Phosphoribosyl pyrophosphate synthase-associated protein 2

Overview
NamePhosphoribosyl pyrophosphate synthase-associated protein 2
Smed IDSMED30016120
Length (bp)441
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (SMED30016120) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphoribosyl pyrophosphate synthase-associated protein 2 (SMED30016120) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphoribosyl pyrophosphate synthase-associated protein 2 (SMED30016120) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphoribosyl pyrophosphate synthase-associated protein 2 (SMED30016120) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016120

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016120h1SMcG0003654 SmedASXL_074614SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
epidermisSMED30016120h1SMcG0003654 dd_Smed_v4_15477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016120h1SMcG0003654 dd_Smed_v4_15477_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30016120h1SMcG0003654 dd_Smed_v4_4658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30016120h1SMcG0003654 dd_Smed_v4_4658_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 170.244 bits (430), Expect = 2.730e-54
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 170.244 bits (430), Expect = 2.730e-54
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 170.629 bits (431), Expect = 2.978e-54
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 170.629 bits (431), Expect = 1.166e-53
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Match: PRPSAP2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:HGNC Symbol;Acc:HGNC:9467])

HSP 1 Score: 171.014 bits (432), Expect = 2.009e-53
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11076043:1 gene:WBGene00012258.1 transcript:W04G3.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 167.162 bits (422), Expect = 2.103e-51
Identity = 71/136 (52.21%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   29 EPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + S G+VLL GNSH + A++V++ L + LG+  VY  +NRET+VDI +++RG+ V+I+Q+G+K+VNND+MELL++IY CKTS +++ITV MPY+PY KQ +M +R SI  +L+A+M+CKAG ++++++DL+ KEIQ
Sbjct:    6 DASSGMVLLTGNSHPELAKMVSERLEIRLGEATVYNKTNRETSVDIKQSVRGKHVFILQSGSKNVNNDVMELLVLIYACKTSMSKTITVIMPYLPYSKQCRMLRRSSIAMKLVAEMICKAGASRLVSLDLYKKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11075961:1 gene:WBGene00012258.1 transcript:W04G3.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 167.162 bits (422), Expect = 2.103e-51
Identity = 71/136 (52.21%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   29 EPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + S G+VLL GNSH + A++V++ L + LG+  VY  +NRET+VDI +++RG+ V+I+Q+G+K+VNND+MELL++IY CKTS +++ITV MPY+PY KQ +M +R SI  +L+A+M+CKAG ++++++DL+ KEIQ
Sbjct:    6 DASSGMVLLTGNSHPELAKMVSERLEIRLGEATVYNKTNRETSVDIKQSVRGKHVFILQSGSKNVNNDVMELLVLIYACKTSMSKTITVIMPYLPYSKQCRMLRRSSIAMKLVAEMICKAGASRLVSLDLYKKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Match: W04G3.5 (pep chromosome:WBcel235:X:11073658:11076043:1 gene:WBGene00012258.1 transcript:W04G3.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:W04G3.5)

HSP 1 Score: 166.777 bits (421), Expect = 2.643e-51
Identity = 71/136 (52.21%), Postives = 111/136 (81.62%), Query Frame = 2
Query:   29 EPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + S G+VLL GNSH + A++V++ L + LG+  VY  +NRET+VDI +++RG+ V+I+Q+G+K+VNND+MELL++IY CKTS +++ITV MPY+PY KQ +M +R SI  +L+A+M+CKAG ++++++DL+ KEIQ
Sbjct:    6 DASSGMVLLTGNSHPELAKMVSERLEIRLGEATVYNKTNRETSVDIKQSVRGKHVFILQSGSKNVNNDVMELLVLIYACKTSMSKTITVIMPYLPYSKQCRMLRRSSIAMKLVAEMICKAGASRLVSLDLYKKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7213176:7215226:1 gene:WBGene00020107.1 transcript:R151.2c.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 117.087 bits (292), Expect = 1.791e-32
Identity = 54/130 (41.54%), Postives = 85/130 (65.38%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + +G+SH D +  + + L + + K ++  +SN+ET V+I E++RG DVYIIQ+    +N+++MELLIMI  CK + +  +   +P  PY +Q K  K R  I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    5 VFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 134          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Match: R151.2 (pep chromosome:WBcel235:III:7211424:7215111:1 gene:WBGene00020107.1 transcript:R151.2b.4 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R151.2)

HSP 1 Score: 117.087 bits (292), Expect = 1.884e-32
Identity = 54/130 (41.54%), Postives = 85/130 (65.38%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + +G+SH D +  + + L + + K ++  +SN+ET V+I E++RG DVYIIQ+    +N+++MELLIMI  CK + +  +   +P  PY +Q K  K R  I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    6 VFSGSSHPDLSTRICERLQLEVSKASLKKFSNKETNVEIGESVRGEDVYIIQSAAGEINDNLMELLIMINACKIASSCRVAAVIPAFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0335445)

HSP 1 Score: 173.711 bits (439), Expect = 8.679e-54
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  +V++ GNSH D A +VA+ + +  G  +V+  SNRET V+I +++RG+D+YIIQTGTK  NN+IMELLIM Y CKTS ARSI   +PY+PY KQ KMRKRG IVS+L+AKM+C +G+  +ITMDLH KEIQ
Sbjct:    6 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302610)

HSP 1 Score: 173.711 bits (439), Expect = 9.047e-54
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  +V++ GNSH D A +VA+ + +  G  +V+  SNRET V+I +++RG+D+YIIQTGTK  NN+IMELLIM Y CKTS ARSI   +PY+PY KQ KMRKRG IVS+L+AKM+C +G+  +ITMDLH KEIQ
Sbjct:    6 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0085677)

