DthoxE protein

Overview
NameDthoxE protein
Smed IDSMED30016117
Length (bp)1121
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DthoxE protein (SMED30016117) t-SNE clustered cells

Violin plots show distribution of expression levels for DthoxE protein (SMED30016117) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DthoxE protein (SMED30016117) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DthoxE protein (SMED30016117) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016117

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
central nervous systemSMED30016117SMESG000079807.1 SmedASXL_002885SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30016117SMESG000079807.1 SmedASXL_002885SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
central nervous systemSMED30016117SMESG000079807.1 Smed-lox5bsmed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30016117SMESG000079807.1 Smed-lox5bsmed_ncbi_20200123PMID:27034770
Currie et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
reproductive organSMED30016117SMESG000079807.1 Contig6820newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30016117SMESG000079807.1 Contig6820uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DthoxE protein vs. Ensembl Human
Match: HOXB7 (homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118])

HSP 1 Score: 134.035 bits (336), Expect = 9.556e-37
Identity = 63/86 (73.26%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S +D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAH L LTERQIKIWFQNRRMKWKK++   K  GPGT
Sbjct:  126 IYPWMR-----SSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTAGPGT 203          
BLAST of DthoxE protein vs. Ensembl Human
Match: HOXA7 (homeobox A7 [Source:HGNC Symbol;Acc:HGNC:5108])

HSP 1 Score: 132.109 bits (331), Expect = 6.475e-36
Identity = 64/84 (76.19%), Postives = 67/84 (79.76%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGP 907
            +YPWM       S  D KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+H   K  GP
Sbjct:  119 IYPWMR-----SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH---KDEGP 194          
BLAST of DthoxE protein vs. Ensembl Human
Match: HOXB6 (homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117])

HSP 1 Score: 128.642 bits (322), Expect = 1.204e-34
Identity = 62/82 (75.61%), Postives = 69/82 (84.15%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSD----HKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS +SS      +R RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+  +
Sbjct:  127 VYPWMQ-RMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKL 207          
BLAST of DthoxE protein vs. Ensembl Human
Match: HOXB6 (homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117])

HSP 1 Score: 128.642 bits (322), Expect = 1.204e-34
Identity = 62/82 (75.61%), Postives = 69/82 (84.15%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSD----HKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS +SS      +R RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+  +
Sbjct:  127 VYPWMQ-RMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKL 207          
BLAST of DthoxE protein vs. Ensembl Human
Match: HOXC6 (homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128])

HSP 1 Score: 125.176 bits (313), Expect = 3.427e-34
Identity = 60/81 (74.07%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHN 886
            +YPWM  +MNS S     +D +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N
Sbjct:   40 IYPWM-QRMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESN 119          
BLAST of DthoxE protein vs. Ensembl Celegans
Match: mab-5 (Homeobox protein mab-5 [Source:UniProtKB/Swiss-Prot;Acc:P10038])

HSP 1 Score: 106.301 bits (264), Expect = 5.512e-27
Identity = 50/75 (66.67%), Postives = 60/75 (80.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            V+PWM  KM      + KR+RQTY+R QTLELEKEFH++KYLTR+RR EI+  L LTERQ+KIWFQNRRMK KK+
Sbjct:  103 VFPWM--KMGGAKGGESKRTRQTYSRSQTLELEKEFHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKE 175          
BLAST of DthoxE protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 104.76 bits (260), Expect = 7.082e-26
Identity = 51/86 (59.30%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  653 VVYPWMNPKMNSESSS-DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGP 907
             VYPWM    ++   S   KR R  YTR Q LELEKEFH +KYLTR+RRIE+AH+L LTERQ+KIWFQNRRMK KK++    +  P
Sbjct:  147 AVYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPP 232          
BLAST of DthoxE protein vs. Ensembl Celegans
Match: lin-39 (Homeobox protein lin-39 [Source:UniProtKB/Swiss-Prot;Acc:P34684])

