFNVSNK--SKKEDGDDS--FKFTSRPPLASSTIRSNGSAK--------NDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDS-DSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTA-SSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISS-NGSVDNSS 1269
            M  IPRFNVS++    KED DDS   +  +R   +S T  SNG+A         N  ++LGFANLP+QM RKAVKKGFNFTLM+VGESGLGKST +NSL  Q +Y +    S  + IN TT+IEK +IELDEKGVKLRLT+VDTPGF D ++C+ECW+PI +YID TF QYFKDEC +NRKNI D+RVHCCLYFISP GHG++P+DVE M+ LH KVNIVPIIAK+D+LT +E++  K +VM DLE+++I  Y+ P   SD+++E R Q++EIRA +PF+ +GSN +V+S ++GR++RGRQY WG+ EVEN +HC+F  LR F+L THMQDLKD+T ++ YENYR + I  RMT+R   R      K+++T+ +  + +VDT  LL+EK++EI+R+Q +L  +Q+  SS  GS D S 
Sbjct:    1 MTSIPRFNVSSRYTRTKEDSDDSRNIRDINRAD-SSRTAGSNGAAASGDSTGSDNSRVQLGFANLPDQMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFQQDLYKDRELGSVTERINKTTEIEKRYIELDEKGVKLRLTVVDTPGFNDCINCQECWRPIEDYIDNTFEQYFKDECGLNRKNIIDHRVHCCLYFISPYGHGLRPIDVEFMRRLHGKVNIVPIIAKSDTLTSTEVRELKERVMGDLERHKIQIYRMPETDSDDDEETRVQESEIRACIPFAAIGSNCVVESGETGRRVRGRQYPWGVVEVENPRHCDFTKLRIFLLGTHMQDLKDITKEVHYENYRAKYITERMTKRKGPREEMETRKSKNTSDAQFEALVDTEGLLKEKEDEIRRMQQLLQHLQSNKSSQGGSADGSG 417          
BLAST of Septin-5 vs. TrEMBL
Match: A0A4Z2DFX4 (Septin-5 OS=Schistosoma japonicum OX=6182 GN=EWB00_001278 PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 2.526e-155
Identity = 231/437 (52.86%), Postives = 308/437 (70.48%), Query Frame = 1
Query:   61 MQGIPRFNVSNKSK-KEDGDDS--FKFTSR------PPLASSTIRSNGSAKNDEL---------KLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKT-----ESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVD---NSSTMSSLSKP 1293
            M  IPRF VS K + K D +++   K  SR          SS+ R++  +++D +         +LGFANLPEQM RKAVKKGFNFTLM+VGESGLGKST +NSL  Q +Y +     +   I STT+IEK  IELDE+GVKLRLT+VDTPGFGD ++C +CWKPI +YID TF QYFKDEC +NRKNI D+RVHCCLYFISP GHG++ +DVE M+ L HKVNIVP+IAKAD+LT +EL+ FK ++M D ++Y+I+ Y+ P C SDEEDE +  D EI+A LPF+V+GSN ++D D  R+ RGRQY WG  EVENS+HC+F  LR F+L+THMQDLKD+T D+ YENYR + I  RM++R +DR   + +       +   +  + IVD  +LL++K+EE+QR+Q ++SKMQ Q+  N +V    N+ + ++ S P
Sbjct:    1 MANIPRFGVSAKYRGKVDPEEASAAKVGSRYFSGSSTNSYSSSTRADDVSRSDSVYSSNIEEDARLGFANLPEQMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFVQDLYKDREVIEANSRIQSTTQIEKRQIELDERGVKLRLTVVDTPGFGDAVNCTDCWKPIEDYIDSTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQIDVEFMRRLQHKVNIVPVIAKADALTANELRAFKERIMADFDRYKIDIYRLPECDSDEEDEIKRLDKEIKAILPFAVIGSNCVIDLDGSRRARGRQYPWGSVEVENSRHCDFTKLRIFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRQSDRREGVGTGALARLEKEGGAGFEAIVDQDSLLKQKEEELQRMQQLMSKMQEQLKRNTNVTVGLNNGSSNAQSSP 437          
BLAST of Septin-5 vs. TrEMBL
Match: A0A074ZXP5 (Septin-type G domain-containing protein OS=Opisthorchis viverrini OX=6198 GN=T265_05018 PE=3 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 4.113e-155
Identity = 215/394 (54.57%), Postives = 292/394 (74.11%), Query Frame = 1
Query:  109 DGDDSFKFTSRPPLASSTIRSNG--SAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVDNSSTMSSL 1284
            D +   +  S  PLA S  RS G      ++ +LGF +LP+QM RKAVKKGFNFTLM+VGESGLGKST +NS+  Q +Y +     + + I STT+IEK  IELDE+GVKLRLT+VDTPGF D +DC +CWKPI  YID+TF QYFKDEC +NRKNI D+RVHCCLYFISP GHG++ VDVE M+ L HKVNIVPIIAKAD+LT +EL+ FK ++M D ++Y+IN Y+ P C SDEE+E +  D EI++ LPF+V+GSN +++ + G++ RGRQY WG+AEVEN +HC+F  LR F+L+THMQDLKD+T D+ YENYR + I  RM++R+ DR     ++T+      + +VD  +LL++K+EE+QR+Q ++S+MQ QI  + ++   ++ SS+
Sbjct:   98 DPNRRMRLISGDPLALSYNRSRGIPLTSEEDSRLGFGHLPDQMHRKAVKKGFNFTLMVVGESGLGKSTLINSMFMQDLYKDREVAGASERIRSTTQIEKRQIELDERGVKLRLTVVDTPGFNDAVDCTDCWKPIETYIDDTFEQYFKDECGLNRKNIHDHRVHCCLYFISPYGHGLRQVDVEFMRRLQHKVNIVPIIAKADTLTATELRAFKERIMSDFDRYKINIYRLPECDSDEEEEIKRLDKEIKSVLPFAVIGSNCVIELEGGKRARGRQYPWGVAEVENPRHCDFTKLRIFLLKTHMQDLKDMTLDVHYENYRAKYITERMSKRHTDRREVGPTRTDREG-GFEALVDQDSLLKQKEEELQRMQQMVSRMQEQIKRSAAISGGNSSSSV 490          
BLAST of Septin-5 vs. TrEMBL
Match: A0A267DF77 (Septin-type G domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028133g2 PE=3 SV=1)

