SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1

Overview
NameSWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1
Smed IDSMED30016154
Length (bp)1313
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMED30016154) t-SNE clustered cells

Violin plots show distribution of expression levels for SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMED30016154) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016154

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016154SMESG000018094.1 dd_Smed_v4_1963_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016154SMESG000018094.1 dd_Smed_v4_1963_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016154SMESG000018094.1 Contig51602newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30016154SMESG000018094.1 Contig51602uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
cephalic gangliaSMED30016154SMESG000018094.1 SMU15037841SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymal cellSMED30016154SMESG000018094.1 SMU15037841SMUPMID:30237141
Trost et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
reproductive organSMED30016154SMESG000018094.1 Contig51602newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016154SMESG000018094.1 Contig51602uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30016154SMESG000018094.1 PL05012B1G09ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 424.861 bits (1091), Expect = 4.677e-147
Identity = 224/408 (54.90%), Postives = 293/408 (71.81%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+    D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 374          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 424.861 bits (1091), Expect = 4.677e-147
Identity = 224/408 (54.90%), Postives = 293/408 (71.81%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+    D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 374          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 421.779 bits (1083), Expect = 9.125e-146
Identity = 224/417 (53.72%), Postives = 293/417 (70.26%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII-------------DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+             D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 421.779 bits (1083), Expect = 9.125e-146
Identity = 224/417 (53.72%), Postives = 293/417 (70.26%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII-------------DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+             D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 409.838 bits (1052), Expect = 7.739e-141
Identity = 224/426 (52.58%), Postives = 294/426 (69.01%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPF---CL---------------DDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+    D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP    C+               DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLWCGCIAALTLRADSALVLHFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 392          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Celegans
Match: snfc-5 (SNF chromatin remodeling Complex component [Source:UniProtKB/TrEMBL;Acc:Q21831])

HSP 1 Score: 308.916 bits (790), Expect = 5.504e-102
Identity = 168/383 (43.86%), Postives = 242/383 (63.19%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDND-PVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSH---PSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKI 1198
            YG +P  F  +E  E YY+  E+G Y+RL RG ++KKYP LWR++    +K K+  + +++     N  +LRA EVDELL+G E +Y+ +  + +      +  +E  S+ +              ++ P+T       W G   + + S+HL+SVPC  P+  +R G++  K +   +  +D +      +NA   E+LVPIRLDME+DG+KLRD FT+NKNE++ITPE  AEI+CEDLDL    F PAI  AI QQ+++    P  D+  N  D R +++LNI+VGN SLVDQFEWD+S+ + NSPE+F+  +C E+GLGGEF++G+AYSIRGQL W+ R YAFSES L TV+  FR  +E + W P +E LTDAE+EKK+
Sbjct:   12 YGPRPQSFSLDEAGERYYIGSEIGAYLRLHRGTLYKKYPLLWRKVATSDDKDKLKQIAMSNAFLHTNIMLLRAHEVDELLDGSEEKYRAAGAAPS------TPRTEGASRTV--------------AKTPATG------WAG-QQVTSGSHHLESVPCSCPIAHSR-GRM--KHRELVYSAEDLEMSKRVMKNAEEGEDLVPIRLDMELDGIKLRDTFTFNKNEKMITPEMIAEIMCEDLDLPLAVFQPAITAAINQQLEASTEAPPLDV--NICDQRAVLKLNINVGNQSLVDQFEWDMSDPN-NSPEEFSRNICKELGLGGEFMSGIAYSIRGQLQWNQRTYAFSESPLATVDCPFRTSSEVESWGPFLETLTDAEIEKKM 361          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Fly
Match: Snr1 (gene:FBgn0011715 transcript:FBtr0078682)

HSP 1 Score: 395.586 bits (1015), Expect = 5.741e-136
Identity = 217/401 (54.11%), Postives = 282/401 (70.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLG-LGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS-----EDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANN 1246
            YG+KP+ FQ EE  EYYY+  EVG YMR FRG ++KKYP + R +L++ E+K++ + GL+S I A + ++LRA EVD+++ G + +Y+            +S+N+                     S  P  R  +S +    + +MPN+S HLD+VP  TP+NRNR      KV+ FP C DD DP +  ENA  KE LVPIRLDME++G KLRD FTWNKNE +ITPEQFAE+LC+DLDL P+ FVPAIAQAI+QQ+++ P+     E+ C    D RVI++LNIHVGN SLVDQ EWD+SE++ N+PE+FA KLC+E+GLGGEFVT +AYSIRGQL+WH R YAFSE+ L T++V FRN ++AD W+P +E LTDAEMEKKIRDQDRNTRRMRRLAN 
Sbjct:    6 YGDKPVAFQLEEGGEYYYVGSEVGNYMRHFRGILYKKYPGMTRIVLSNEERKRLAESGLSSHILASSVSLLRAVEVDDIMAGNDEKYRA-----------VSVNT---------------------SDTPVPRESKSKKQPQYVPTMPNSS-HLDAVPQATPINRNRVH--TKKVRTFPMCFDDTDPTASLENAAQKECLVPIRLDMELEGQKLRDTFTWNKNESMITPEQFAEVLCDDLDLNPLPFVPAIAQAIRQQIEAFPNDPPILEETC----DQRVIVKLNIHVGNTSLVDQVEWDMSEKN-NNPEEFAIKLCAELGLGGEFVTAIAYSIRGQLSWHCRTYAFSEAPLSTIDVPFRNPSDADAWAPFLETLTDAEMEKKIRDQDRNTRRMRRLANT 366          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Match: smarcb1a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1a [Source:NCBI gene;Acc:799716])

HSP 1 Score: 423.705 bits (1088), Expect = 6.127e-147
Identity = 222/397 (55.92%), Postives = 288/397 (72.54%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            YG+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+L RRL    E+KKI+    A+ +T     +L+A EV+E+ +G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA  +E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 YGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLSRRLATVEERKKIVASSHATSVT-----LLKASEVEEIFDGHDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQQEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLSPLTFVPAIASAIRQQIESYPTDSILDEQMDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 364          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1b [Source:ZFIN;Acc:ZDB-GENE-991008-16])