HSP 1 Score: 104.76 bits (260), Expect = 7.082e-26
Identity = 51/86 (59.30%), Postives = 61/86 (70.93%), Query Frame = 2
Query:  653 VVYPWMNPKMNSESSS-DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGP 907
             VYPWM    ++   S   KR R  YTR Q LELEKEFH +KYLTR+RRIE+AH+L LTERQ+KIWFQNRRMK KK++    +  P
Sbjct:  147 AVYPWMTRVHSTTGGSRGEKRQRTAYTRNQVLELEKEFHTHKYLTRKRRIEVAHSLMLTERQVKIWFQNRRMKHKKENKDKPMTPP 232          
BLAST of DthoxE protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 80.1073 bits (196), Expect = 8.263e-17
Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  686 SESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 877
            + SS   ++ R+ YT+ QTLELEKEF +N Y+++++R E+A  L LTERQ+KIWFQNRRMK KK
Sbjct:  193 TSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKK 256          
BLAST of DthoxE protein vs. Ensembl Celegans
Match: php-3 (Posterior Hox gene Paralog [Source:UniProtKB/TrEMBL;Acc:Q9XW88])

HSP 1 Score: 80.1073 bits (196), Expect = 8.263e-17
Identity = 37/64 (57.81%), Postives = 50/64 (78.12%), Query Frame = 2
Query:  686 SESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 877
            + SS   ++ R+ YT+ QTLELEKEF +N Y+++++R E+A  L LTERQ+KIWFQNRRMK KK
Sbjct:  193 TSSSHAMRKKRKPYTKAQTLELEKEFLYNTYVSKQKRWELAKYLHLTERQVKIWFQNRRMKDKK 256          
BLAST of DthoxE protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081649)

HSP 1 Score: 127.102 bits (318), Expect = 4.119e-33
Identity = 59/75 (78.67%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +YPWM       S  + KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  270 LYPWM------RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 338          
BLAST of DthoxE protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081656)

HSP 1 Score: 127.102 bits (318), Expect = 4.119e-33
Identity = 59/75 (78.67%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +YPWM       S  + KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  270 LYPWM------RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 338          
BLAST of DthoxE protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081648)

HSP 1 Score: 127.487 bits (319), Expect = 4.880e-33
Identity = 59/75 (78.67%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +YPWM       S  + KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  283 LYPWM------RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 351          
BLAST of DthoxE protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081651)

HSP 1 Score: 127.487 bits (319), Expect = 4.880e-33
Identity = 59/75 (78.67%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +YPWM       S  + KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  283 LYPWM------RSQFERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 351          
BLAST of DthoxE protein vs. Ensembl Fly
Match: Antp (gene:FBgn0260642 transcript:FBtr0081653)

HSP 1 Score: 127.102 bits (318), Expect = 4.953e-33
Identity = 58/75 (77.33%), Postives = 63/75 (84.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +YPWM  +       + KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  270 LYPWMRSQFGK--CQERKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 342          
BLAST of DthoxE protein vs. Ensembl Zebrafish
Match: hoxc6a (homeobox C6a [Source:NCBI gene;Acc:30346])

HSP 1 Score: 128.642 bits (322), Expect = 5.430e-35
Identity = 64/97 (65.98%), Postives = 74/97 (76.29%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHN----IPKLNGPGT 913
            ++ +YPWM  +MNS S     SD +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N    +P     GT
Sbjct:   97 NIQIYPWMQ-RMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKETNLTSTVPGTESAGT 192          
BLAST of DthoxE protein vs. Ensembl Zebrafish
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 127.872 bits (320), Expect = 1.585e-34
Identity = 57/78 (73.08%), Postives = 66/78 (84.62%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            ++ +YPWM       + +D KR RQTY+RYQTLELEKEFHFN+YL+RRRRIEIAHAL LTERQIKIWFQNRRMKWKK+
Sbjct:  131 NLRIYPWMRS-----TGADRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRIEIAHALCLTERQIKIWFQNRRMKWKKE 203          
BLAST of DthoxE protein vs. Ensembl Zebrafish
Match: hoxb6a (homeobox B6a [Source:NCBI gene;Acc:30341])

HSP 1 Score: 127.872 bits (320), Expect = 1.863e-34
Identity = 61/81 (75.31%), Postives = 69/81 (85.19%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSS---DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS + +     +R RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++ +
Sbjct:  132 VYPWMQ-RMNSCNGTFGNAGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKL 211          
BLAST of DthoxE protein vs. Ensembl Zebrafish
Match: hoxb6b (homeobox B6b [Source:NCBI gene;Acc:58053])