HSP 1 Score: 173.711 bits (439), Expect = 9.047e-54
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  +V++ GNSH D A +VA+ + +  G  +V+  SNRET V+I +++RG+D+YIIQTGTK  NN+IMELLIM Y CKTS ARSI   +PY+PY KQ KMRKRG IVS+L+AKM+C +G+  +ITMDLH KEIQ
Sbjct:    6 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302609)

HSP 1 Score: 173.711 bits (439), Expect = 9.047e-54
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  +V++ GNSH D A +VA+ + +  G  +V+  SNRET V+I +++RG+D+YIIQTGTK  NN+IMELLIM Y CKTS ARSI   +PY+PY KQ KMRKRG IVS+L+AKM+C +G+  +ITMDLH KEIQ
Sbjct:    6 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Match: CG2246 (gene:FBgn0039790 transcript:FBtr0302608)

HSP 1 Score: 173.711 bits (439), Expect = 9.047e-54
Identity = 78/134 (58.21%), Postives = 103/134 (76.87%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  +V++ GNSH D A +VA+ + +  G  +V+  SNRET V+I +++RG+D+YIIQTGTK  NN+IMELLIM Y CKTS ARSI   +PY+PY KQ KMRKRG IVS+L+AKM+C +G+  +ITMDLH KEIQ
Sbjct:    6 TSDIVIINGNSHPDLANMVAERMGIKNGGCSVFHKSNRETIVEISDSVRGKDIYIIQTGTKDANNNIMELLIMAYACKTSSARSIVGVIPYLPYSKQCKMRKRGCIVSKLLAKMMCTSGLTHIITMDLHQKEIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 172.555 bits (436), Expect = 1.934e-55
Identity = 82/138 (59.42%), Postives = 103/138 (74.64%), Query Frame = 2
Query:   32 PSKGLVLLAGNSH---KDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            P  GLV+   NS+   ++ A  +A+ L V LGKV VY  +NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y C+TSCAR+I   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:    4 PKGGLVIFTANSNPSSRELARRIAERLGVELGKVQVYQEANRETRVQIEESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCARNIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 172.94 bits (437), Expect = 1.938e-53
Identity = 82/138 (59.42%), Postives = 103/138 (74.64%), Query Frame = 2
Query:   32 PSKGLVLLAGNSH---KDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            P  GLV+   NS+   ++ A  +A+ L V LGKV VY  +NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y C+TSCAR+I   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:    4 PKGGLVIFTANSNPSSRELARRIAERLGVELGKVQVYQEANRETRVQIEESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCARNIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 128.257 bits (321), Expect = 1.102e-36
Identity = 60/130 (46.15%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + +G+SH D ++ +A  L + LGKV    +SN+ET V+I E++RG DVYI+Q+G   +N+++MELLIMI  CK + A  +T  +P  PY +Q K  K R  I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    6 IFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 127.872 bits (320), Expect = 1.395e-36
Identity = 61/132 (46.21%), Postives = 89/132 (67.42%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGS---IVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + +G+SH D ++ +A  L + LGKV    +SN+ET V+I E++RG DVYI+Q+G   +N+++MELLIMI  CK + A  +T  +P  PY +Q K  K GS   I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    6 IFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKVGSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 137          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Match: prps1a (phosphoribosyl pyrophosphate synthetase 1A [Source:ZFIN;Acc:ZDB-GENE-011212-5])

HSP 1 Score: 128.257 bits (321), Expect = 1.919e-36
Identity = 60/130 (46.15%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + +G+SH D ++ +A  L + LGKV    +SN+ET V+I E++RG DVYI+Q+G   +N+++MELLIMI  CK + A  +T  +P  PY +Q K  K R  I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    6 IFSGSSHPDLSQKIADRLGLELGKVVTKKFSNQETCVEIGESVRGEDVYIVQSGCGEINDNLMELLIMINACKIASASRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Match: rab10 (RAB10, member RAS oncogene family [Source:Xenbase;Acc:XB-GENE-5947409])

HSP 1 Score: 170.244 bits (430), Expect = 4.736e-52
Identity = 82/135 (60.74%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V LGKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y C+TSCA++I+  +PY PY KQ KMRKRGSIVS+L+A M+CKAG+   ITMDLH KEIQ
Sbjct:   20 GLVLFSANSNASCVELAKRIAERLGVELGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCAKTISGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHFITMDLHQKEIQ 154          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 140.198 bits (352), Expect = 1.492e-40
Identity = 71/135 (52.59%), Postives = 91/135 (67.41%), Query Frame = 2
Query:   41 GLVLLAGNSHK---DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS +   + A+ + + L   LGK  VY  SN ET V+I E++RG +++IIQT  + VN  IMELLIM Y  KTSCA SI   +PY PY KQSKMRKRGSIV +L+A M+  AG+  +ITMDLH KEIQ
Sbjct:   15 GYRVFSANSSEACMELAKKITERLGAELGKAVVYQESNGETRVEIKESVRGHNIFIIQTIPRDVNTAIMELLIMAYALKTSCANSIIGVIPYFPYSKQSKMRKRGSIVCKLLASMMSDAGLTHIITMDLHQKEIQ 149          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 140.198 bits (352), Expect = 1.628e-40
Identity = 71/135 (52.59%), Postives = 91/135 (67.41%), Query Frame = 2
Query:   41 GLVLLAGNSHK---DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS +   + A+ + + L   LGK  VY  SN ET V+I E++RG +++IIQT  + VN  IMELLIM Y  KTSCA SI   +PY PY KQSKMRKRGSIV +L+A M+  AG+  +ITMDLH KEIQ
Sbjct:   21 GYRVFSANSSEACMELAKKITERLGAELGKAVVYQESNGETRVEIKESVRGHNIFIIQTIPRDVNTAIMELLIMAYALKTSCANSIIGVIPYFPYSKQSKMRKRGSIVCKLLASMMSDAGLTHIITMDLHQKEIQ 155          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 139.813 bits (351), Expect = 1.831e-40
Identity = 71/135 (52.59%), Postives = 91/135 (67.41%), Query Frame = 2
Query:   41 GLVLLAGNSHK---DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS +   + A+ + + L   LGK  VY  SN ET V+I E++RG +++IIQT  + VN  IMELLIM Y  KTSCA SI   +PY PY KQSKMRKRGSIV +L+A M+  AG+  +ITMDLH KEIQ
Sbjct:   34 GYRVFSANSSEACMELAKKITERLGAELGKAVVYQESNGETRVEIKESVRGHNIFIIQTIPRDVNTAIMELLIMAYALKTSCANSIIGVIPYFPYSKQSKMRKRGSIVCKLLASMMSDAGLTHIITMDLHQKEIQ 168          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Match: lmbrd2 (LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-GENE-991215])