HSP 1 Score: 467.618 bits (1202), Expect = 6.938e-155
Identity = 231/418 (55.26%), Postives = 306/418 (73.21%), Query Frame = 1
Query:   61 MQGIPRFNVSNK--SKKEDGDDSFKF----------TSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDS-DSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTA-SSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISS-NGSVDNSS 1269
            M  IPRFNVS++    KED DDS             T+    A+++  S GS  N  ++LGFANLP+QM RKAVKKGFNFTLM+VGESGLGKST +NSL  Q +Y +    S  + IN TT+IEK +IELDEKGVKLRLT+VDTPGF D ++C+ECW+PI +YID TF QYFKDEC +NRKNI D+RVHCCLYFISP GHG++P+DVE M+ LH KVNIVPIIAK+D+LT +E++  K +VM DLE+++I  Y+ P   SD+++E R Q++EIRA +PF+ +GSN +V+S ++GR++RGRQY WG+ EVEN +HC+F  LR F+L THMQDLKD+T +L YENYR + I  RMT+R   R      K+++T+ +  + +VDT  LL+EK++EI+R+Q +L  +Q+  SS  GS D S 
Sbjct:    1 MTSIPRFNVSSRYTRTKEDSDDSRNIRDINRADSSRTAGSNGAAASADSTGS-DNSRVQLGFANLPDQMHRKAVKKGFNFTLMVVGESGLGKSTLINSLFQQDLYKDRELGSVTERINKTTEIEKRYIELDEKGVKLRLTVVDTPGFNDCINCQECWRPIEDYIDNTFEQYFKDECGLNRKNIIDHRVHCCLYFISPYGHGLRPIDVEFMRRLHGKVNIVPIIAKSDTLTSTEVRELKERVMGDLERHKIQIYRMPETDSDDDEETRVQESEIRACIPFAAIGSNCVVESGETGRRVRGRQYPWGVVEVENPRHCDFTKLRIFLLGTHMQDLKDITKELHYENYRAKYITERMTKRKGPREEMETRKSKNTSDAQFEALVDTEGLLKEKEDEIRRMQQLLQHLQSNKSSQGGSADGSG 417          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 400.208 bits (1027), Expect = 1.737e-133
Identity = 188/358 (52.51%), Postives = 255/358 (71.23%), Query Frame = 1
Query:  166 RSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            R   + + D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNI DNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P++AKAD LT +E+K  K +V D++E++ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR   IQ   ++   D    I+S          D  +T  L++ KDEE++R+Q +L KMQ Q+
Sbjct:   18 RGRTTRQKDKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVYQFPECDSDEDEEFKQMDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQDN--RIDSPIPILPLPTPD-AETERLIKMKDEELKRMQEMLEKMQQQM 371          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 398.667 bits (1023), Expect = 5.614e-133
Identity = 187/350 (53.43%), Postives = 252/350 (72.00%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNI DNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P++AKAD LT +E+K  K +V D++E++ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR   IQ   ++   D    I+S          D  +T  L++ KDEE++R+Q +L KMQ Q+
Sbjct:   19 DKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVYQFPECDSDEDEEFKQMDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQDN--RIDSPIPILPLPTPD-AETERLIKMKDEELKRMQEMLEKMQQQM 364          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 397.127 bits (1019), Expect = 8.775e-132
Identity = 187/350 (53.43%), Postives = 252/350 (72.00%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNI DNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P++AKAD LT +E+K  K +V D++E++ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR   IQ   ++   D    I+S          D  +T  L++ KDEE++R+Q +L KMQ Q+
Sbjct:   64 DKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVYQFPECDSDEDEEFKQMDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQDN--RIDSPIPILPLPTPD-AETERLIKMKDEELKRMQEMLEKMQQQM 409          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept4a (septin-5-like [Source:NCBI gene;Acc:103047659])

HSP 1 Score: 395.201 bits (1014), Expect = 1.592e-130
Identity = 188/355 (52.96%), Postives = 259/355 (72.96%), Query Frame = 1
Query:  187 NDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRR-NNDRYATINSKTESTASSIDDIV---DTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
             D   +GFA LP Q+ RK+VKKGF FTLM+ GESGLGKST +NSL    +Y + +  ++E+ I  T +I KH I ++EKGVKL+LTIVDTPGFGD ++  E W+PIV+++++ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH KVNIVP++AKAD LT +EL + K K+ +++E++ I+ YQ P C SDE++EF+ QD E++ ++PF+VVGSNI+V+S  GR+ RGR Y WG+ EVEN  H +F  LR  ++RTHMQDLKDVT +  YENYR Q IQ +MTR    +R  ++ S    + + +  +    +T  L+ EKDEE++R+  VL ++Q Q+
Sbjct:   89 QDREYVGFATLPNQVHRKSVKKGFAFTLMVAGESGLGKSTLINSLFLTDLYKDRKMLNAEERITQTVEIIKHTIGIEEKGVKLKLTIVDTPGFGDAVNNTESWRPIVDFVEQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPYGHGLRPIDVEFMKALHEKVNIVPVLAKADCLTPAELSLKKIKIREEIERFGIHIYQFPDCDSDEDEEFKLQDQELKESIPFAVVGSNILVES-KGRRFRGRTYPWGVVEVENPAHSDFLKLRNMLVRTHMQDLKDVTRETHYENYRAQCIQ-KMTRMVVKERKRSLCSHLRESVTDLPLVPVDSETERLIWEKDEELRRMHEVLERIQEQM 441          
BLAST of Septin-5 vs. Ensembl Cavefish
Match: sept5a (septin 5 [Source:NCBI gene;Acc:103046048])

HSP 1 Score: 383.259 bits (983), Expect = 7.010e-127
Identity = 180/337 (53.41%), Postives = 242/337 (71.81%), Query Frame = 1
Query:  190 DELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQ 1200
            D+  +GFA LP Q+ RK+VKKGF+FTLM+ GESGLGKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNI DNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P++AKAD LT +E+K  K +V D++E++ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR   IQ   ++   D    I+S          D  +T  L++ KDEE++
Sbjct:   21 DKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNILDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLVAKADCLTPNEIKKLKDRVRDEIERFGIKVYQFPECDSDEDEEFKQMDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAHCIQEMTSKLAQDN--RIDSPIPILPLPTPD-AETERLIKMKDEEVR 353          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: zgc:162239 (zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28])

HSP 1 Score: 372.474 bits (955), Expect = 2.482e-123
Identity = 174/363 (47.93%), Postives = 252/363 (69.42%), Query Frame = 1
Query:  187 NDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIV---------DTSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            +D+  +GFA LP Q+ RK+VKKGF FTLM+ GESGLGKST +NSL    +Y +     ++     TT+I +  +E++EKGV+LRL++VDTPGF D +D  ECW+P+VEY++E F  YF++E  ++RKN+QD RVHCCLYFISP GHG+KP+DVE MK LH+KVNIVP+IAKAD+LT  E +  KR+V ++L +  I  YQ P C SDE+DEF+ QD E++A++PF+V+G + +V++ SGR++RGR Y WGIAEV++S+HC+   LRT ++RTHMQDLKDVT DL YE +R + I++            +   ++ +  S+ D               L++ K++E+ R+Q +L  MQ ++ + 
Sbjct:   20 HDKEYVGFATLPNQVHRKSVKKGFEFTLMVAGESGLGKSTLINSLFLTDLYHDRVLLPADGKRCDTTEILRRTLEIEEKGVRLRLSLVDTPGFADAIDNTECWQPVVEYVEEQFESYFREESGLDRKNLQDTRVHCCLYFISPYGHGLKPLDVEFMKALHNKVNIVPVIAKADTLTMRERETLKRRVQEELSENDIKIYQFPECDSDEDDEFKRQDEELKASIPFAVIGGSAVVEA-SGRRVRGRLYPWGIAEVDSSEHCDLAKLRTMLIRTHMQDLKDVTRDLHYEEHRARCIRLSCPPPALSPPPPLPRGSKLSRESVVDFPMPIMSGLAGRADALIRAKEQELARMQEMLVHMQNKVQAQ 381          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 284.648 bits (727), Expect = 9.101e-89
Identity = 138/287 (48.08%), Postives = 198/287 (68.99%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTE--PRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            +GFANLP Q+ RKA K+GF FTLM+VGESG+GKST +NS+    +Y+E  P  T     I  T K+E+  + + E+GV L LTIVDTPG+GD ++  EC +P++++ID  F  Y   E  +NR+ + D+RVH CLYFI+P+GHG+K +D+E MK LH+KVNI+P++AKAD+   +E   FK+++M D+    I  YQ      +E+++   +   I+  LP +V+GSN++VD    R   GR Y WG+AEV+N +HC+F  LR  ++RTHMQDLKDVTN++ YEN+R
Sbjct:   34 VGFANLPNQIYRKAAKRGFEFTLMVVGESGVGKSTLINSMFKTDLYSEEFPGPTKR---IQKTVKVEQSKVVIREEGVHLTLTIVDTPGYGDFINNSECVQPVIDHIDSQFEDYLNAESRVNRRPMPDSRVHACLYFIAPSGHGLKALDIEFMKRLHNKVNIIPLVAKADAFLPTECCAFKKQIMKDIHDNNIKIYQFTDTHDEEDNKLLNK---IKERLPLAVIGSNVVVDVGGRRVW-GRHYPWGVAEVDNVEHCDFTTLRRMLIRTHMQDLKDVTNNVHYENFR 313          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 266.544 bits (680), Expect = 2.903e-83
Identity = 141/333 (42.34%), Postives = 211/333 (63.36%), Query Frame = 1
Query:   70 IPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKN-IQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSD---SGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            +PR      + +  G D     +RPP   + ++ N  A      +G   + EQM+RKA+K+GF F +M+VG+SGLGKST VN+L    +  +    + E+ I  T +I+     ++EKGVK++LT++DTPGFGD ++   CW+P+++YI++ + +Y  +E  I RK  I D+RVHCC+YFI  TGH ++ +D+E MK L   VNIVP+IAK+D+LT  E + FK+K+ + LE   I+ Y  P    DE++E R+ + +IR  +PF+VVGS    D D   +GRK  GR+  WGI E+EN  HC F+ LR  ++R+H QDLK+VT+ + YE YR
Sbjct:   11 VPRAEPEEMTTETPGQDGG--VARPP---TRVKPNLDAFG---YVGIDAVLEQMRRKAMKQGFEFNIMVVGQSGLGKSTLVNTLFKSPVSRKSCTPNHEEKIPKTVEIKSVSHVIEEKGVKMKLTVIDTPGFGDQINNNNCWEPVLKYINDQYEKYLAEEVNITRKKVIPDSRVHCCIYFIPATGHSLRLLDIEFMKRLGKVVNIVPVIAKSDTLTLEERQAFKKKIREQLETQGISIY--PHKEHDEDEEDRSVNNKIRELMPFAVVGS----DKDYLVNGRKTLGRKTKWGIIEIENVAHCEFSQLRELLIRSHTQDLKEVTSCVHYEGYR 329          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN9 (septin 9 [Source:HGNC Symbol;Acc:HGNC:7323])