HSP 1 Score: 125.946 bits (315), Expect = 8.396e-34
Identity = 60/79 (75.95%), Postives = 68/79 (86.08%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS---SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            VYPWM  +MNS +    S  +R RQTYTR+QTLELEKEFHFN+YLTRRRRIEI+HAL LTERQIKIWFQNRRMKWKK++
Sbjct:  129 VYPWMQ-RMNSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKEN 206          
BLAST of DthoxE protein vs. Ensembl Zebrafish
Match: hoxb6b (homeobox B6b [Source:NCBI gene;Acc:58053])

HSP 1 Score: 125.946 bits (315), Expect = 8.396e-34
Identity = 60/79 (75.95%), Postives = 68/79 (86.08%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS---SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            VYPWM  +MNS +    S  +R RQTYTR+QTLELEKEFHFN+YLTRRRRIEI+HAL LTERQIKIWFQNRRMKWKK++
Sbjct:  129 VYPWMQ-RMNSCNGMPGSTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKEN 206          
BLAST of DthoxE protein vs. Ensembl Xenopus
Match: cd276 (CD276 molecule [Source:Xenbase;Acc:XB-GENE-921537])

HSP 1 Score: 130.954 bits (328), Expect = 8.939e-36
Identity = 61/76 (80.26%), Postives = 64/76 (84.21%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            +YPWM       S  D KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+H
Sbjct:  110 IYPWMR-----SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 180          
BLAST of DthoxE protein vs. Ensembl Xenopus
Match: HOXB7 (homeobox B7 [Source:NCBI gene;Acc:100494663])

HSP 1 Score: 130.568 bits (327), Expect = 1.950e-35
Identity = 59/79 (74.68%), Postives = 67/79 (84.81%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            ++ +YPWM       + +D KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++
Sbjct:  122 NLRIYPWMR-----STGADRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN 195          
BLAST of DthoxE protein vs. Ensembl Xenopus
Match: zdhhc15 (zinc finger DHHC-type containing 15 [Source:Xenbase;Acc:XB-GENE-948859])

HSP 1 Score: 129.798 bits (325), Expect = 6.196e-35
Identity = 62/90 (68.89%), Postives = 71/90 (78.89%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM  +MNS S     +D +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N+      GT
Sbjct:  122 IYPWMQ-RMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGT 210          
BLAST of DthoxE protein vs. Ensembl Xenopus
Match: HOXB6 (homeobox B6 [Source:NCBI gene;Acc:100124320])

HSP 1 Score: 127.872 bits (320), Expect = 2.379e-34
Identity = 62/82 (75.61%), Postives = 69/82 (84.15%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSS----DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS +SS      +R RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAH+L LTERQIKIWFQNRRMKWKK+  +
Sbjct:  126 VYPWMQ-RMNSCNSSVFGPSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHSLCLTERQIKIWFQNRRMKWKKESKL 206          
BLAST of DthoxE protein vs. Ensembl Xenopus
Match: ppm1j (protein phosphatase, Mg2+/Mn2+ dependent 1J [Source:Xenbase;Acc:XB-GENE-941439])

HSP 1 Score: 127.102 bits (318), Expect = 9.605e-34
Identity = 60/87 (68.97%), Postives = 67/87 (77.01%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESSS-----DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIP 892
            D VVYPWM     S +SS     + KRSR  YTR Q LELEKEFH+N+YLTRRRR+EIAH L L+ERQIKIWFQNRRMKWKKDH +P
Sbjct:  146 DPVVYPWMKKAHISRASSTYSDGEAKRSRTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHTLRLSERQIKIWFQNRRMKWKKDHKLP 232          
BLAST of DthoxE protein vs. Ensembl Mouse
Match: Hoxb7 (homeobox B7 [Source:MGI Symbol;Acc:MGI:96188])

HSP 1 Score: 133.265 bits (334), Expect = 1.299e-36
Identity = 63/86 (73.26%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S  D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAH L LTERQIKIWFQNRRMKWKK++   K +GPGT
Sbjct:  126 IYPWMR-----SSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTSGPGT 203          
BLAST of DthoxE protein vs. Ensembl Mouse
Match: Hoxa7 (homeobox A7 [Source:MGI Symbol;Acc:MGI:96179])