HSP 1 Score: 139.428 bits (350), Expect = 3.042e-40
Identity = 71/135 (52.59%), Postives = 91/135 (67.41%), Query Frame = 2
Query:   41 GLVLLAGNSHK---DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS +   + A+ + + L   LGK  VY  SN ET V+I E++RG +++IIQT  + VN  IMELLIM Y  KTSCA SI   +PY PY KQSKMRKRGSIV +L+A M+  AG+  +ITMDLH KEIQ
Sbjct:   22 GYRVFSANSSEACMELAKKITERLGAELGKAVVYQESNGETRVEIKESVRGHNIFIIQTIPRDVNTAIMELLIMAYALKTSCANSIIGVIPYFPYSKQSKMRKRGSIVCKLLASMMSDAGLTHIITMDLHQKEIQ 156          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Match: Prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:MGI Symbol;Acc:MGI:2384838])

HSP 1 Score: 170.629 bits (431), Expect = 2.672e-52
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Match: Prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:MGI Symbol;Acc:MGI:2384838])

HSP 1 Score: 170.629 bits (431), Expect = 2.672e-52
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Match: Prpsap1 (phosphoribosyl pyrophosphate synthetase-associated protein 1 [Source:MGI Symbol;Acc:MGI:1915013])

HSP 1 Score: 142.124 bits (357), Expect = 2.168e-43
Identity = 67/117 (57.26%), Postives = 87/117 (74.36%), Query Frame = 2
Query:   86 LVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            ++++ L   LGK  VY  +N ET V+I E++RG+D++IIQT  + VN  +MELLIM Y  KT+CAR+I   +PY PY KQSKMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:   18 VLSRRLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 134          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Match: Prpsap1 (phosphoribosyl pyrophosphate synthetase-associated protein 1 [Source:MGI Symbol;Acc:MGI:1915013])

HSP 1 Score: 144.05 bits (362), Expect = 5.286e-42
Identity = 68/121 (56.20%), Postives = 88/121 (72.73%), Query Frame = 2
Query:   74 DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + A+ + + L   LGK  VY  +N ET V+I E++RG+D++IIQT  + VN  +MELLIM Y  KT+CAR+I   +PY PY KQSKMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:   50 ELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 170          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Match: Prpsap1 (phosphoribosyl pyrophosphate synthetase-associated protein 1 [Source:MGI Symbol;Acc:MGI:1915013])

HSP 1 Score: 137.117 bits (344), Expect = 3.181e-41
Identity = 71/140 (50.71%), Postives = 93/140 (66.43%), Query Frame = 2
Query:   41 GLVLLAGNSHK---DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGT-----KSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS     + A+ + + L   LGK  VY  +N ET V+I E++RG+D++IIQT       + VN  +MELLIM Y  KT+CAR+I   +PY PY KQSKMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:   36 GYRVFSANSTAACTELAKRITERLGAELGKSVVYQETNGETRVEIKESVRGQDIFIIQTIPSFYCFRDVNTAVMELLIMAYALKTACARNIIGVIPYFPYSKQSKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 175          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Match: sp|O08618|KPRB_RAT (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Rattus norvegicus OX=10116 GN=Prpsap2 PE=1 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 1.384e-51
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Match: sp|O60256|KPRB_HUMAN (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Homo sapiens OX=9606 GN=PRPSAP2 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.460e-51
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Match: sp|Q5ZL26|KPRB_CHICK (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Gallus gallus OX=9031 GN=PRPSAP2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.643e-51
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKRIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Match: sp|Q5RBA8|KPRB_PONAB (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Pongo abelii OX=9601 GN=PRPSAP2 PE=2 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.661e-51
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Match: sp|Q8R574|KPRB_MOUSE (Phosphoribosyl pyrophosphate synthase-associated protein 2 OS=Mus musculus OX=10090 GN=Prpsap2 PE=1 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 1.869e-51
Identity = 83/135 (61.48%), Postives = 101/135 (74.81%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLVL + NS+    EL   +A+ L V +GKV VY   NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y CKTSCA+SI   +PY PY KQ KMRKRGSIVS+L+A M+CKAG+  +ITMDLH KEIQ
Sbjct:   19 GLVLFSANSNSSCMELSKKIAERLGVEMGKVQVYQEPNRETRVQIQESVRGKDVFIIQTISKDVNTTIMELLIMVYACKTSCAKSIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLTHLITMDLHQKEIQ 153          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Match: A0A1I8JA31 (Pribosyltran_N domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 4.158e-63
Identity = 95/135 (70.37%), Postives = 117/135 (86.67%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            PSKG+VLLAGNSH +FA+LVA++L+V LG V+V   SN ET V+I ET+R RDVYIIQTGTK+VNNDIMELL+M+Y CKTS AR+I V MPY+PYCKQSKMRKRGSIVS L+A++ C+ G+N++IT+DLH KEIQ
Sbjct:   46 PSKGMVLLAGNSHPEFAKLVAKYLSVPLGSVSVGPKSNNETGVEINETVRSRDVYIIQTGTKNVNNDIMELLVMMYACKTSDARTINVIMPYLPYCKQSKMRKRGSIVSHLLARLFCRTGLNRMITIDLHKKEIQ 180          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Match: A0A267H439 (Pribosyltran_N domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig003166g1 PE=4 SV=1)