HSP 1 Score: 423.32 bits (1087), Expect = 1.452e-146
Identity = 221/397 (55.67%), Postives = 286/397 (72.04%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    A+ +T     +L+A E +E+ EG + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ +   Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:   19 FGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIVASSHATSVT-----LLKASECEEIFEGNDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQAEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEEQTDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPESFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 376          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1b [Source:ZFIN;Acc:ZDB-GENE-991008-16])

HSP 1 Score: 422.935 bits (1086), Expect = 1.536e-146
Identity = 224/401 (55.86%), Postives = 290/401 (72.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            YG+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+L RRL    E+KKI+    D G  +  T+V   +L+A EV+E+ +G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA  +E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 YGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLSRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEIFDGHDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQQEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLSPLTFVPAIASAIRQQIESYPTDSILDEQMDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 371          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Match: smarcb1a (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1a [Source:NCBI gene;Acc:799716])

HSP 1 Score: 422.935 bits (1086), Expect = 1.536e-146
Identity = 224/401 (55.86%), Postives = 290/401 (72.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            YG+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+L RRL    E+KKI+    D G  +  T+V   +L+A EV+E+ +G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA  +E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 YGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLSRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEIFDGHDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQQEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLSPLTFVPAIASAIRQQIESYPTDSILDEQMDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 371          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1b [Source:ZFIN;Acc:ZDB-GENE-991008-16])

HSP 1 Score: 416.772 bits (1070), Expect = 3.681e-144
Identity = 221/401 (55.11%), Postives = 286/401 (71.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYA----FSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    A+ +T     +L+A E +E+ EG + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ +   Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YA    FSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 FGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIVASSHATSVT-----LLKASECEEIFEGNDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQAEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEEQTDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPESFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFRSDFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 368          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Xenopus
Match: arhgap29 (Rho GTPase activating protein 29 [Source:Xenbase;Acc:XB-GENE-964890])

HSP 1 Score: 424.091 bits (1089), Expect = 8.276e-147
Identity = 221/402 (54.98%), Postives = 286/402 (71.14%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLAS-----PITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KP+ FQ EE+ EYY +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+              A +  +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    9 FGQKPVKFQLEEDGEYYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKYHGYTTLATSVTLLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 376          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Xenopus
Match: arhgap29 (Rho GTPase activating protein 29 [Source:Xenbase;Acc:XB-GENE-964890])

HSP 1 Score: 418.698 bits (1075), Expect = 1.587e-144
Identity = 205/384 (53.39%), Postives = 271/384 (70.57%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGL-----ASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKI 1198
            +G+KP+ FQ EE+ EYY +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+   +          A +  +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKI
Sbjct:   10 FGQKPVKFQLEEDGEYYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVCQHIPQRYHGYTTLATSVTLLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKI 359          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Xenopus
Match: arhgap29 (Rho GTPase activating protein 29 [Source:Xenbase;Acc:XB-GENE-964890])

HSP 1 Score: 417.157 bits (1071), Expect = 2.108e-143
Identity = 205/384 (53.39%), Postives = 270/384 (70.31%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLAS-----PITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKI 1198
            +G+KP+ FQ EE+ EYY +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+              A +  +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKI
Sbjct:   45 FGQKPVKFQLEEDGEYYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKYHGYTTLATSVTLLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKI 394          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Mouse
Match: Smarcb1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:MGI Symbol;Acc:MGI:1328366])

HSP 1 Score: 424.861 bits (1091), Expect = 3.211e-147
Identity = 224/408 (54.90%), Postives = 293/408 (71.81%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+    D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 374          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Mouse
Match: Smarcb1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:MGI Symbol;Acc:MGI:1328366])

HSP 1 Score: 421.779 bits (1083), Expect = 6.265e-146
Identity = 224/417 (53.72%), Postives = 293/417 (70.26%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII-------------DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+             D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Match: sp|Q6DFM1|SNF5_XENTR (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus tropicalis OX=8364 GN=smarcb1 PE=2 SV=1)

HSP 1 Score: 424.091 bits (1089), Expect = 4.384e-146
Identity = 221/402 (54.98%), Postives = 286/402 (71.14%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLAS-----PITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KP+ FQ EE+ EYY +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+              A +  +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    9 FGQKPVKFQLEEDGEYYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKYHGYTTLATSVTLLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 376          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Match: sp|Q5U379|SNF5_DANRE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1-A OS=Danio rerio OX=7955 GN=smarcb1a PE=2 SV=1)

HSP 1 Score: 422.935 bits (1086), Expect = 1.159e-145
Identity = 224/401 (55.86%), Postives = 290/401 (72.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            YG+KPI FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+L RRL    E+KKI+    D G  +  T+V   +L+A EV+E+ +G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA  +E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 YGQKPIKFQLEEDGDFYMIGSEVGNYLRMFRGSLYKRYPSLSRRLATVEERKKIVASSHDHGYTTLATSVT--LLKASEVEEIFDGHDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQQEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLSPLTFVPAIASAIRQQIESYPTDSILDEQMDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 371          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Match: sp|Q6GQ82|SNF5_XENLA (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Xenopus laevis OX=8355 GN=smarcb1 PE=2 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 3.481e-145
Identity = 220/402 (54.73%), Postives = 286/402 (71.14%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLAS-----PITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KP+ FQ EE+ +YY +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+              A +  +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    9 FGQKPVKFQLEEDGDYYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKYHGHTTLATSVTLLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 376          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Match: sp|Q9Z0H3|SNF5_MOUSE (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Mus musculus OX=10090 GN=Smarcb1 PE=1 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 4.382e-145
Identity = 224/417 (53.72%), Postives = 293/417 (70.26%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII-------------DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+             D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Match: sp|Q12824|SNF5_HUMAN (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1 PE=1 SV=2)