HSP 1 Score: 133.265 bits (334), Expect = 1.614e-36
Identity = 61/76 (80.26%), Postives = 64/76 (84.21%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            +YPWM       S  D KR RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+H
Sbjct:  118 IYPWMR-----SSGPDRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEH 188          
BLAST of DthoxE protein vs. Ensembl Mouse
Match: Hoxb6 (homeobox B6 [Source:MGI Symbol;Acc:MGI:96187])

HSP 1 Score: 129.028 bits (323), Expect = 5.973e-35
Identity = 70/127 (55.12%), Postives = 82/127 (64.57%), Query Frame = 2
Query:  530 NNAICQHLGSN---LFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSD----HKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
             +A C   G++    FH +  KSD       +             VYPWM  +MNS +SS      +R RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+  +
Sbjct:   84 KDAACALSGADEPPPFHPEPRKSDC--AQDKSVFGETEEQKCSTPVYPWMQ-RMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKL 207          
BLAST of DthoxE protein vs. Ensembl Mouse
Match: Hoxb6 (homeobox B6 [Source:MGI Symbol;Acc:MGI:96187])

HSP 1 Score: 129.028 bits (323), Expect = 5.973e-35
Identity = 70/127 (55.12%), Postives = 82/127 (64.57%), Query Frame = 2
Query:  530 NNAICQHLGSN---LFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSD----HKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
             +A C   G++    FH +  KSD       +             VYPWM  +MNS +SS      +R RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK+  +
Sbjct:   84 KDAACALSGADEPPPFHPEPRKSDC--AQDKSVFGETEEQKCSTPVYPWMQ-RMNSCNSSSFGPSGRRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKESKL 207          
BLAST of DthoxE protein vs. Ensembl Mouse
Match: Hoxc6 (homeobox C6 [Source:MGI Symbol;Acc:MGI:96197])

HSP 1 Score: 126.331 bits (316), Expect = 8.976e-34
Identity = 60/81 (74.07%), Postives = 68/81 (83.95%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHN 886
            +YPWM  +MNS S     +D +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N
Sbjct:  122 IYPWMQ-RMNSHSGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESN 201          
BLAST of DthoxE protein vs. UniProt/SwissProt
Match: sp|Q9TT89|HXB7_BOVIN (Homeobox protein Hox-B7 OS=Bos taurus OX=9913 GN=HOXB7 PE=2 SV=1)

HSP 1 Score: 136.732 bits (343), Expect = 4.626e-37
Identity = 64/86 (74.42%), Postives = 71/86 (82.56%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S +D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++   K +GPGT
Sbjct:  126 IYPWMR-----SSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN---KTSGPGT 203          
BLAST of DthoxE protein vs. UniProt/SwissProt
Match: sp|A1YFA5|HXB7_GORGO (Homeobox protein Hox-B7 OS=Gorilla gorilla gorilla OX=9595 GN=HOXB7 PE=3 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 5.771e-37
Identity = 64/86 (74.42%), Postives = 70/86 (81.40%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S +D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++   K  GPGT
Sbjct:  126 IYPWMR-----SSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN---KTAGPGT 203          
BLAST of DthoxE protein vs. UniProt/SwissProt
Match: sp|P18864|HXB7_RAT (Homeobox protein Hox-B7 OS=Rattus norvegicus OX=10116 GN=Hoxb7 PE=2 SV=2)

HSP 1 Score: 134.806 bits (338), Expect = 2.775e-36
Identity = 63/86 (73.26%), Postives = 71/86 (82.56%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S ++ KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++   K +GPGT
Sbjct:  126 IYPWMR-----SSGTERKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKEN---KTSGPGT 203          
BLAST of DthoxE protein vs. UniProt/SwissProt
Match: sp|P09629|HXB7_HUMAN (Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN=HOXB7 PE=1 SV=4)

HSP 1 Score: 134.035 bits (336), Expect = 4.589e-36
Identity = 63/86 (73.26%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S +D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAH L LTERQIKIWFQNRRMKWKK++   K  GPGT
Sbjct:  126 IYPWMR-----SSGTDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTAGPGT 203          
BLAST of DthoxE protein vs. UniProt/SwissProt
Match: sp|P09024|HXB7_MOUSE (Homeobox protein Hox-B7 OS=Mus musculus OX=10090 GN=Hoxb7 PE=2 SV=2)