HSP 1 Score: 207.608 bits (527), Expect = 9.079e-63
Identity = 95/135 (70.37%), Postives = 117/135 (86.67%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            PSKG+VLLAGNSH +FA+LVA++L+V LG V+V   SN ET V+I ET+R RDVYIIQTGTK+VNNDIMELL+M+Y CKTS AR+I V MPY+PYCKQSKMRKRGSIVS L+A++ C+ G+N++IT+DLH KEIQ
Sbjct:   39 PSKGMVLLAGNSHPEFAKLVAKYLSVPLGSVSVGPKSNNETGVEINETVRSRDVYIIQTGTKNVNNDIMELLVMMYACKTSDARTINVIMPYLPYCKQSKMRKRGSIVSHLLARLFCRTGLNRMITIDLHKKEIQ 173          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Match: A0A267F7Q9 (Pribosyltran_N domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010632g1 PE=4 SV=1)

HSP 1 Score: 205.682 bits (522), Expect = 2.336e-62
Identity = 94/135 (69.63%), Postives = 117/135 (86.67%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            PSKG+VL+AGNSH +FA+LVA++L+V LG V+V   SN ET V+I ET+R RDVYIIQTGTK+VNNDIMELL+M+Y CKTS AR+I V MPY+PYCKQSKMRKRGSIVS L+A++ C+ G+N++IT+DLH KEIQ
Sbjct:   10 PSKGMVLIAGNSHPEFAKLVAKYLSVPLGSVSVGPKSNNETGVEINETVRSRDVYIIQTGTKNVNNDIMELLVMMYACKTSDARTINVIMPYLPYCKQSKMRKRGSIVSHLLARLFCRTGLNRMITIDLHKKEIQ 144          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Match: A0A267H4J1 (Pribosyltran_N domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001204g2 PE=4 SV=1)

HSP 1 Score: 206.068 bits (523), Expect = 4.158e-62
Identity = 94/135 (69.63%), Postives = 117/135 (86.67%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            PSKG+VL+AGNSH +FA+LVA++L+V LG V+V   SN ET V+I ET+R RDVYIIQTGTK+VNNDIMELL+M+Y CKTS AR+I V MPY+PYCKQSKMRKRGSIVS L+A++ C+ G+N++IT+DLH KEIQ
Sbjct:   41 PSKGMVLIAGNSHPEFAKLVAKYLSVPLGSVSVGPKSNNETGVEINETVRSRDVYIIQTGTKNVNNDIMELLVMMYACKTSDARTINVIMPYLPYCKQSKMRKRGSIVSHLLARLFCRTGLNRMITIDLHKKEIQ 175          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Match: A0A2H1C393 (Pribosyltran_N domain-containing protein OS=Fasciola hepatica OX=6192 GN=D915_11140 PE=4 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.514e-60
Identity = 86/135 (63.70%), Postives = 111/135 (82.22%), Query Frame = 2
Query:   35 SKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQV 439
            S+G+V+LAGNSH +    V +HL+V  GK +VYF +NRETAV++ ET+RGRDVYIIQ+GTK VNNDIMELLI+ +  +T+CAR +   MPY+PYCKQSK RKRG I S+L+AKMLC +G++ +IT+DLHAKEIQV
Sbjct:   24 SRGMVILAGNSHPELVNCVCRHLDVQPGKCSVYFRTNRETAVELRETVRGRDVYIIQSGTKDVNNDIMELLILAHASRTACARKVVAVMPYLPYCKQSKRRKRGPITSKLVAKMLCASGIDHLITLDLHAKEIQV 158          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase associated protein 2 [Source:NCBI gene;Acc:103041258])

HSP 1 Score: 170.244 bits (430), Expect = 1.792e-52
Identity = 82/135 (60.74%), Postives = 102/135 (75.56%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLV+   NS+    EL   +A+ L V LGKV VY  +NRET V I E++RG+DV+IIQT +K VN  IMELLIM+Y C+TSCAR+I   +PY PY KQ KMRKRGSIVS+L+A M+CKAG++ +ITMDLH KEIQ
Sbjct:    7 GLVIFTANSNPSSRELGKRIAERLGVELGKVQVYQEANRETRVQIQESVRGKDVFIIQTVSKDVNTTIMELLIMVYACRTSCARNIIGVIPYFPYSKQCKMRKRGSIVSKLLASMMCKAGLSHLITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 148.673 bits (374), Expect = 6.378e-44
Identity = 75/135 (55.56%), Postives = 93/135 (68.89%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAELVAQ---HLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            G  + + NS    +EL  Q    L V LGK  VY  SNRET VD+ E++RG+D++IIQT  + VN  IMELL+M Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:    7 GYRVFSANSTPAGSELAKQITERLGVELGKSVVYQESNRETRVDVKESVRGQDIFIIQTMPRDVNTAIMELLVMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 145.976 bits (367), Expect = 3.692e-43
Identity = 70/117 (59.83%), Postives = 87/117 (74.36%), Query Frame = 2
Query:   86 LVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            L+ + L V LGK  VY  SNRET VD+ E++RG+D++IIQT  + VN  IMELL+M Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:    6 LLLRRLGVELGKSVVYQESNRETRVDVKESVRGQDIFIIQTMPRDVNTAIMELLVMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 122          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Match: PRPSAP1 (phosphoribosyl pyrophosphate synthetase associated protein 1 [Source:NCBI gene;Acc:103025091])