HSP 1 Score: 421.779 bits (1083), Expect = 4.382e-145
Identity = 224/417 (53.72%), Postives = 293/417 (70.26%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII-------------DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            M  L   +G+KP+ FQ E++ E+Y +  EVG Y+R+FRG ++K+YP+LWRRL    E+KKI+             D G  +  T+V   +L+A EV+E+L+G + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE F+EILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH + YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    3 MMALSKTFGQKPVKFQLEDDGEFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLATVEERKKIVASSHGKKTKPNTKDHGYTTLATSVT--LLKASEVEEILDGNDEKYKA-----------VSISTE------------------PPTYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQPEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFSEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILEDQSDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQKTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 383          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Match: A0A4S2MFB9 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001795 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 269/441 (61.00%), Postives = 318/441 (72.11%), Query Frame = 2
Query:   50 LMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSW------------NSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPN----------------------------SQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            + FRYGEKPI FQ E + EYYYLA EVGRY+RLFR E+FKKYPNLWRRL+   EK+K+I +GLAS +TA+NA +LR FEV+++L G + R   S             +    + G  S+ S                   P+                            +  P ++R  SGRW+GLGS PNTS+HLDSVPCPTP++R RT +  +K   FPFCLDD+DP++FH+NA   E LVPIRLD+E DGVKLRDCFTWN+NEQLITPEQFAE+LC+DLD+ PITFVPAI  AIKQQVD+HP ED+   Q D+RVIIRLNIHVGNISLVDQFEWD+SE  ENSPE+FA +LC+E+GLGGEFVT VAYSIRGQLAWH R+YAFSES LPTV+V FRN NEADQWSP+VE+LTDAEMEKKIRDQDRNTRRMRRLAN QP
Sbjct:    3 IAFRYGEKPIEFQLEPDGEYYYLASEVGRYLRLFRKELFKKYPNLWRRLVTPEEKEKLIQMGLASHVTAMNAMLLRTFEVNDILCGHDDRSMDSMTHLESSARDTQSSGSTSVFGTSSVGSAGTGAAGSKPPGVGVGTGTPSRTGSVSAGINGAPNAGFSVTGSSATDFLAGTPKSKRENSGRWVGLGSAPNTSFHLDSVPCPTPISRLRTARQTSKAATFPFCLDDSDPLAFHDNARQTECLVPIRLDIECDGVKLRDCFTWNRNEQLITPEQFAEVLCDDLDINPITFVPAIVSAIKQQVDAHPVEDLLVGQTDTRVIIRLNIHVGNISLVDQFEWDMSER-ENSPEQFASRLCAELGLGGEFVTAVAYSIRGQLAWHQRIYAFSESPLPTVDVAFRNSNEADQWSPVVEVLTDAEMEKKIRDQDRNTRRMRRLANTQP 442          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Match: A0A5J4P1V5 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0014874 PE=4 SV=1)

HSP 1 Score: 522.316 bits (1344), Expect = 0.000e+0
Identity = 273/442 (61.76%), Postives = 321/442 (72.62%), Query Frame = 2
Query:   56 FRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGRE----------------------------------GRYKVSWNSDNLIDGLLSINSEV---------ISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            FRYGEKPI FQ E + +Y+YLA EVGRY+RLFR E+FKKYPNLWRRL    EK+K+I +GLASPITA+NA +LR  EV+E+L G++                                  G   ++ N+ +L  G  +IN            I   +       +     ++    ++R  SGRW+GLGS PNTS+HLDSVPCPTP++R RT +  +K   FPFCLDD+DPV+FHENA   E LVPIRLD+E DGVKLRDCFTWN+NEQLITPEQ AE+LC+DLDL PITFVPAI  AIKQQV++HP+EDM   Q D+RVIIRLNIHVGNISLVDQFEWD+SE  ENSPE FA +LC+E+GLGGEFVT VAYSIRGQLAWH R+YAFSES LPTV+VVFRN NEADQWSPIVE+LTDAEMEKKIRDQDRNTRRMRRLAN QP
Sbjct:    5 FRYGEKPIEFQLETDGDYFYLASEVGRYLRLFRKELFKKYPNLWRRLATPEEKEKLIHMGLASPITAINAMLLRTCEVNEILCGQDDHSLELQENVGTATRETTLCNSGSTGNVFGSNNLGTVTLTPNAKSLAGGTGTINRTASATGGLNGPIGLGIPMAGGTGSATDHLSASGAKSKRESSGRWIGLGSAPNTSFHLDSVPCPTPISRLRTARQTSKGSTFPFCLDDSDPVAFHENACQPECLVPIRLDIECDGVKLRDCFTWNRNEQLITPEQMAEVLCDDLDLNPITFVPAIVSAIKQQVEAHPTEDMLAGQKDTRVIIRLNIHVGNISLVDQFEWDMSEA-ENSPELFAGRLCAELGLGGEFVTAVAYSIRGQLAWHQRIYAFSESPLPTVDVVFRNSNEADQWSPIVEVLTDAEMEKKIRDQDRNTRRMRRLANTQP 445          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Match: A0A075A6N6 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02371 PE=4 SV=1)