HSP 1 Score: 243.817 bits (621), Expect = 2.677e-75
Identity = 114/260 (43.85%), Postives = 179/260 (68.85%), Query Frame = 1
Query:  280 GESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRK-NIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            G+SGLGKST VN+L    +  +    + ++ I  T +I+     ++E+GVK++LT++DTPGFGD ++   CW+PI++YI E + +Y ++E  I RK +I D RVHCC+Y I P+GH ++P+DVE M+ L   V++VP+I KAD+LT  E  +F++++  DL  + I+ Y  P    DE+++ R ++AE+R  +PF+VVGS+     ++GR++ GR+  WG+ EVEN  HC F +LR  ++R+HM+DLKDVT+ +LYE YR
Sbjct:    1 GQSGLGKSTLVNTLFKSRVSRKSCTPNYQERILKTVEIQSVSHVIEERGVKMKLTVIDTPGFGDQINNENCWEPILKYIGEQYEKYLREEVRITRKRHIPDTRVHCCIYCIPPSGHSLRPLDVEFMQHLSKVVSVVPVITKADTLTLEERHLFRQRIQADLVAHGIDVY--PQREFDEDEQGRLENAEVREKIPFAVVGSDREY-QENGRRVLGRKTRWGLVEVENINHCEFALLRDLLIRSHMEDLKDVTHSILYETYR 257          
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Match: SEPTIN7 (septin 7 [Source:HGNC Symbol;Acc:HGNC:1717])

HSP 1 Score: 221.861 bits (564), Expect = 6.351e-68
Identity = 104/204 (50.98%), Postives = 142/204 (69.61%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEE 813
            +GFANLP Q+ RK+VK+GF FTLM+VGESGLGKST +NSL    +Y       S+  +  T ++E+  + L E GV+L LTIVDTPGFGD +D   CW+ I++YID     Y   E  +NR+ + D+RVHCCLYFI P+GH +KP+D+E MK LH KVNI+P+IAKADSLT  E + FK+ +M ++ +++I  Y+ P    D+E
Sbjct:   17 VGFANLPNQVYRKSVKRGFEFTLMVVGESGLGKSTLINSLFLTDLYASEYPGPSQ-RVRKTLQVEQSKVVLKEGGVQLTLTIVDTPGFGDAVDNSSCWQSIIDYIDSKCEDYLNAEARVNRRLMPDSRVHCCLYFIFPSGHQLKPLDIEFMKRLHDKVNIIPLIAKADSLTTEECQQFKKTIMKEILEHKIKIYEFPDVEDDDE 219          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC3 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble with other septins into rod-like complexes that can associate with other rods to form filament polymers; septin rings at the mother-bud neck act as scaffolds for recruiting factors needed for cell division and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000004306])

HSP 1 Score: 249.98 bits (637), Expect = 6.884e-75
Identity = 120/307 (39.09%), Postives = 193/307 (62.87%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQS-IYTEPRDTSSEDMINST--------------------TKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDC-RECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            +GFANLP+Q  R+++K GF+F L+ VG  G+GK+T + +L N   I         E++ N                       KI+ +   ++E GVKL L ++DT GFGD L+  ++ W PI++ ID  F QY   E  INR +I D R+H CLYFI PTGH +KP+D++ M++++ K N++P+IAK+D LT+ E+  FK+ +M+ L +  I  ++PPI  +D+ +     +  + ++LP++V+GSN IV++ SG ++RGR Y WG+ EV+N  H +FN+L+  +++  M++LK+ T+ +LYENYR
Sbjct:  100 VGFANLPKQWHRRSIKNGFSFNLLCVGPDGIGKTTLMKTLFNNDDIEANLVKDYEEELANDQEEEEGQGEGHENQSQEQRHKVKIKSYESVIEENGVKLNLNVIDTEGFGDFLNNDQKSWDPIIKEIDSRFDQYLDAENKINRHSINDKRIHACLYFIEPTGHYLKPLDLKFMQSVYEKCNLIPVIAKSDILTDEEILSFKKTIMNQLIQSNIELFKPPIYSNDDAENSHLSE-RLFSSLPYAVIGSNDIVENYSGNQVRGRSYPWGVIEVDNDNHSDFNLLKNLLIKQFMEELKERTSKILYENYR 405          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC11 (Component of the septin ring that is required for cytokinesis; present at the ends of rod-like septin hetero-oligomers; C-terminal extension is important for recruitment of Bni5p to the mother-bud neck, which in turn is required for Myo1p recruitment and cytokinesis; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000003837])

HSP 1 Score: 232.646 bits (592), Expect = 9.650e-70
Identity = 123/294 (41.84%), Postives = 191/294 (64.97%), Query Frame = 1
Query:  232 QRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTE------PRDTSSE-DMINSTTKIEKHFIEL-DEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRK-NIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAE----IRAALPFSVVGSNIIVD--SDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQII 1068
            +RK +K+G  FT+MIVG+SG G+STF+N+L  Q +         P DTS+E D+     ++ +  +EL D++GVK++L I+DTPGFGD LD    ++ I +YI   + +   +E  + R    +D RVHCCLY I+PTGHG+K +DVE ++ L   VNI+P+I+K+DSLT  ELK+ K+ +M+D++++ +  Y  P     +EDE   +D E    +R  LPF+++GSN + +   D G  +RGR+Y WGI +VE+S   +F ILR  +L +H+ DLK+ T+++LYE YR + +
Sbjct:   13 KRKHLKRGITFTVMIVGQSGSGRSTFINTLCGQQVVDTSTTILLPTDTSTEIDL-----QLREETVELEDDEGVKIQLNIIDTPGFGDSLDNSPSFEIISDYIRHQYDEILLEESRVRRNPRFKDGRVHCCLYLINPTGHGLKEIDVEFIRQLGSLVNIIPVISKSDSLTRDELKLNKKLIMEDIDRWNLPIYNFPF----DEDEISDEDYETNMYLRTLLPFAIIGSNEVYEMGGDVG-TIRGRKYPWGILDVEDSSISDFVILRNALLISHLHDLKNYTHEILYERYRTEAL 296          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC12 (Component of the septin ring that is required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate with other rods to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells [Source:SGD;Acc:S000001149])