HSP 1 Score: 145.976 bits (367), Expect = 4.412e-43
Identity = 70/117 (59.83%), Postives = 87/117 (74.36%), Query Frame = 2
Query:   86 LVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            L+ + L V LGK  VY  SNRET VD+ E++RG+D++IIQT  + VN  IMELL+M Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:    6 LLLRRLGVELGKSVVYQESNRETRVDVKESVRGQDIFIIQTMPRDVNTAIMELLVMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 122          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Match: prpsap1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:103035713])

HSP 1 Score: 142.895 bits (359), Expect = 7.383e-42
Identity = 71/138 (51.45%), Postives = 93/138 (67.39%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            P  G  + + NS     EL   + + L V LGK  VY  +N ET VD+ E++RG+ ++IIQT  + VN  IME+L+M Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG++ +ITMDLH KEIQ
Sbjct:    4 PKSGYRVFSANSTPACTELAKKITERLGVELGKSVVYQEANTETRVDVKESVRGQSIFIIQTIPRDVNTAIMEMLVMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLSHIITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Sea Lamprey
Match: prpsap2 (phosphoribosyl pyrophosphate synthetase-associated protein 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2077])

HSP 1 Score: 147.902 bits (372), Expect = 1.159e-44
Identity = 70/112 (62.50%), Postives = 83/112 (74.11%), Query Frame = 2
Query:  101 LNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            L+  LGK  VY   NRET V I +++RG+DV+IIQT  + VN  +MELLIM Y CKTS AR+I   +PY PY K SKMRKRGSIV +L+A MLCKAGM  +ITMDLH KEIQ
Sbjct:    2 LSTDLGKAQVYQEPNRETRVHIQQSVRGKDVFIIQTCPRDVNTAVMELLIMTYACKTSAARNIIGVVPYFPYSKHSKMRKRGSIVCKLLASMLCKAGMTHLITMDLHQKEIQ 113          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Match: PRS4 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS4 has a paralog, PRS2, that arose from the whole genome duplication; a missense mutation in the conserved residue R196 of its human homolog PRPS1 is pathogenic [Source:SGD;Acc:S000000164])

HSP 1 Score: 140.584 bits (353), Expect = 3.824e-42
Identity = 70/132 (53.03%), Postives = 92/132 (69.70%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQT--GTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            LLAGNSH D AE +++ L + L KV VY YSN+ET+V I E+LR  DVYIIQT  G + +N+ +MELLI+I+ CK + AR IT  +P  PY +Q K  K R  I ++L+A +L  AG + VITMDLHA +IQ
Sbjct:   16 LLAGNSHPDLAEQISKKLGIPLSKVGVYQYSNKETSVTIGESLRDEDVYIIQTGIGEQEINDFLMELLILIHACKIASARKITTVIPNFPYARQDKKDKSRAPITAKLVANLLQTAGADHVITMDLHASQIQ 147          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Match: PRS2 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase, synthesizes PRPP; which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; PRS2 has a paralog, PRS4, that arose from the whole genome duplication [Source:SGD;Acc:S000000901])

HSP 1 Score: 139.813 bits (351), Expect = 6.280e-42
Identity = 71/132 (53.79%), Postives = 91/132 (68.94%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQT--GTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            LLAGNSH   AEL++Q L V L KV VY YSN+ET+V I E++R  DVYIIQT  G   +N+ +MELLI+I+ CKT+  R IT  +P  PY +Q K  K R  I ++L+A +L  AG + VITMDLHA +IQ
Sbjct:    8 LLAGNSHPGLAELISQRLGVPLSKVGVYQYSNKETSVTIGESIRDEDVYIIQTGYGEHEINDFLMELLILIHACKTASVRRITAVIPNFPYARQDKKDKSRAPITAKLIANLLETAGCDHVITMDLHASQIQ 139          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Match: PRS1 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; plays a key role in cell wall integrity (CWI) pathway; one of five related enzymes, which are active as heteromultimeric complexes; missense mutations in human homolog PRPS1 are associated with neuropathic Arts syndrome and Charcot-Marie Tooth (CMTX5) disease [Source:SGD;Acc:S000001664])

HSP 1 Score: 122.865 bits (307), Expect = 1.331e-34
Identity = 55/130 (42.31%), Postives = 85/130 (65.38%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKM-RKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  GNSH +   +V Q L +      +  ++N ET+V I  ++R  DVY+IQ+G+ S+N+DIMELLI++  C+   AR IT  +P  PY KQ KM R RG+I ++++A +L  AG + V++MDLHA ++Q
Sbjct:    6 IFVGNSHPELGNMVCQRLGIEPAPCTLKKFANGETSVQIGVSVRDEDVYVIQSGSPSINDDIMELLILVSACRGGSARKITAVIPQFPYSKQCKMKRHRGAITARMLANLLVMAGADHVVSMDLHASQMQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Match: PRS3 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes [Source:SGD;Acc:S000001003])