HSP 1 Score: 517.694 bits (1332), Expect = 1.927e-179
Identity = 274/441 (62.13%), Postives = 323/441 (73.24%), Query Frame = 2
Query:   50 LMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWN------------SDNLIDGLLSINSEV--------------ISKDXXXXXXXXXXXXVPNSQNPST--------------RRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            + FRYGEKPI FQ E + EYYYLA EVGRY+RLFR E+FKKYPNLWRRL+   EK+K+I +GLAS +TA+NA +LR FEV+++L G + R   S              S   + G  S+ +                       GS +  +N  PN+  P T              +R  SGRW+GLGS PNTS+HLDSVPCPTP++R RT +  +K   FPFCLDD+DP++FH+NA   E LVPIRLD+E DGVKLRDCFTWN+NEQLITPEQFAE+LC+DLD+ PITFVPAI  AIKQQVD+HP ED+   Q D+RVIIRLNIHVGNISLVDQFEWD+SE  ENSPE+FA +LC+E+GLGGEFVT VAYSIRGQLAWH R+YAFSES LPTV+V FRN NEADQWSP+VE+LTDAEMEKKIRDQDRNTRRMRRLAN QP
Sbjct:    3 IAFRYGEKPIEFQLEPDGEYYYLASEVGRYLRLFRKELFKKYPNLWRRLVTPEEKEKLIQMGLASHVTAMNAMLLRTFEVNDILCGHDDRSMDSMTHLESSARDSQSSSSTSVFGTSSVGTTASGAAGSKPPGVGVGTGTPSRTGSVSAGINGAPNAGFPVTGSSATDFLSGTPKSKRENSGRWVGLGSAPNTSFHLDSVPCPTPISRLRTARQTSKAATFPFCLDDSDPLAFHDNARQAECLVPIRLDIECDGVKLRDCFTWNRNEQLITPEQFAEVLCDDLDINPITFVPAIVSAIKQQVDAHPVEDLLVGQTDTRVIIRLNIHVGNISLVDQFEWDMSER-ENSPEQFASRLCAELGLGGEFVTAVAYSIRGQLAWHQRIYAFSESPLPTVDVAFRNSNEADQWSPVVEVLTDAEMEKKIRDQDRNTRRMRRLANTQP 442          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Match: A0A0V0J2V7 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR113958 PE=4 SV=1)

HSP 1 Score: 510.375 bits (1313), Expect = 9.159e-177
Identity = 270/426 (63.38%), Postives = 322/426 (75.59%), Query Frame = 2
Query:   50 LMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKV--------------SWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPN-----------SQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            L FRYGEKPI FQ + + E++YLA EVGRYMRLFRGE+ KKYPNLW+ L    E++K+I +GLA+PITA+NA +LRA+EVDEL+ G E R+K               S  ++  I    S+N   I       +S   LN   N           S    T +RESGRW+   S+PNTS+HLDSVPCPTP+ R+R  K  +KV +FP CLDD+DPV++HENA+  E LVPIRLD+E DGVKLRDCFTWN+ EQ+ITPEQFAEILC+DLDL PI+FVPAIAQAI+QQV++H  E++   Q D+RVIIRLNIHVGN+SLVDQFEWDLSE   NSPE FA +LC+E+GLGGEFVT VAYSIRGQLAWH RLYAF+ES LPTV+VVFR+ NEADQWSP+VE+LTDAEMEKKIRDQDRNTRRMRRLAN QP
Sbjct:    3 LEFRYGEKPIEFQLQPDGEFFYLASEVGRYMRLFRGELLKKYPNLWKSLATPEEREKLIAMGLATPITAINATLLRAYEVDELIAGSEERFKSFEGTGTAMMGHAAQSTGNNGSITRAGSVNLSGIGSSAGGLASGTALNLSGNNIISDVSLGSGSTPLKTSKRESGRWVS--SVPNTSFHLDSVPCPTPIGRSRPHKQSSKVSSFPICLDDSDPVAYHENAIQPEHLVPIRLDIEFDGVKLRDCFTWNRYEQMITPEQFAEILCDDLDLNPISFVPAIAQAIRQQVEAHSVENILVGQTDTRVIIRLNIHVGNLSLVDQFEWDLSEP-ANSPELFAARLCAELGLGGEFVTAVAYSIRGQLAWHQRLYAFTESPLPTVDVVFRSPNEADQWSPVVEVLTDAEMEKKIRDQDRNTRRMRRLANAQP 425          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Match: A0A504YSQ8 (SWI/SNF matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Fasciola gigantica OX=46835 GN=FGIG_08772 PE=4 SV=1)

HSP 1 Score: 504.597 bits (1298), Expect = 2.146e-174
Identity = 265/434 (61.06%), Postives = 313/434 (72.12%), Query Frame = 2
Query:   56 FRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGR-YKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPS----------------------------------TRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            FRYGE+PI FQ E   EYYYLA EVGRY+RLFR E+FKKYPNLWRRL+   EK+K+I +GLASPITA+NA +LR +EV+++L  ++ R   V       +     IN   +S        A+ +    ++  PS                                  ++R  SGRW+ L + P+TS+HLDSVPCPTP++R RT +  +K   FPFCLDD+DPV+FHENA   E LVPIRLD+E DGVKLRDCFTWN+NE  ITPEQ AE+LC+DLDL PI+FVPAI  AIKQQVD+HP +D+   Q D+RVIIRLNIHVGN SLVDQFEWDLSE  ENSPE FA +LC+E+GLGGEFVT VAYSIRGQLAWH R+YAFSES LPTV+VVFRN NEADQWSPIVE+LTDAEMEKKIRDQDRNTRRMRRLAN QP
Sbjct:    5 FRYGERPIEFQLESEGEYYYLASEVGRYLRLFRKELFKKYPNLWRRLITPEEKEKLIQMGLASPITAMNAMLLRTYEVNDILNSQDDRSVTVVEPRGTAVRDPSVINPGFMSGSSATSGLASTVKTSGSTGTPSRGSLSAAGVNGAAPMSLIGGVGSSTSAEHLSASKSKRESSGRWMSLSATPSTSFHLDSVPCPTPISRLRTARQTSKAFTFPFCLDDSDPVAFHENARQPECLVPIRLDIECDGVKLRDCFTWNRNELQITPEQMAEVLCDDLDLNPISFVPAIVNAIKQQVDAHPVDDLLAGQTDTRVIIRLNIHVGNTSLVDQFEWDLSEP-ENSPELFASRLCAELGLGGEFVTAVAYSIRGQLAWHQRVYAFSESPLPTVDVVFRNSNEADQWSPIVEVLTDAEMEKKIRDQDRNTRRMRRLANAQP 437          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Cavefish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:NCBI gene;Acc:103037407])