HSP 1 Score: 221.09 bits (562), Expect = 1.946e-65
Identity = 113/293 (38.57%), Postives = 174/293 (59.39%), Query Frame = 1
Query:  205 GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRA---------ALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            G +NLP Q  +   ++G  FT+M+ GESGLGK+TF+N+L    +         ++ I  T +I+     L+EK  +LR+ ++DTPGFGD ++  + W+P+V++ID+    Y + E    R    D RVH  LYFI PTGHG+KP+D+E MK L  + N++P+IAKAD+LT  EL+ FK ++   +E  +I  + PP+    +ED     + +  A         A+PF++VGS    D+  G ++  R+Y WG+ E+EN  HC+F  LR  +LRT++ DL   T ++ YE YR
Sbjct:   16 GISNLPNQRYKIVNEEGGTFTVMLCGESGLGKTTFINTLFQTVLKRADGQQHRQEPIRKTVEIDITRALLEEKHFELRVNVIDTPGFGDNVNNNKAWQPLVDFIDDQHDSYMRQEQQPYRTKKFDLRVHAVLYFIRPTGHGLKPIDIETMKRLSTRANLIPVIAKADTLTAQELQQFKSRIRQVIEAQEIRIFTPPLDADSKEDAKSGSNPDSAAVEHARQLIEAMPFAIVGSEKKFDNGQGTQVVARKYPWGLVEIENDSHCDFRKLRALLLRTYLLDLISTTQEMHYETYR 308          
BLAST of Septin-5 vs. Ensembl Yeast
Match: CDC10 (Component of the septin ring, required for cytokinesis; septins are GTP-binding proteins that assemble into rod-like hetero-oligomers that can associate to form filaments; septin rings at the mother-bud neck act as scaffolds for recruiting cell division factors and as barriers to prevent diffusion of specific proteins between mother and daughter cells; N-terminus interacts with phosphatidylinositol-4,5-bisphosphate; protein abundance increases under DNA damage stress [Source:SGD;Acc:S000000595])

HSP 1 Score: 204.912 bits (520), Expect = 1.992e-60
Identity = 110/295 (37.29%), Postives = 172/295 (58.31%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLL-NQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKN-IQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRG-QIIQVR 1077
            +GF  +  Q++ + +KKGF F +M+VG+SGLGKST +N+L  +  I +   D  S   +  TT+++     L E  V+L + ++DTPGFGD +D  + W+PIV+YI E   QY + E    R+  I D RVH  LYF+ P G  +  +DVE +K L    N++P+I K+D+LT  E   F+  + ++ EKY    Y  P    +  DE    +  +R+ +PF+VVGS   ++ + G   RGR+  W    VE+   C+F  LR F++RTH+QDL + T+ + YE +R  Q+I ++
Sbjct:   13 VGFDTITNQIEHRLLKKGFQFNIMVVGQSGLGKSTLINTLFASHLIDSATGDDISALPVTKTTEMKISTHTLVEDRVRLNINVIDTPGFGDFIDNSKAWEPIVKYIKEQHSQYLRKELTAQRERFITDTRVHAILYFLQPNGKELSRLDVEALKRLTEIANVIPVIGKSDTLTLDERTEFRELIQNEFEKYNFKIY--PYDSEELTDEELELNRSVRSIIPFAVVGSENEIEIN-GETFRGRKTRWSAINVEDINQCDFVYLREFLIRTHLQDLIETTSYIHYEGFRARQLIALK 304          
BLAST of Septin-5 vs. Ensembl Yeast
Match: SPR3 (Sporulation-specific homolog of the CDC3/10/11/12 family of genes; septin protein involved in sporulation; regulated by ABFI; the yeast CDC3/10/11/12 family is a family of bud neck microfilament genes [Source:SGD;Acc:S000003291])

HSP 1 Score: 209.149 bits (531), Expect = 5.484e-60
Identity = 113/298 (37.92%), Postives = 170/298 (57.05%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPIC---GSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTR 1086
            +G  NLP Q +    K G +FTLM+ G+SGLGK+TF+NSL + S+         +D I     I ++   ++  G  L   ++DTPGFG+ +D    W+ +V YIDE    Y   E   +R  + DNRVHCCLYF+ P+  GI  +DV  MK L  +VN++P+IAK+D LT+ ELK FK +V + +    I     P+C   G    DE      +I    PFS++ SN  + ++ G K++GRQY WG  ++EN K+C+F IL+  I   ++ DL + T D  YE  R ++++ R+ +
Sbjct:   90 IGIKNLPRQRELLNAKNGIDFTLMVAGQSGLGKTTFINSLFSTSLI--------DDDIKENKPIIRYKSIVEGDGTHLNFNVIDTPGFGNNMDNAFTWRTMVNYIDEEIRSYIFQEEQPDRTKMVDNRVHCCLYFLRPSNKGIDTLDVVTMKKLAKRVNLIPVIAKSDLLTKEELKNFKTQVREIIRVQDI-----PVCFFFG----DEVLNATQDIFQKYPFSIIASNEYIFNEKGEKVKGRQYKWGAVDIENEKYCDFKILQKTIFDWNLIDLVESTED-YYEKCRSEMLRTRLLK 369          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO47409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RLX3])

HSP 1 Score: 387.882 bits (995), Expect = 2.453e-129
Identity = 187/366 (51.09%), Postives = 255/366 (69.67%), Query Frame = 1
Query:  175 GSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTS---NLLQEKDEEIQRIQAVLSKMQTQISSNGSVDN 1263
              +KN+   +GFANLP Q+ RK+VKKGF FTLM+VGESGLGKST ++SL    +Y +     ++  I  T  IE + +E++EKGV+LRLT+VDTPGF D +D    W+PIV+YID  F  Y +DE  +NR+NI D RVHCCLYFI+P GHG++PVDVE MK LH KVNIVP+IAK+DSLT++E+   KRKV+D++  ++I  Y  P C S++++EF A + +++A+LPF+V+GSN +++   GRK+R R Y WG AEVEN  HC+F  LR  ++RTHMQDLKDVT D+ YENYR Q +  +  + N     T NSK   T  S D +VD S    +LQEK+ E++R+Q +L+KMQ +I       N
Sbjct:    9 AESKNNVAYVGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYDDKSIPPAKGRIGQTVHIESNTVEIEEKGVRLRLTVVDTPGFADAVDNTYSWEPIVDYIDHQFESYLRDESGLNRRNIMDTRVHCCLYFINPHGHGLRPVDVEFMKALHTKVNIVPVIAKSDSLTKTEISRLKRKVLDEIADHEIKIYSFPECDSEDDEEFLAINKDLKASLPFAVIGSNTVIEV-KGRKVRARWYPWGYAEVENPDHCDFIKLRNMLVRTHMQDLKDVTQDVHYENYRAQRLLDQTGKAN-----TKNSK--KTTGSYDQVVDISEKDKMLQEKEAELRRMQEMLAKMQQEIHQQKKASN 366          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO33106 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST61])

HSP 1 Score: 327.02 bits (837), Expect = 4.090e-107
Identity = 144/265 (54.34%), Postives = 203/265 (76.60%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFIL 996
            +GFANLP Q+ RK+VKKGF FTLM+VGESGLGKST ++SL    +Y++ +  S+E+ I  T KIE   +E++E+GVKLRLT+VDTPG+GDG++ +  +KPI++Y +  F  Y KDE  +NR++I D+RVHCC YFI+PTGHG+KP+D+E MK LHH VNIVP+I KAD+LT +ELK  KR+V+D++++Y I  Y+ P C SDE++EF  Q  +++  +PF+VVGSN ++D   G+K+RGR Y WG+ EVEN  HC+F+ LR  ++
Sbjct:    5 VGFANLPNQVHRKSVKKGFEFTLMVVGESGLGKSTLIDSLFLTDLYSDRKILSAEERIKKTVKIETSTVEIEERGVKLRLTVVDTPGYGDGINHKNSFKPILDYANNQFESYLKDESGLNRRHIIDSRVHCCFYFIAPTGHGLKPLDIEFMKALHHIVNIVPVIGKADTLTPTELKEMKRRVLDEIDEYGIQIYELPQCDSDEDEEFIEQTRQLKEGMPFAVVGSNTLIDV-CGKKVRGRLYPWGVVEVENPIHCDFSKLRAMLM 268          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO34522 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SP25])