HSP 1 Score: 110.538 bits (275), Expect = 1.176e-30
Identity = 59/137 (43.07%), Postives = 84/137 (61.31%), Query Frame = 2
Query:   32 PSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYII-QTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            P+  + LLA + H+  AELVA+ L + L    +      E +  I E++R +D++II Q G+  VN+ ++ELLIMI   KT+ AR IT  +P  PY +Q +  K R  I ++LMA ML  AG + VITMDLHA +IQ
Sbjct:    2 PTNSIKLLAPDVHRGLAELVAKRLGLQLTSSKLKRDPTGEVSFSIGESVRDQDIFIITQIGSGVVNDRVLELLIMINASKTASARRITAIIPNFPYARQDRKDKSRAPITAKLMADMLTTAGCDHVITMDLHASQIQ 138          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Match: PRS5 (5-phospho-ribosyl-1(alpha)-pyrophosphate synthetase; synthesizes PRPP, which is required for nucleotide, histidine, and tryptophan biosynthesis; one of five related enzymes, which are active as heteromultimeric complexes; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000005422])

HSP 1 Score: 82.8037 bits (203), Expect = 7.724e-20
Identity = 36/97 (37.11%), Postives = 62/97 (63.92%), Query Frame = 2
Query:   44 LVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKM 334
            +V+  G+SH +    + ++L++   KV +  +SN ET + + E++R +DVYIIQ+G   VN+  M+LLI+I  CK++ A  +T  MPY+ Y +Q  +
Sbjct:    6 IVVFGGDSHPELVTKICENLDIHPSKVELGKFSNGETNIALRESVREKDVYIIQSGCGQVNDTFMQLLILISACKSASASRVTAVMPYLCYSRQPDI 102          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Nematostella
Match: EDO48023 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKP7])

HSP 1 Score: 136.346 bits (342), Expect = 1.197e-39
Identity = 68/142 (47.89%), Postives = 100/142 (70.42%), Query Frame = 2
Query:   23 TMEPSKGLVLLAG-NSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTG---TKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
             ++P++G VL+   N+ K+ +E +A+ L V    V+V  ++N+E+ V I  ++RGRDV+IIQTG     + NN +MELLIM Y C+ + AR I   +PY+PY KQSKM KRG+I ++LMA +L K+G+  +ITMDLH+KEIQ
Sbjct:    2 AVDPTQGGVLVFSLNTAKELSESIARRLGVLPAPVHVGQFANKESKVHIGVSVRGRDVFIIQTGQGEETTCNNAMMELLIMAYACRIASARRIVGVIPYLPYSKQSKMHKRGAIPAKLMASLLGKSGLTSIITMDLHSKEIQ 143          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Nematostella
Match: EDO47117 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNC7])

HSP 1 Score: 124.79 bits (312), Expect = 1.185e-35
Identity = 60/130 (46.15%), Postives = 86/130 (66.15%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            +  G+SH   A L+A+ L   L K  +  +SN+ET V+I E++RG DVYIIQ+G   +N+++MELLIMI  CK + A+ +T  +P  PY +Q K  K R  I ++L+A ML  AG + +ITMDLHA +IQ
Sbjct:    6 IFGGSSHPVLARLIAERLGFDLAKCVLKKFSNQETCVEIAESVRGEDVYIIQSGCGEINDNMMELLIMINACKIASAQRVTAVIPCFPYARQDKKDKSRAPISAKLVANMLSVAGADHIITMDLHASQIQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Match: prpsap2 (phosphoribosyl pyrophosphate synthase-associated protein 2 [Source:NCBI gene;Acc:101168959])

HSP 1 Score: 176.407 bits (446), Expect = 6.952e-55
Identity = 84/135 (62.22%), Postives = 102/135 (75.56%), Query Frame = 2
Query:   41 GLVLLAGNSHKDFAEL---VAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            GLV+   NSH    EL   +A+ L V LGKV VY  +NRET V I E++RG+DV++IQT +K VN  IME+LIM+Y C+TSCARSIT  +PY PY KQ KMRKRGSIVS+LMA M+CKAG+  +ITMDLH KEIQ
Sbjct:    7 GLVIFTANSHASSRELGKRIAERLGVELGKVQVYQEANRETRVQIQESVRGKDVFVIQTVSKDVNTTIMEMLIMVYACRTSCARSITGVLPYFPYSKQCKMRKRGSIVSKLMASMMCKAGLTHLITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Match: prpsap2 (phosphoribosyl pyrophosphate synthase-associated protein 2 [Source:NCBI gene;Acc:101168959])

HSP 1 Score: 144.436 bits (363), Expect = 1.419e-42
Identity = 65/100 (65.00%), Postives = 81/100 (81.00%), Query Frame = 2
Query:  137 YSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            ++  ET V I E++RG+DV++IQT +K VN  IME+LIM+Y C+TSCARSIT  +PY PY KQ KMRKRGSIVS+LMA M+CKAG+  +ITMDLH KEIQ
Sbjct:   31 HTKGETRVQIQESVRGKDVFVIQTVSKDVNTTIMEMLIMVYACRTSCARSITGVLPYFPYSKQCKMRKRGSIVSKLMASMMCKAGLTHLITMDLHQKEIQ 130          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Match: ENSORLT00000015651.2 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101163819])

HSP 1 Score: 142.51 bits (358), Expect = 1.173e-41
Identity = 68/121 (56.20%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   74 DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + A+ + + L V LGK  V+   NRET VD+ E++RG+ ++IIQT  + VN  IMELLIM Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:   21 ELAKKITERLGVELGKSVVFQEPNRETRVDVKESVRGQTIFIIQTIPRDVNTAIMELLIMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Match: ENSORLT00000042972.1 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101163819])