HSP 1 Score: 422.55 bits (1085), Expect = 1.448e-146
Identity = 220/397 (55.42%), Postives = 287/397 (72.29%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KPI FQ E++ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    A+ +T     +L+A E +E+ EG + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 FGQKPIKFQLEQDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIVASSHATSVT-----LLKASECEEIFEGNDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILDEQTDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPETFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 364          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Cavefish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:NCBI gene;Acc:103037407])

HSP 1 Score: 416.387 bits (1069), Expect = 3.837e-144
Identity = 220/401 (54.86%), Postives = 287/401 (71.57%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYA----FSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KPI FQ E++ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    A+ +T     +L+A E +E+ EG + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YA    FSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 FGQKPIKFQLEQDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIVASSHATSVT-----LLKASECEEIFEGNDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRNRMGR--DKKRTFPLCFDDHDPAVIHENASQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILDEQTDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPETFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFRSDFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 368          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Cavefish
Match: smarcb1b (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:NCBI gene;Acc:103037407])

HSP 1 Score: 307.375 bits (786), Expect = 6.565e-102
Identity = 158/219 (72.15%), Postives = 183/219 (83.56%), Query Frame = 2
Query:  596 FCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
               DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ + + Q D RVII+LNIHVGNISLVDQFEWD+SE+ ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:  108 LSFDDHDPAVIHENASQSEVLVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSILDEQTDQRVIIKLNIHVGNISLVDQFEWDMSEK-ENSPETFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 325          

HSP 2 Score: 90.1225 bits (222), Expect = 1.417e-19
Identity = 38/91 (41.76%), Postives = 61/91 (67.03%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII--DLGLASPITAVNANILRAFEVDELLEGREGRYKV 328
            +G+KPI FQ E++ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    G      A +  +L+A E +E+ EG + +YK 
Sbjct:    7 FGQKPIKFQLEQDGDFYMIGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIVASSHGYCYTTLATSVTLLKASECEEIFEGNDEKYKA 97          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Sea Lamprey
Match: SMARCB1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, member 1 [Source:HGNC Symbol;Acc:HGNC:11103])

HSP 1 Score: 415.231 bits (1066), Expect = 2.786e-144
Identity = 221/401 (55.11%), Postives = 286/401 (71.32%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKII----DLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            YG KPI FQ E+  E++ +  EVG Y+R+FRG ++KKYP+LWRRL    E+KKI+    D G  +  T+V   +L+A EV+E+LEG + +YK            +SI++E                  P +     + +   +W+   +MPN+S+HLD+VPC TP+NRNR G+  +K + FP C DD+DP   HENA+  E LVPIRLDME+DG KLRD FTWN +E+LITPE FAEILC+DLDL P++FVP+IA AI+ QV++ P++ + ++Q D RVI++LNIHVGNISLVDQFEWD++E+ ENSPEKFA +LCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LP VE+  RN  +AD W P +E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:   10 YGPKPIKFQLEDAGEWFMIGSEVGNYLRMFRGSLYKKYPSLWRRLATMDERKKIVASSHDHGYTTLATSVT--LLKACEVEEILEGNDDKYKA-----------VSISTE------------------PPAYLREQKPKRPNQWVP--AMPNSSHHLDAVPCSTPINRNRMGR--DKKRTFPLCFDDHDPAVIHENAMQSEILVPIRLDMEIDGQKLRDTFTWNMHEKLITPEMFAEILCDDLDLNPLSFVPSIAAAIRSQVEAFPTDSILDDQSDQRVIVKLNIHVGNISLVDQFEWDMAEK-ENSPEKFALRLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPIVEIAIRNAGDADAWCPFLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 374          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Yeast
Match: SNF5 (Subunit of the SWI/SNF chromatin remodeling complex; involved in transcriptional regulation; functions interdependently in transcriptional activation with Snf2p and Snf6p; relocates to the cytosol under hypoxic conditions [Source:SGD;Acc:S000000493])

HSP 1 Score: 108.227 bits (269), Expect = 1.128e-25
Identity = 84/243 (34.57%), Postives = 129/243 (53.09%), Query Frame = 2
Query:  554 NRTGKVVNKVQ--NFPFCLDDNDPVSFHENALIKEELVPIRL--DMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPIT---FVPAIAQAIKQQVD---SHPSEDMCNNQ---PDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQL-AWHNRL----YAFSESR----------LPTVEV--VFRNHNEADQWSPIVEILTDAEMEK 1192
            N T +V+ +V+  N    L+D   V         E+LVPIRL  D + D   LRD   WNKN++LI  E F + +  D   +  T    +  I Q+I++Q+     +P  ++  ++    D R+ I+L+I VG   L+DQFEWD+S  D N PE+FA  +C E+ L GEFVT +A+SIR Q+  +H  L    Y F  S           LPT+ +  V+R   E+  ++P +  ++ AE+E+
Sbjct:  421 NTTTRVIPQVEVGNRKHYLEDKLKVYKQAMNETSEQLVPIRLEFDQDRDRFFLRDTLLWNKNDKLIKIEDFVDDMLRDYRFEDATREQHIDTICQSIQEQIQEFQGNPYIELNQDRLGGDDLRIRIKLDIVVGQNQLIDQFEWDISNSD-NCPEEFAESMCQELELPGEFVTAIAHSIREQVHMYHKSLALLGYNFDGSAIEDDDIRSRMLPTITLDDVYRPAAESKIFTPNLLQISAAELER 662          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Yeast
Match: SFH1 (Component of the RSC chromatin remodeling complex; essential gene required for cell cycle progression and maintenance of proper ploidy; phosphorylated in the G1 phase of the cell cycle; Snf5p paralog; hSNF5 tumor suppressor ortholog [Source:SGD;Acc:S000004313])