HSP 1 Score: 328.946 bits (842), Expect = 1.256e-105
Identity = 150/285 (52.63%), Postives = 208/285 (72.98%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            +GFANLP Q+ RK+VKKGF FT+M+VGESGLGKST +NSL    +YT     S ++ +N T +++   +EL E GV+LRLT+VDTPGFGD +D  +CWKP+++YID  F ++   E  + R    DNRVHCCLYFISPTGH +KP+D+E MK LH+KVNIVP+I+KAD+LT  E   FK++++ ++++  I+ Y+ P  G +E+ E  A    +R  +PF+VVGSN +++ + G+++R R Y WG+ EVEN +HC+F  LR  ++RTHMQDLKDVTND  YENYR
Sbjct:    5 VGFANLPNQVFRKSVKKGFEFTVMVVGESGLGKSTLLNSLFLTDLYTPSSYPSIKEKLNKTVEVKPCTVELKEGGVRLRLTVVDTPGFGDAVDNTDCWKPVIKYIDSKFEEHLNAESRVQRSPFPDNRVHCCLYFISPTGHSLKPLDIEFMKKLHNKVNIVPVISKADTLTTEECTRFKKQILQEIKENNISIYEFPDLGGEEDAELDA--VNMRDKVPFAVVGSNTVLEVN-GKRVRARVYPWGVVEVENVEHCDFVALRNMLIRTHMQDLKDVTNDAHYENYR 286          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO37950 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE59])

HSP 1 Score: 228.409 bits (581), Expect = 3.357e-68
Identity = 122/290 (42.07%), Postives = 178/290 (61.38%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRK--NIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQ-DAEIRAALPFSVVGS--NIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            +GF +LP+Q+  K+V +GF F ++ +GE+G+GKST +++L   +   +P             +IE H  +L+E  V L+LTIVDT G+GD ++  +    IV YID+ F  Y   E  I R      D R+H CLYFISPTGH +K +D+  MK L  KVNI+PIIAKAD++ +SELK FK+K+MD+LE   +  Y+ P+     +DE  A+ ++ +   +PF+VVGS   ++V+     K R R Y WG  EVEN  HC+F  LR  ++RT+MQ L D T+ + YE +R
Sbjct:   25 VGFDSLPDQLVNKSVNRGFAFNILCIGETGIGKSTLMDTLFQTTFEGQPHSHHL-----PGVQIEHHTYDLNESNVMLKLTIVDTVGYGDQINKEDSSSSIVNYIDQQFDTYLHQELKIKRTMDTFHDTRIHACLYFISPTGHSLKSLDLVCMKQLDKKVNIIPIIAKADTIAKSELKQFKQKIMDELESNGVEIYRFPV-----DDETVAEMNSTMNNEIPFAVVGSREEVMVNKT---KSRARVYPWGTVEVENENHCDFVKLREMLIRTNMQSLIDKTHTVHYELFR 301          
BLAST of Septin-5 vs. Ensembl Nematostella
Match: EDO47975 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKG1])

HSP 1 Score: 201.83 bits (512), Expect = 1.461e-60
Identity = 94/197 (47.72%), Postives = 139/197 (70.56%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRK-NIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQP 789
            +GF  + EQ++RK++K+GF F LM+VG SGLGKST VN+L    + + P  T    +I  T  ++     ++EKGV+L+LTI DTPGFGD ++  +CW+PI++YI+  + ++  +E  I RK  I D+RVHCCLYFI+PTGH +KP+DVE MK L   VNIVP+IAKAD++T  E + F+R++ +D++ + IN + P
Sbjct:    3 VGFDTVQEQIRRKSLKRGFEFNLMVVGASGLGKSTMVNTLFKGKL-SRPTSTGKPTIIPKTVDVKSVSHVIEEKGVRLKLTITDTPGFGDQINNDKCWEPIMDYINSQYDKFLTEEVTIERKPRIPDSRVHCCLYFIAPTGHRLKPIDVEFMKRLDKCVNIVPVIAKADNMTLEEREAFRRRLREDIQAHNINIHYP 198          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 398.282 bits (1022), Expect = 7.009e-133
Identity = 190/373 (50.94%), Postives = 265/373 (71.05%), Query Frame = 1
Query:  121 SFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            + ++ SR P+ +        +  ++  +GFA LP Q+ RK+VKKGF+FTLM+ GESG+GKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P+IAKAD LT +E+K  K ++ ++++K+ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR Q IQ   ++   D    + S       S  D V+T  L++ KDEE++R+Q +L+KMQ Q+
Sbjct:    4 NIRYKSRIPVKTE------DSTEEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVYQFPECDSDEDEEFKQLDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQDN--RMESPIPILPLSTPD-VETEKLIKMKDEELKRMQEMLNKMQQQM 366          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 397.512 bits (1020), Expect = 1.085e-132
Identity = 187/346 (54.05%), Postives = 254/346 (73.41%), Query Frame = 1
Query:  202 LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            +GFA LP Q+ RK+VKKGF+FTLM+ GESG+GKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P+IAKAD LT +E+K  K ++ ++++K+ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR Q IQ   ++   D    + S       S  D V+T  L++ KDEE++R+Q +L+KMQ Q+
Sbjct:   11 VGFATLPNQVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVYQFPECDSDEDEEFKQLDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQDN--RMESPIPILPLSTPD-VETEKLIKMKDEELKRMQEMLNKMQQQM 352          
BLAST of Septin-5 vs. Ensembl Medaka
Match: sept5a (septin 5 [Source:NCBI gene;Acc:101158828])

HSP 1 Score: 397.897 bits (1021), Expect = 2.589e-131
Identity = 188/358 (52.51%), Postives = 259/358 (72.35%), Query Frame = 1
Query:  166 RSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            R   + + ++  +GFA LP Q+ RK+VKKGF+FTLM+ GESG+GKST VNSL    +Y + +  ++E+ IN T +I KH ++++EKGVKL+LTIVDTPGFGD ++  ECWKPI +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFI P GHG++PVDVE MK LH KVNI+P+IAKAD LT +E+K  K ++ ++++K+ I  YQ P C SDE++EF+  D E++   PF+V+GSN +V++  G+++RGR Y WGI EVEN  HC+F  LR  ++R+HM DLKDVT D+ YENYR Q IQ   ++   D    + S       S  D V+T  L++ KDEE++R+Q +L+KMQ Q+
Sbjct:  104 RVRTARQKEKQYVGFATLPNQVHRKSVKKGFDFTLMVAGESGMGKSTLVNSLFLTDLYKDRKLLNAEERINQTVEIIKHTVDIEEKGVKLKLTIVDTPGFGDAVNNNECWKPITDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFIPPFGHGLRPVDVEFMKALHEKVNIIPLIAKADCLTPNEIKKLKDRIREEIDKFGIKVYQFPECDSDEDEEFKQLDKELKECTPFAVIGSNTVVEA-RGQRVRGRLYPWGIVEVENQSHCDFVKLRNMLIRSHMHDLKDVTCDVHYENYRAQCIQEMTSKLAQDN--RMESPIPILPLSTPD-VETEKLIKMKDEELKRMQEMLNKMQQQM 457          
BLAST of Septin-5 vs. Ensembl Medaka
Match: ENSORLT00000001335.2 (septin-5 [Source:NCBI gene;Acc:101166318])