HSP 1 Score: 142.51 bits (358), Expect = 1.330e-41
Identity = 68/121 (56.20%), Postives = 87/121 (71.90%), Query Frame = 2
Query:   74 DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + A+ + + L V LGK  V+   NRET VD+ E++RG+ ++IIQT  + VN  IMELLIM Y  KTSCA++I   +PY PY KQ KMRKRGSIV +L+A ML KAG+  +ITMDLH KEIQ
Sbjct:   21 ELAKKITERLGVELGKSVVFQEPNRETRVDVKESVRGQTIFIIQTIPRDVNTAIMELLIMAYALKTSCAKNIIGVIPYFPYSKQCKMRKRGSIVCKLLASMLAKAGLTHIITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Match: ENSORLT00000000265.2 (phosphoribosyl pyrophosphate synthase-associated protein 1 [Source:NCBI gene;Acc:101162980])

HSP 1 Score: 141.739 bits (356), Expect = 2.365e-41
Identity = 67/121 (55.37%), Postives = 88/121 (72.73%), Query Frame = 2
Query:   74 DFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + A+ + + L V LGK  V+  SN ET VD+ E++RG+DV+IIQT  + VN  IMELL+M Y  K++CAR+I   +PY PY KQ K+RKRGS+V +L+A ML KAG + VITMDLH KEIQ
Sbjct:   21 ELAKKITERLGVELGKSVVFQESNSETKVDLKESVRGQDVFIIQTIPRDVNTAIMELLVMTYALKSACARNIIGVVPYFPYSKQCKLRKRGSVVCKLLASMLAKAGASHVITMDLHQKEIQ 141          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 288.5 bits (737), Expect = 7.398e-99
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 2
Query:   26 MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ
Sbjct:    1 MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 137          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Planmine SMEST
Match: SMESG000007561.1 (SMESG000007561.1)

HSP 1 Score: 288.5 bits (737), Expect = 7.831e-99
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 2
Query:   26 MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ
Sbjct:    1 MEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 137          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Planmine SMEST
Match: SMESG000008493.1 (SMESG000008493.1)

HSP 1 Score: 129.028 bits (323), Expect = 1.144e-37
Identity = 63/130 (48.46%), Postives = 88/130 (67.69%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + AG+S+   A+ +++ + + LG+V    +SN ET V+I E++RG DVYIIQTG+  VN+++MELLIMI  CK + A  IT  MP  PY +Q K  K R  I ++L+A ML  AG N +ITMDLHA +IQ
Sbjct:    6 VFAGSSNTSLAQKISERIGIKLGEVISKKFSNEETCVEIRESVRGEDVYIIQTGSGEVNDNLMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLSVAGANHIITMDLHASQIQ 135          
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Planmine SMEST
Match: SMESG000008469.1 (SMESG000008469.1)