HSP 1 Score: 88.9669 bits (219), Expect = 8.425e-20
Identity = 60/197 (30.46%), Postives = 98/197 (49.75%), Query Frame = 2
Query:  656 LVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIR------------GQLAW----HNRLYAF-SESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKK 1195
            ++PI LD+E  G  ++D F WN N+  I+PE+FA I C+DLD+   T    IA  IK+Q+    +        D  VII L  ++ +    D F+W+L+++   +PE+FA  +  ++GL  EF+  ++ S+             G L      ++  + + S  RL   E+          W P VEILT  E++K+
Sbjct:  203 MIPITLDIEHMGHTIKDQFLWNYNDDSISPEEFASIYCKDLDMTSATLQTQIANIIKEQLKDLENIAATEIMSDLHVIINLTCNLQDRFFEDNFQWNLNDKSL-TPERFATSIVQDLGLTREFIPLISQSLHETILKIKKDWVDGHLIQDHVPNDAAFGYLSGIRLDIDEL-------GSNWCPRVEILTKEEIQKR 391          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Nematostella
Match: EDO41311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4M6])

HSP 1 Score: 150.599 bits (379), Expect = 3.977e-44
Identity = 74/114 (64.91%), Postives = 87/114 (76.32%), Query Frame = 2
Query:  872 PDSR-----VIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKI 1198
            PD R      + RLNIHVGNISLVDQFEWDLSE  +NSPE+FA  LCS++GLGGEFVT VAYSIRGQL+WH + YAFSE+ LP V+   R+  + D W P +E LTDAEMEKK+
Sbjct:    7 PDPREYVLHTVARLNIHVGNISLVDQFEWDLSEP-QNSPEQFALSLCSDLGLGGEFVTAVAYSIRGQLSWHQKTYAFSEAPLPKVDNPVRSGPDIDNWGPYLETLTDAEMEKKL 119          

HSP 2 Score: 45.0542 bits (105), Expect = 7.975e-6
Identity = 24/59 (40.68%), Postives = 35/59 (59.32%), Query Frame = 2
Query:  668 RLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSH 844
            RL++ +  + L D F W+ +E   +PEQFA  LC DL L    FV A+A +I+ Q+  H
Sbjct:   19 RLNIHVGNISLVDQFEWDLSEPQNSPEQFALSLCSDLGLGG-EFVTAVAYSIRGQLSWH 76          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Medaka
Match: smarcb1b (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 [Source:NCBI gene;Acc:101163885])

HSP 1 Score: 425.631 bits (1093), Expect = 9.861e-148
Identity = 222/399 (55.64%), Postives = 288/399 (72.18%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPIT--AVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KP+ FQ EE+ EYY +  EVG Y+R+FRG ++K+YP+LWR+L    E+KKI++       T  A +  +L+A EV+E+LEG + +YK            +SI++E                  P +     + + + +W+   ++PN+S+HLD+VPC T +NR+R G+  +K + FP C DD+DP   HENA   E LVPIRLDME++G KLRD FTWN NE+L+TPE FAEILC+DLDL P+TFVPAIA AI+QQ++S+P++ +  +Q D RVII+LNIHVGNISLVDQFEWD+SE  ENSPEKFA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    7 FGQKPVKFQLEEDGEYYMIGSEVGNYLRMFRGSLYKRYPSLWRKLATVEERKKIVESSHDHGYTQLATSVTLLKASEVEEILEGNDEKYKA-----------VSISTE------------------PPAYLREQKAKRNSQWVP--TLPNSSHHLDAVPCSTTINRSRLGR--DKKRTFPLCFDDHDPAVIHENATQTEVLVPIRLDMEIEGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLTFVPAIASAIRQQIESYPTDSLLEDQTDQRVIIKLNIHVGNISLVDQFEWDMSER-ENSPEKFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 371          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Medaka
Match: ENSORLT00000015725.2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 [Source:NCBI gene;Acc:101169626])

HSP 1 Score: 419.468 bits (1077), Expect = 2.207e-145
Identity = 221/397 (55.67%), Postives = 283/397 (71.28%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
            +G+KP+ FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    A+ +T     +L+A E +E+ EG + +YK            +SIN+E                  P +     + + S +W+   ++P++S+HLD+VP  T +NRNR G+  +K + FP C DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P+E M   Q D RVII+LNIHVGNISLVDQFEWD+SE  ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:    9 FGQKPVKFQLEEDGDFYMVGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIMASSHATSVT-----LLKASECEEIFEGNDEKYKA-----------VSINTE------------------PPAYLREQKVKRSSQWVP--TLPSSSHHLDAVPSSTAINRNRMGR--DKKRTFPLCFDDHDPAVIHENAAQLEALVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTEAMFEEQADQRVIIKLNIHVGNISLVDQFEWDMSER-ENSPESFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 366          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Medaka
Match: ENSORLT00000015721.2 (SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 [Source:NCBI gene;Acc:101169626])

HSP 1 Score: 306.99 bits (785), Expect = 6.957e-102
Identity = 159/219 (72.60%), Postives = 180/219 (82.19%), Query Frame = 2
Query:  596 FCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQP 1252
               DD+DP   HENA   E LVPIRLDME+DG KLRD FTWN NE+L+TPE FAEILC+DLDL P+ FVPAIA AI+QQ++S+P+E M   Q D RVII+LNIHVGNISLVDQFEWD+SE  ENSPE FA KLCSE+GLGGEFVT +AYSIRGQL+WH R YAFSE+ LPTVE+  RN  +ADQW P++E LTDAEMEKKIRDQDRNTRRMRRLAN  P
Sbjct:  105 LSFDDHDPAVIHENAAQLEALVPIRLDMEIDGQKLRDAFTWNMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYPTEAMFEEQADQRVIIKLNIHVGNISLVDQFEWDMSER-ENSPESFALKLCSELGLGGEFVTTIAYSIRGQLSWHQRTYAFSENPLPTVEIAIRNTGDADQWCPLLETLTDAEMEKKIRDQDRNTRRMRRLANTAP 322          