HSP 1 Score: 377.096 bits (967), Expect = 1.427e-124
Identity = 179/361 (49.58%), Postives = 249/361 (68.98%), Query Frame = 1
Query:  121 SFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQR 1203
            S ++ SR P        +G    D+  +GFA LP Q+ RK+VKKGF+FTL++ GE+GLGKST VNSL    +Y E +  ++E+ I  T +I K  ++++EKGVKL+LTIVDTPG GD ++  +CW+P+ +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP G G++P+DVE MK L  K N+VP+IAKAD LT  E+K  K +V ++++KY I  YQ P C SDE++E + QD E++ ++PF+V+G N +++   G+++RGR Y WG+ EVEN  HC+F  LR  ++RTHM DLKD TNDL YENYR Q IQ   ++ N D+   + S       S  D  +T  L++ KDEE++R
Sbjct:    4 SSRYRSRAP-------RSGKHPPDKEYVGFATLPNQLHRKSVKKGFDFTLLVAGEAGLGKSTLVNSLFLTDLYKERKLLNAEERIKQTVEITKRTVDIEEKGVKLKLTIVDTPGVGDAVNNTQCWRPVTDYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGQGLRPIDVEFMKALQDKANVVPVIAKADCLTPLEIKKLKERVREEIDKYGIKIYQFPDCDSDEDEESKQQDRELKESIPFAVIGGNTVIEV-RGQRVRGRLYPWGVVEVENPSHCDFVKLRNMLIRTHMHDLKDTTNDLHYENYRAQAIQNMTSKMNADK--RVESPIPILPLSTPD-AETEKLIKMKDEELRR 353          
BLAST of Septin-5 vs. Ensembl Medaka
Match: ENSORLT00000009841.2 (septin-4 [Source:NCBI gene;Acc:101169222])

HSP 1 Score: 363.614 bits (932), Expect = 5.519e-120
Identity = 170/328 (51.83%), Postives = 236/328 (71.95%), Query Frame = 1
Query:  271 MIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQ--VRMTRRNNDRYATINSKTESTASSIDDIV---DTSNLLQEKDEEIQRIQAVLSKMQTQI 1239
            M+ GESGLGKST VNSL    +Y + +  ++E+ I  T +I KH ++++EKGVKL+LTIVDTPGFGD +D  ECWK + +YID+ F QYF+DE  +NRKNIQDNRVHCCLYFISP GHG++P+DVE MK LH KVNIVP++AKAD+LT +E++  K K+ +++E+Y I  YQ P C SDE++EF+ QD E++ ++PF+V+GSN +V++  G+++RGR Y WGI EVENS HC+F  LR  ++RTHMQDLKDVT +  YENYR Q IQ   RM  +  +R              +   V   +T  L++EKDEE++++Q +L ++Q  +
Sbjct:    1 MVAGESGLGKSTLVNSLFLTDLYKDRKLLNAEERITQTVEITKHTVDIEEKGVKLKLTIVDTPGFGDAIDNTECWKSVADYIDQQFEQYFRDESGLNRKNIQDNRVHCCLYFISPFGHGLRPLDVEFMKALHEKVNIVPVLAKADTLTPTEVQKKKIKIREEIEQYGIKIYQFPDCDSDEDEEFKQQDLELKESIPFAVIGSNTVVEA-KGKRVRGRLYPWGIVEVENSAHCDFVKLRNMLVRTHMQDLKDVTRETHYENYRAQCIQSMTRMVVKERNRNKLTRESGTDFPIPMGPAVSESETEKLIREKDEELRQMQEMLQRIQDHL 327          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000076922.1 (SMESG000076922.1)

HSP 1 Score: 862.062 bits (2226), Expect = 0.000e+0
Identity = 426/427 (99.77%), Postives = 427/427 (100.00%), Query Frame = 1
Query:   61 MQGIPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVDNSSTMSSLSKPXXXXXXXXXXXXQTMP 1341
            MQGIPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRD+SSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVDNSSTMSSLSKPSAINNISILSASQTMP
Sbjct:    1 MQGIPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDSSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVDNSSTMSSLSKPSAINNISILSASQTMP 427          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000048968.1 (SMESG000048968.1)

HSP 1 Score: 437.573 bits (1124), Expect = 1.136e-147
Identity = 219/416 (52.64%), Postives = 294/416 (70.67%), Query Frame = 1
Query:   61 MQGIPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELK-LGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDEEDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYATINSKTESTASSID-------------------DIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSN 1248
            M   P+FN+ NKS K    DS    +  P + ST +     K+D L+ LGF  +P+QM RKAVKKGFNF++M+VGESGLGKSTFVNSLL   +Y +     + + I  TTKI K FIELDEKGVKLRLTI+DTPGF D ++C  CWKPI +YI++TF QYFK+EC +NRKNIQDNR+HCCLYF++P G G+KP+DVE++K L  K+NI+P+I KADSLT  ELK  K+K+++D+E+YQ++ Y+ P C SDEE   R  D+EI+A LPFS++GS  I+D+  G K+RGRQYIWG +EVEN+KHC+F+ LR F+L+THMQDLKD+T+D+LYENYR   I  R+ RR+N+R  T  S    T+++ D                    IVD+ N    K+EEIQR++ +  K+++Q+ S+
Sbjct:    1 MATTPKFNIINKSFK----DSDANCNSNPNSVSTPK----IKHDGLQSLGFGQIPDQMHRKAVKKGFNFSIMVVGESGLGKSTFVNSLLMTDLYKDREILPAFESIAVTTKIVKRFIELDEKGVKLRLTIIDTPGFNDAVNCYNCWKPIEDYINDTFDQYFKEECGLNRKNIQDNRIHCCLYFVNPFGRGLKPLDVEVIKRLQCKINIIPVIGKADSLTADELKKLKQKILNDIERYQLDVYRLPECESDEEASIRTLDSEIKACLPFSIIGSPDIIDNTRGPKIRGRQYIWGTSEVENNKHCDFSRLRLFLLKTHMQDLKDMTSDVLYENYRANCITERIHRRHNERQTTGASDDTGTSNNTDRISDHFGDTKQEIIDPGFEAIVDSEN-FHHKEEEIQRMRVLCEKLESQLKSS 407          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 279.256 bits (713), Expect = 1.492e-85
Identity = 141/304 (46.38%), Postives = 196/304 (64.47%), Query Frame = 1
Query:  160 TIRSNGSAKNDELKLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIY-TEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICG---SDEEDEFRAQD-AEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            ++ SN    +   K+GF +L +Q+ ++A +KGF F LM+VG SGLGKSTF+NSLL    Y TE    S    I  T  IE   + L E  V L+L +VDTPGFGD +D   CW PI+EYID  F ++  +E  +NR    D R+H C+YFI PTGH +KP+DVE MK +H KVNI+P+I K+D++T  E + FK+ V++ L  ++I  Y  P  G   S  +++    D  + R  +PFSV+GSNI +D + G+K+RGR+Y WG  EVEN++H +F  L+  I+RTH+ DLKDVT+  LYE YR
Sbjct:   61 SVYSNNKKLDVLYKIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKR--IKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKN-GKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR 361          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000064397.1 (SMESG000064397.1)

HSP 1 Score: 278.485 bits (711), Expect = 2.255e-85
Identity = 139/291 (47.77%), Postives = 191/291 (65.64%), Query Frame = 1
Query:  199 KLGFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIY-TEPRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICG---SDEEDEFRAQD-AEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            K+GF +L +Q+ ++A +KGF F LM+VG SGLGKSTF+NSLL    Y TE    S    I  T  IE   + L E  V L+L +VDTPGFGD +D   CW PI+EYID  F ++  +E  +NR    D R+H C+YFI PTGH +KP+DVE MK +H KVNI+P+I K+D++T  E + FK+ V++ L  ++I  Y  P  G   S  +++    D  + R  +PFSV+GSNI +D + G+K+RGR+Y WG  EVEN++H +F  L+  I+RTH+ DLKDVT+  LYE YR
Sbjct:   59 KIGFGSLTDQVYKRAFRKGFEFNLMVVGCSGLGKSTFINSLLMSDFYNTEYLGPSKR--IKKTVYIEPTTVILKENDVALKLCLVDTPGFGDAVDNSACWDPIIEYIDNRFDEHIDNENKVNRLIFPDKRIHACIYFIQPTGHNLKPLDVEFMKRIHEKVNIIPVIGKSDTMTPEECRDFKKNVLNQLTFHKIKIYDFPESGAAYSASDNDGEVMDLKKCREKIPFSVIGSNIFIDKN-GKKIRGRRYPWGDVEVENAEHNDFVFLKYMIMRTHLLDLKDVTSQQLYEKYR 346          
BLAST of Septin-5 vs. Planmine SMEST
Match: SMESG000016474.1 (SMESG000016474.1)