HSP 1 Score: 128.257 bits (321), Expect = 1.940e-37
Identity = 63/130 (48.46%), Postives = 87/130 (66.92%), Query Frame = 2
Query:   50 LLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRETAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAMPYMPYCKQSKMRK-RGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQ 436
            + AG+S+   A+ +++ + + LG V    +SN ET V+I E++RG DVYIIQTG+  VN+++MELLIMI  CK + A  IT  MP  PY +Q K  K R  I ++L+A ML  AG N +ITMDLHA +IQ
Sbjct:    6 VFAGSSNTSLAQKISERIGIKLGDVISKKFSNEETCVEIRESVRGEDVYIIQTGSGEVNDNLMELLIMINACKNASASRITAVMPCFPYARQDKKDKSRAPISAKLVANMLSVAGANHIITMDLHASQIQ 135          
The following BLAST results are available for this feature:
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRPSAP22.730e-5461.48phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP22.730e-5461.48phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP22.978e-5461.48phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP21.166e-5361.48phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP22.009e-5361.48phosphoribosyl pyrophosphate synthetase associated... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
W04G3.52.103e-5152.21pep chromosome:WBcel235:X:11073658:11076043:1 gene... [more]
W04G3.52.103e-5152.21pep chromosome:WBcel235:X:11073658:11075961:1 gene... [more]
W04G3.52.643e-5152.21pep chromosome:WBcel235:X:11073658:11076043:1 gene... [more]
R151.21.791e-3241.54pep chromosome:WBcel235:III:7213176:7215226:1 gene... [more]
R151.21.884e-3241.54pep chromosome:WBcel235:III:7211424:7215111:1 gene... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG22468.679e-5458.21gene:FBgn0039790 transcript:FBtr0335445[more]
CG22469.047e-5458.21gene:FBgn0039790 transcript:FBtr0302610[more]
CG22469.047e-5458.21gene:FBgn0039790 transcript:FBtr0085677[more]
CG22469.047e-5458.21gene:FBgn0039790 transcript:FBtr0302609[more]
CG22469.047e-5458.21gene:FBgn0039790 transcript:FBtr0302608[more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpsap21.934e-5559.42phosphoribosyl pyrophosphate synthetase-associated... [more]
prpsap21.938e-5359.42phosphoribosyl pyrophosphate synthetase-associated... [more]
prps1a1.102e-3646.15phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1a1.395e-3646.21phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
prps1a1.919e-3646.15phosphoribosyl pyrophosphate synthetase 1A [Source... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rab104.736e-5260.74RAB10, member RAS oncogene family [Source:Xenbase;... [more]
lmbrd21.492e-4052.59LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd21.628e-4052.59LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd21.831e-4052.59LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
lmbrd23.042e-4052.59LMBR1 domain containing 2 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prpsap22.672e-5261.48phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap22.672e-5261.48phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap12.168e-4357.26phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap15.286e-4256.20phosphoribosyl pyrophosphate synthetase-associated... [more]
Prpsap13.181e-4150.71phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O08618|KPRB_RAT1.384e-5161.48Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|O60256|KPRB_HUMAN1.460e-5161.48Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q5ZL26|KPRB_CHICK1.643e-5161.48Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q5RBA8|KPRB_PONAB1.661e-5161.48Phosphoribosyl pyrophosphate synthase-associated p... [more]
sp|Q8R574|KPRB_MOUSE1.869e-5161.48Phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8JA314.158e-6370.37Pribosyltran_N domain-containing protein OS=Macros... [more]
A0A267H4399.079e-6370.37Pribosyltran_N domain-containing protein (Fragment... [more]
A0A267F7Q92.336e-6269.63Pribosyltran_N domain-containing protein OS=Macros... [more]
A0A267H4J14.158e-6269.63Pribosyltran_N domain-containing protein (Fragment... [more]
A0A2H1C3931.514e-6063.70Pribosyltran_N domain-containing protein OS=Fascio... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpsap21.792e-5260.74phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP16.378e-4455.56phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP13.692e-4359.83phosphoribosyl pyrophosphate synthetase associated... [more]
PRPSAP14.412e-4359.83phosphoribosyl pyrophosphate synthetase associated... [more]
prpsap17.383e-4251.45phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
prpsap21.159e-4462.50phosphoribosyl pyrophosphate synthetase-associated... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PRS43.824e-4253.035-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS26.280e-4253.795-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS11.331e-3442.315-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS31.176e-3043.075-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
PRS57.724e-2037.115-phospho-ribosyl-1(alpha)-pyrophosphate synthetas... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO480231.197e-3947.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471171.185e-3546.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prpsap26.952e-5562.22phosphoribosyl pyrophosphate synthase-associated p... [more]
prpsap21.419e-4265.00phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000015651.21.173e-4156.20phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000042972.11.330e-4156.20phosphoribosyl pyrophosphate synthase-associated p... [more]
ENSORLT00000000265.22.365e-4155.37phosphoribosyl pyrophosphate synthase-associated p... [more]
back to top
BLAST of Phosphoribosyl pyrophosphate synthase-associated protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000007561.17.398e-99100.00SMESG000007561.1[more]
SMESG000007561.17.831e-99100.00SMESG000007561.1[more]
SMESG000008493.11.144e-3748.46SMESG000008493.1[more]
SMESG000008469.11.940e-3748.46SMESG000008469.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016120 ID=SMED30016120|Name=Phosphoribosyl pyrophosphate synthase-associated protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=441bp
CAATACTGTCAAAGTTAAATTCACAATGGAACCGTCCAAAGGATTAGTAT
TATTAGCAGGAAATTCACATAAAGATTTTGCTGAACTTGTTGCTCAACAC
TTAAATGTCTCATTAGGTAAAGTAAATGTTTATTTTTATTCGAACAGAGA
AACTGCAGTTGATATATATGAAACATTGAGAGGAAGAGATGTTTATATTA
TTCAAACTGGCACTAAAAGTGTCAATAATGATATTATGGAGTTACTTATT
ATGATATATGGATGCAAAACATCTTGTGCAAGATCAATCACTGTTGCAAT
GCCTTATATGCCATATTGTAAGCAGTCTAAAATGCGCAAAAGAGGATCGA
TTGTTAGTCAGCTTATGGCAAAAATGCTTTGCAAAGCTGGAATGAATCAA
GTTATAACAATGGACTTGCATGCCAAAGAAATTCAAGTAAT
back to top

protein sequence of SMED30016120-orf-1

>SMED30016120-orf-1 ID=SMED30016120-orf-1|Name=SMED30016120-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=146bp
NTVKVKFTMEPSKGLVLLAGNSHKDFAELVAQHLNVSLGKVNVYFYSNRE
TAVDIYETLRGRDVYIIQTGTKSVNNDIMELLIMIYGCKTSCARSITVAM
PYMPYCKQSKMRKRGSIVSQLMAKMLCKAGMNQVITMDLHAKEIQV
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002056medial muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR005946Rib-P_diPkinase
IPR029057PRTase-like
IPR029099Pribosyltran_N
Vocabulary: molecular function
TermDefinition
GO:0000287magnesium ion binding
GO:0004749ribose phosphate diphosphokinase activity
Vocabulary: biological process
TermDefinition
GO:0009116nucleoside metabolic process
GO:0009165nucleotide biosynthetic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM01400Pribosyltran_N_2coord: 15..130
e-value: 5.3E-47
score: 172.1
NoneNo IPR availablePANTHERPTHR10210:SF53coord: 13..145
IPR029099Ribose-phosphate pyrophosphokinase, N-terminal domainPFAMPF13793Pribosyltran_Ncoord: 15..130
e-value: 1.1E-36
score: 125.3
IPR005946Ribose-phosphate pyrophosphokinaseTIGRFAMTIGR01251TIGR01251coord: 16..145
e-value: 2.3E-35
score: 119.9
IPR005946Ribose-phosphate pyrophosphokinasePANTHERPTHR10210RIBOSE-PHOSPHATE DIPHOSPHOKINASE FAMILY MEMBERcoord: 13..145
IPR029057Phosphoribosyltransferase-likeGENE3DG3DSA:3.40.50.2020coord: 14..146
e-value: 5.5E-49
score: 167.7
IPR029057Phosphoribosyltransferase-likeSUPERFAMILYSSF53271PRTase-likecoord: 14..145