HSP 2 Score: 100.908 bits (250), Expect = 2.240e-23
Identity = 79/274 (28.83%), Postives = 138/274 (50.36%), Query Frame = 2
Query:   62 YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYK-VSWNSDNLIDGLLSINSE---VISKDXXXXXXXXXXXXVP---NSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPC------PTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSH 844
            +G+KP+ FQ EE+ ++Y +  EVG Y+R+FRG ++K+YP+LWRRL +  E+KKI+    +S   + +  +L+A E +E+ EG + +YK VS N++      LS +     VI ++     +A     VP   + +    + R++  W  +     T      + C      P          +  +++++P          F E A   ++ V I+L++ +  + L D F W+ +E+  +PE FA  LC +L L    FV  IA +I+ Q+  H
Sbjct:    9 FGQKPVKFQLEEDGDFYMVGSEVGNYLRMFRGSLYKRYPSLWRRLASVEERKKIM---ASSHGGSTSVTLLKASECEEIFEGNDEKYKAVSINTEP--PAYLSFDDHDPAVIHEN-----AAQLEALVPIRLDMEIDGQKLRDAFTW-NMNEKLMTPEMFAEILCDDLDLNPLAFVPAIASAIRQQIESYP------TEAMFEEQA---DQRVIIKLNIHVGNISLVDQFEWDMSERENSPESFALKLCSELGLGG-EFVTTIAYSIRGQLSWH 261          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Match: SMESG000018094.1 (SMESG000018094.1)

HSP 1 Score: 780.785 bits (2015), Expect = 0.000e+0
Identity = 404/405 (99.75%), Postives = 405/405 (100.00%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQPW 1255
            MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDLLNGSSANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS+DMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW
Sbjct:    1 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDLLNGSSANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSDDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW 405          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Match: SMESG000018094.1 (SMESG000018094.1)

HSP 1 Score: 771.926 bits (1992), Expect = 0.000e+0
Identity = 400/401 (99.75%), Postives = 401/401 (100.00%), Query Frame = 2
Query:   53 MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQPW 1255
            MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDLLNGSSANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS+DMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW
Sbjct:    1 MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDLLNGSSANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSDDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW 401          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Match: SMESG000018094.1 (SMESG000018094.1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 394/405 (97.28%), Postives = 395/405 (97.53%), Query Frame = 2
Query:   41 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQPW 1255
            MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSE  S        ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS+DMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW
Sbjct:    1 MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSENGSS-------ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSDDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW 398          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Match: SMESG000018094.1 (SMESG000018094.1)

HSP 1 Score: 758.059 bits (1956), Expect = 0.000e+0
Identity = 390/401 (97.26%), Postives = 391/401 (97.51%), Query Frame = 2
Query:   53 MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQPW 1255
            MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSE  S        ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS+DMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW
Sbjct:    1 MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSENGSS-------ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSDDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW 394          
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Match: SMESG000018094.1 (SMESG000018094.1)