HSP 1 Score: 264.618 bits (675), Expect = 6.855e-80
Identity = 134/312 (42.95%), Postives = 195/312 (62.50%), Query Frame = 1
Query:  175 GSAKNDELKL----GFANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTE-----PRDTSSEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVEYIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKTLHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGS--------DEEDEFRAQDAEI-RAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSKHCNFNILRTFILRTHMQDLKDVTNDLLYENYR 1056
            G+  N +++L    GF NLP+Q+ R+++  GF F LM+VG SGLGKSTFVN+L    +Y        + T     IN+TT      + + E  V L+LT++DTPGFGD +D  ECW P+++YI+  + +Y   +  ++R  I DNRVH CLYFI PTGHG+K +D+E MK +H KVNI+PIIAKAD+L   E   FK+ +++ ++   I  Y  P   +         +  E   +D  I R   PF+VV SNI+++   G K+RGR Y WG+ EV+N +H +F+ LRT +L +H+QD+KD T+ +L+ENYR
Sbjct:   71 GNIDNSKMRLVKNIGFENLPDQIYRRSLFNGFEFNLMVVGCSGLGKSTFVNTLFLSELYNNENLPPTKRTQKTVHINTTT------VNITENSVSLKLTLIDTPGFGDSVDNSECWNPVLKYIESKYTEYMHAQNRVHRNRIVDNRVHACLYFIEPTGHGLKQLDLEFMKRIHTKVNIIPIIAKADTLIPEECAEFKKTILNQIKTNGIKIYDFPEEAAAISLGVTVAKARETNWKDITIKRKRQPFAVVCSNIVIEK-GGNKVRGRTYPWGLVEVDNLEHNDFSALRTLLLSSHLQDIKDTTDQVLFENYR 375          
The following BLAST results are available for this feature:
BLAST of Septin-5 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SEPTIN48.779e-13750.88septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN48.779e-13750.88septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN41.558e-13650.88septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN41.558e-13650.88septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
SEPTIN42.458e-13654.27septin 4 [Source:HGNC Symbol;Acc:HGNC:9165][more]
back to top
BLAST of Septin-5 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
unc-596.705e-8742.33pep chromosome:WBcel235:I:13629227:13633494:1 gene... [more]
unc-611.291e-6738.49pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-611.650e-6738.49pep chromosome:WBcel235:V:14731095:14733877:-1 gen... [more]
unc-613.862e-6738.49pep chromosome:WBcel235:V:14731136:14734237:-1 gen... [more]
back to top
BLAST of Septin-5 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sep44.825e-12450.29gene:FBgn0259923 transcript:FBtr0074371[more]
Sep48.575e-12448.79gene:FBgn0259923 transcript:FBtr0074368[more]
Sep48.575e-12448.79gene:FBgn0259923 transcript:FBtr0074366[more]
Sep48.575e-12448.79gene:FBgn0259923 transcript:FBtr0074365[more]
Sep48.575e-12448.79gene:FBgn0259923 transcript:FBtr0074369[more]
back to top
BLAST of Septin-5 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept4a7.880e-13353.17septin 4a [Source:ZFIN;Acc:ZDB-GENE-051120-87][more]
sept5a2.679e-13252.49septin 5a [Source:ZFIN;Acc:ZDB-GENE-030131-7868][more]
sept5b1.862e-12850.81septin 5b [Source:ZFIN;Acc:ZDB-GENE-040808-43][more]
BX640522.11.176e-12451.90septin 4b [Source:NCBI gene;Acc:100003446][more]
sept27.012e-11245.82septin 2 [Source:ZFIN;Acc:ZDB-GENE-030131-911][more]
back to top
BLAST of Septin-5 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cbx53.231e-13154.60chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727][more]
cbx53.714e-13054.28chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727][more]
metap1d1.203e-12950.13methionyl aminopeptidase type 1D (mitochondrial) [... [more]
cbx53.019e-12950.40chromobox 5 [Source:Xenbase;Acc:XB-GENE-972727][more]
metap1d5.476e-12950.13methionyl aminopeptidase type 1D (mitochondrial) [... [more]
back to top
BLAST of Septin-5 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Sept48.632e-13552.66septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept41.412e-13452.66septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept42.893e-13452.97septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept43.562e-13052.66septin 4 [Source:MGI Symbol;Acc:MGI:1270156][more]
Sept51.029e-12953.06septin 5 [Source:MGI Symbol;Acc:MGI:1195461][more]
back to top
BLAST of Septin-5 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O43236|SEPT4_HUMAN1.305e-13550.88Septin-4 OS=Homo sapiens OX=9606 GN=SEPTIN4 PE=1 S... [more]
sp|Q4R4X5|SEPT4_MACFA5.701e-13552.66Septin-4 OS=Macaca fascicularis OX=9541 GN=SEPTIN4... [more]
sp|Q5R6R7|SEPT4_PONAB9.354e-13552.66Septin-4 OS=Pongo abelii OX=9601 GN=SEPTIN4 PE=2 S... [more]
sp|P28661|SEPT4_MOUSE9.876e-13452.66Septin-4 OS=Mus musculus OX=10090 GN=Septin4 PE=1 ... [more]
sp|Q9BGQ3|SEPT5_MACFA1.910e-13152.57Septin-5 OS=Macaca fascicularis OX=9541 GN=SEPTIN5... [more]
back to top
BLAST of Septin-5 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
S5XLH61.541e-15954.74Putative septin; Septin-5 OS=Schistosoma mansoni O... [more]
A0A1I8HW143.974e-15755.50Septin-type G domain-containing protein OS=Macrost... [more]
A0A4Z2DFX42.526e-15552.86Septin-5 OS=Schistosoma japonicum OX=6182 GN=EWB00... [more]
A0A074ZXP54.113e-15554.57Septin-type G domain-containing protein OS=Opistho... [more]
A0A267DF776.938e-15555.26Septin-type G domain-containing protein OS=Macrost... [more]
back to top
BLAST of Septin-5 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept5a1.737e-13352.51septin 5 [Source:NCBI gene;Acc:103046048][more]
sept5a5.614e-13353.43septin 5 [Source:NCBI gene;Acc:103046048][more]
sept5a8.775e-13253.43septin 5 [Source:NCBI gene;Acc:103046048][more]
sept4a1.592e-13052.96septin-5-like [Source:NCBI gene;Acc:103047659][more]
sept5a7.010e-12753.41septin 5 [Source:NCBI gene;Acc:103046048][more]
back to top
BLAST of Septin-5 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
zgc:1622392.482e-12347.93zgc:162239 [Source:ZFIN;Acc:ZDB-GENE-070424-28][more]
SEPTIN79.101e-8948.08septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
SEPTIN92.903e-8342.34septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN92.677e-7543.85septin 9 [Source:HGNC Symbol;Acc:HGNC:7323][more]
SEPTIN76.351e-6850.98septin 7 [Source:HGNC Symbol;Acc:HGNC:1717][more]
back to top
BLAST of Septin-5 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CDC36.884e-7539.09Component of the septin ring that is required for ... [more]
CDC119.650e-7041.84Component of the septin ring that is required for ... [more]
CDC121.946e-6538.57Component of the septin ring that is required for ... [more]
CDC101.992e-6037.29Component of the septin ring, required for cytokin... [more]
SPR35.484e-6037.92Sporulation-specific homolog of the CDC3/10/11/12 ... [more]
back to top
BLAST of Septin-5 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO474092.453e-12951.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO331064.090e-10754.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO345221.256e-10552.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379503.357e-6842.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479751.461e-6047.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Septin-5 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sept5a7.009e-13350.94septin 5 [Source:NCBI gene;Acc:101158828][more]
sept5a1.085e-13254.05septin 5 [Source:NCBI gene;Acc:101158828][more]
sept5a2.589e-13152.51septin 5 [Source:NCBI gene;Acc:101158828][more]
ENSORLT00000001335.21.427e-12449.58septin-5 [Source:NCBI gene;Acc:101166318][more]
ENSORLT00000009841.25.519e-12051.83septin-4 [Source:NCBI gene;Acc:101169222][more]
back to top
BLAST of Septin-5 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076922.10.000e+099.77SMESG000076922.1[more]
SMESG000048968.11.136e-14752.64SMESG000048968.1[more]
SMESG000064397.11.492e-8546.38SMESG000064397.1[more]
SMESG000064397.12.255e-8547.77SMESG000064397.1[more]
SMESG000016474.16.855e-8042.95SMESG000016474.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016193 ID=SMED30016193|Name=Septin-5|organism=Schmidtea mediterranea sexual|type=transcript|length=2205bp
CTTATTTATTGTCTTTAAATACTTTTTAAAATATTTTAGATATATTTGAA
TCTATAAATCATGCAAGGTATACCAAGATTTAATGTTTCAAATAAGTCTA
AGAAAGAAGATGGCGATGATAGTTTTAAATTTACAAGTAGACCTCCATTA
GCTTCGTCTACTATCAGATCAAATGGAAGTGCTAAAAACGATGAATTAAA
ATTAGGATTTGCAAATTTACCAGAACAAATGCAAAGAAAAGCTGTAAAGA
AAGGATTTAATTTTACTTTGATGATTGTTGGAGAAAGTGGCTTAGGAAAA
AGCACATTTGTCAACAGTTTATTGAATCAAAGTATTTACACTGAACCTCG
AGACACGTCAAGTGAAGACATGATAAATTCTACGACAAAAATTGAAAAAC
ATTTCATTGAACTTGATGAGAAAGGAGTGAAACTGAGATTAACTATTGTT
GATACTCCTGGATTTGGTGATGGTCTTGATTGTCGCGAATGTTGGAAACC
AATAGTCGAATATATTGACGAAACATTTTACCAGTATTTTAAAGACGAAT
GTGCGATTAATCGAAAAAATATTCAAGACAATCGAGTGCATTGTTGTTTA
TATTTCATTTCTCCAACTGGACATGGAATTAAGCCAGTGGATGTAGAATT
AATGAAAACTCTCCACCATAAAGTGAATATTGTTCCAATCATAGCCAAAG
CTGATTCATTGACTGAATCAGAATTAAAAATATTCAAACGAAAAGTCATG
GATGATTTAGAAAAATATCAAATCAATTTCTATCAGCCACCGATTTGTGG
TAGCGATGAAGAAGACGAATTTCGAGCTCAAGATGCTGAAATACGGGCTG
CTTTGCCGTTTTCAGTAGTCGGTAGTAATATTATTGTCGATAGTGATAGT
GGACGCAAATTACGTGGCCGACAATATATATGGGGAATTGCGGAGGTTGA
GAATTCCAAACATTGCAATTTTAATATATTACGGACTTTTATTCTTAGGA
CTCATATGCAAGATCTGAAAGATGTGACAAATGATTTACTGTATGAAAAT
TATCGTGGCCAAATTATCCAAGTGAGAATGACCAGGCGCAACAATGACCG
CTATGCTACAATAAACAGCAAGACTGAATCCACAGCCTCTTCAATCGATG
ACATTGTCGACACGAGCAACTTGTTACAGGAGAAAGATGAAGAGATCCAA
CGCATTCAGGCGGTCTTATCGAAAATGCAAACTCAGATCAGCAGTAACGG
ATCGGTCGATAATTCCTCGACTATGTCCAGTTTAAGCAAACCCTCAGCTA
TCAACAACATCTCGATATTGTCTGCATCCCAAACAATGCCAGCCGCTACC
AGCAATTCTCCTTCCGTCTCTGTCAAATCCTCCAGCACGATTTCCAGTGC
CAAATAATCGATTTGCACATAACTCCCGGTTGTCGTCGTCGTCGCCGTCG
TCAGTCTTGTCTCCAGTTATTTTTAATAAAATAAAAAACAATTTATGCAT
GTTTTTCTCAATAAAAAAAACTACACTGATTATTGTTCGACATTATTGAT
TTTTTTGATTTTTTAATTTTTATATATATATTGATTATTGGTGATTTTTG
ATCACTTTGTGTAGATAAATTACAATTGATTATTTTTGCGATCATTGATT
AATTTTCTATCGAATAATTTGTCTCTGTGTAAGTTGCTTTGATTTATTTT
CATTTGATGATGATGATGGTGGCGTAGCGTGTGTGTGTGTGTTACTGGAT
ACCGCAATTATTTTACTAATACTCTTTAATATTATGTGCATTTTTTCACA
TTGGAACATTAATTTTTTTGTGTGGAAATGTGGACATCCCGCGTAATCGA
TTCCTCGTGATGTCCATATATAGACATGAATATGCCTGATTTGATCCAGG
TGATGCGCACATGCCTGCAGGTGATAACACTGATATATGATCGCGCAATT
TGTTTTTATGTTATTATTTAATTTTTTGGATTAGTCATTTGTGTGTGTAT
GTGTGTCTCTCTCTGATTGGAAGGGTTTTGAATGTATTTATTGTTGCCGG
CATGACAAGGAGGATTTTAATTTATCATTTATATAAAGCTTAATTTGTTT
TCATTCTTAATGAGGAAAGTTTTGAGATTTTCAAGCATATAAAGAATGGA
GATGAGACTAGAAAAAATACATTTTTGTATAACAAAATTTGTCTTACATT
TCAAG
back to top