HSP 1 Score: 753.051 bits (1943), Expect = 0.000e+0
Identity = 387/401 (96.51%), Postives = 390/401 (97.26%), Query Frame = 2
Query:   53 MFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSEVISKDXXXXXXXXXXXXVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIXXXXXXXXXXXXLANNQPW 1255
            + +YGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSE  S        ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPS+DMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW
Sbjct:    3 IMKYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWRRLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNSDNLIDGLLSINSENGSS-------ANNLNAVPNSQNPSTRRRESGRWLGLGSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENALIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKPITFVPAIAQAIKQQVDSHPSDDMCNNQPDSRVIIRLNIHVGNISLVDQFEWDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFSESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLANNQPW 396          
The following BLAST results are available for this feature:
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMARCB14.677e-14754.90SWI/SNF related, matrix associated, actin dependen... [more]
SMARCB14.677e-14754.90SWI/SNF related, matrix associated, actin dependen... [more]
SMARCB19.125e-14653.72SWI/SNF related, matrix associated, actin dependen... [more]
SMARCB19.125e-14653.72SWI/SNF related, matrix associated, actin dependen... [more]
SMARCB17.739e-14152.58SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
snfc-55.504e-10243.86SNF chromatin remodeling Complex component [Sourc... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Snr15.741e-13654.11gene:FBgn0011715 transcript:FBtr0078682[more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
smarcb1a6.127e-14755.92SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1b1.452e-14655.67SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1b1.536e-14655.86SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1a1.536e-14655.86SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1b3.681e-14455.11SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
arhgap298.276e-14754.98Rho GTPase activating protein 29 [Source:Xenbase;A... [more]
arhgap291.587e-14453.39Rho GTPase activating protein 29 [Source:Xenbase;A... [more]
arhgap292.108e-14353.39Rho GTPase activating protein 29 [Source:Xenbase;A... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Smarcb13.211e-14754.90SWI/SNF related, matrix associated, actin dependen... [more]
Smarcb16.265e-14653.72SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6DFM1|SNF5_XENTR4.384e-14654.98SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q5U379|SNF5_DANRE1.159e-14555.86SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q6GQ82|SNF5_XENLA3.481e-14554.73SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q9Z0H3|SNF5_MOUSE4.382e-14553.72SWI/SNF-related matrix-associated actin-dependent ... [more]
sp|Q12824|SNF5_HUMAN4.382e-14553.72SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2MFB90.000e+061.00Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4P1V50.000e+061.76SWI/SNF-related matrix-associated actin-dependent ... [more]
A0A075A6N61.927e-17962.13Uncharacterized protein OS=Opisthorchis viverrini ... [more]
A0A0V0J2V79.159e-17763.38Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A504YSQ82.146e-17461.06SWI/SNF matrix-associated actin-dependent regulato... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smarcb1b1.448e-14655.42SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1b3.837e-14454.86SWI/SNF related, matrix associated, actin dependen... [more]
smarcb1b6.565e-10272.15SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
SMARCB12.786e-14455.11SWI/SNF related, matrix associated, actin dependen... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
SNF51.128e-2534.57Subunit of the SWI/SNF chromatin remodeling comple... [more]
SFH18.425e-2030.46Component of the RSC chromatin remodeling complex;... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO413113.977e-4464.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smarcb1b9.861e-14855.64SWI/SNF-related matrix-associated actin-dependent ... [more]
ENSORLT00000015725.22.207e-14555.67SWI/SNF-related matrix-associated actin-dependent ... [more]
ENSORLT00000015721.26.957e-10272.60SWI/SNF-related matrix-associated actin-dependent ... [more]
back to top
BLAST of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000018094.10.000e+099.75SMESG000018094.1[more]
SMESG000018094.10.000e+099.75SMESG000018094.1[more]
SMESG000018094.10.000e+097.28SMESG000018094.1[more]
SMESG000018094.10.000e+097.26SMESG000018094.1[more]
SMESG000018094.10.000e+096.51SMESG000018094.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016154 ID=SMED30016154|Name=SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1313bp
AAATATTAAATATCAATTTTTAATTTATTAAAATTTATAAATGGCAATTT
TAATGTTTAGATATGGTGAGAAACCAATTCCATTTCAATTTGAAGAGAAC
GATGAGTATTATTACTTGGCACAAGAAGTTGGACGATATATGAGATTATT
TCGAGGTGAAATTTTTAAAAAATATCCCAATCTTTGGAGGCGATTATTGA
ATGATGTGGAAAAGAAAAAAATTATTGATTTAGGATTGGCATCACCTATT
ACGGCTGTTAATGCTAATATTCTTAGAGCATTTGAAGTTGATGAATTACT
AGAAGGAAGAGAAGGAAGGTATAAAGTCAGTTGGAATTCTGATAATTTAA
TTGATGGACTCCTATCTATTAATTCAGAAGTTATTTCTAAAGATTTATTG
AATGGCAGTTCCGCAAATAATTTAAATGCGGTTCCTAATTCCCAAAATCC
TTCTACTCGGCGCAGAGAAAGTGGAAGATGGCTGGGTCTTGGATCAATGC
CGAATACATCATATCACCTTGATTCGGTACCTTGCCCAACCCCAGTTAAT
AGAAACAGAACAGGTAAAGTAGTAAATAAAGTGCAAAATTTCCCGTTTTG
CCTTGATGACAACGATCCAGTTTCTTTCCATGAGAACGCTTTGATAAAAG
AAGAGCTTGTACCGATCAGATTAGACATGGAAATGGACGGGGTGAAACTG
CGAGATTGTTTTACATGGAATAAAAACGAGCAGCTCATCACCCCTGAGCA
ATTTGCAGAAATTCTATGCGAAGATCTTGATCTTAAACCGATCACTTTTG
TACCTGCAATTGCCCAAGCAATTAAGCAGCAGGTTGATAGCCACCCGAGC
GAAGACATGTGCAATAATCAACCCGATAGCCGTGTCATTATTCGCCTAAA
TATCCACGTGGGCAACATCTCTCTAGTCGATCAGTTTGAGTGGGATCTAA
GTGAAGAAGATGAAAATTCACCCGAGAAATTTGCTCACAAACTTTGCTCC
GAAATGGGTTTAGGCGGAGAATTTGTTACCGGGGTCGCCTATAGCATTCG
CGGCCAATTGGCCTGGCACAACCGGTTATACGCATTTAGTGAATCTCGTT
TGCCAACTGTTGAAGTAGTTTTCCGTAACCATAATGAAGCTGACCAGTGG
AGCCCGATTGTTGAAATATTAACAGATGCTGAAATGGAGAAAAAAATTAG
AGATCAAGATAGAAACACGAGGAGGATGCGAAGATTGGCTAACAATCAGC
CTTGGTGACCAAGTCAAAATTAATTGTGTAATAATGTTTTATTTAAATAA
AGATTTGTTAAAT
back to top

protein sequence of SMED30016154-orf-1

>SMED30016154-orf-1 ID=SMED30016154-orf-1|Name=SMED30016154-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=406bp
MAILMFRYGEKPIPFQFEENDEYYYLAQEVGRYMRLFRGEIFKKYPNLWR
RLLNDVEKKKIIDLGLASPITAVNANILRAFEVDELLEGREGRYKVSWNS
DNLIDGLLSINSEVISKDLLNGSSANNLNAVPNSQNPSTRRRESGRWLGL
GSMPNTSYHLDSVPCPTPVNRNRTGKVVNKVQNFPFCLDDNDPVSFHENA
LIKEELVPIRLDMEMDGVKLRDCFTWNKNEQLITPEQFAEILCEDLDLKP
ITFVPAIAQAIKQQVDSHPSEDMCNNQPDSRVIIRLNIHVGNISLVDQFE
WDLSEEDENSPEKFAHKLCSEMGLGGEFVTGVAYSIRGQLAWHNRLYAFS
ESRLPTVEVVFRNHNEADQWSPIVEILTDAEMEKKIRDQDRNTRRMRRLA
NNQPW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000044cephalic ganglia
PLANA:0000099neuron
PLANA:0000208testis
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR006939SNF5
Vocabulary: biological process
TermDefinition
GO:0006338chromatin remodeling
Vocabulary: cellular component
TermDefinition
GO:0000228nuclear chromosome
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006939SNF5/SMARCB1/INI1PFAMPF04855SNF5coord: 272..394
e-value: 2.2E-29
score: 102.9
coord: 203..268
e-value: 9.7E-24
score: 84.5
IPR006939SNF5/SMARCB1/INI1PANTHERPTHR10019SNF5coord: 136..401