protein sequence of SMED30016193-orf-1

>SMED30016193-orf-1 ID=SMED30016193-orf-1|Name=SMED30016193-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=449bp
MQGIPRFNVSNKSKKEDGDDSFKFTSRPPLASSTIRSNGSAKNDELKLGF
ANLPEQMQRKAVKKGFNFTLMIVGESGLGKSTFVNSLLNQSIYTEPRDTS
SEDMINSTTKIEKHFIELDEKGVKLRLTIVDTPGFGDGLDCRECWKPIVE
YIDETFYQYFKDECAINRKNIQDNRVHCCLYFISPTGHGIKPVDVELMKT
LHHKVNIVPIIAKADSLTESELKIFKRKVMDDLEKYQINFYQPPICGSDE
EDEFRAQDAEIRAALPFSVVGSNIIVDSDSGRKLRGRQYIWGIAEVENSK
HCNFNILRTFILRTHMQDLKDVTNDLLYENYRGQIIQVRMTRRNNDRYAT
INSKTESTASSIDDIVDTSNLLQEKDEEIQRIQAVLSKMQTQISSNGSVD
NSSTMSSLSKPSAINNISILSASQTMPAATSNSPSVSVKSSSTISSAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030643Septin4
IPR027417P-loop_NTPase
IPR030379G_SEPTIN_dom
IPR016491Septin
Vocabulary: molecular function
TermDefinition
GO:0005525GTP binding
GO:0000166nucleotide binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 372..392
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 45..338
e-value: 6.9E-112
score: 375.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..38
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..448
NoneNo IPR availablePANTHERPTHR18884SEPTINcoord: 35..394
IPR030379Septin-type guanine nucleotide-binding (G) domainPFAMPF00735Septincoord: 64..340
e-value: 3.5E-114
score: 380.8
IPR030379Septin-type guanine nucleotide-binding (G) domainPROSITEPS51719G_SEPTINcoord: 64..338
score: 94.21
IPR016491SeptinPIRSFPIRSF006698Septincoord: 6..436
e-value: 6.1E-133
score: 441.3
IPR016491SeptinCDDcd01850CDC_Septincoord: 64..332
e-value: 1.22051E-146
score: 416.947
IPR030643Septin 4PANTHERPTHR18884:SF71SEPTIN-4coord: 35..394
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 45..247