HSP 1 Score: 133.265 bits (334), Expect = 9.089e-36
Identity = 63/86 (73.26%), Postives = 69/86 (80.23%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            +YPWM       S  D KR RQTYTRYQTLELEKEFH+N+YLTRRRRIEIAH L LTERQIKIWFQNRRMKWKK++   K +GPGT
Sbjct:  126 IYPWMR-----SSGPDRKRGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKEN---KTSGPGT 203          
BLAST of DthoxE protein vs. TrEMBL
Match: O76939 (DthoxE protein OS=Girardia tigrina OX=6162 GN=DthoxE PE=3 SV=1)

HSP 1 Score: 412.92 bits (1060), Expect = 5.369e-141
Identity = 268/329 (81.46%), Postives = 293/329 (89.06%), Query Frame = 2
Query:   59 MKLMYPNYHSVMPEFQLNCESEISSNTT-----IGYDHPVSIXXXXXXXXXXXXXXXXXXXXXXXGLELPPNFSIPRYSDEFLLTGN-QDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDS-----XXXXXXXXXXISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTXXXXXXXXXXXXXXXXXXXTDIEDHCSDTESLN 1012
            MKLMYPNYHSVMPEFQL+CE+EISSNTT     I YDH  S+T++SYNSMKN   FT+PS+LNNS LEL PNFSIPRYS+EFLL G+ QDSSK++PNY+QQ CYYLYRK  R+ET +LNLPY  +WKNS++FCHG+IN+NYETDS     N+  NN NNNI+HIRAL NNAICQHLG+NLFH+ HFKSD+ SLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKL+ KTD EDHCSD ES N
Sbjct:    1 MKLMYPNYHSVMPEFQLSCETEISSNTTLASGAIDYDHSTSLTDTSYNSMKNQPVFTTPSSLNNSCLELAPNFSIPRYSEEFLLPGDHQDSSKNIPNYNQQPCYYLYRKQPRSETHDLNLPYP-SWKNSNIFCHGSINNNYETDSLLHPNNSNNNNTNNNITHIRALSNNAICQHLGTNLFHEPHFKSDLQSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLDIKTDQEDHCSDAESGN 328          
BLAST of DthoxE protein vs. TrEMBL
Match: Q9XY03 (PLOX6-Dj (Fragment) OS=Dugesia japonica OX=6161 GN=Plox6-Dj PE=2 SV=1)

HSP 1 Score: 293.893 bits (751), Expect = 9.511e-96
Identity = 188/216 (87.04%), Postives = 201/216 (93.06%), Query Frame = 2
Query:  380 ETQNLNLPYSGAWKNSSLFCHGTINSNYETDS-------XXXXXXXXXXISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTXXXXXXXXXXXXXXXXXXXTDIEDHCSDTES 1006
            ETQ+LNLPY  +WKNS++FCHG+IN+NYE DS       NN ++NN+NN ++IRAL NNAICQHLGSNLFH+ HFKSD+PSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSD ES
Sbjct:    1 ETQDLNLPYP-SWKNSNIFCHGSINTNYENDSLINSNNNNNNSSNNSNNSNNIRALSNNAICQHLGSNLFHEPHFKSDLPSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDNES 215          
BLAST of DthoxE protein vs. TrEMBL
Match: Q24681 (DNA-binding protein (Fragment) OS=Girardia tigrina OX=6162 GN=homeobox PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 8.466e-92
Identity = 160/191 (83.77%), Postives = 174/191 (91.10%), Query Frame = 2
Query:  353 YLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDS-----XXXXXXXXXXISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPG 910
            YLYRK  R+ET +LNLPY  +WKNS++FCHG+IN+NYETDS     N+  N+ NNNI+HIRAL NNAICQHLG+NLFH+ HFKSD+ SLHSPNNIINNSPNHNDMVVYPW+NPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAH LSLTERQIKIWFQNRRMKWKKDHNIPKLNGPG
Sbjct:    1 YLYRKRPRSETHDLNLPYP-SWKNSNIFCHGSINNNYETDSLLHPNNSNNNSTNNNITHIRALSNNAICQHLGTNLFHEPHFKSDLQSLHSPNNIINNSPNHNDMVVYPWLNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHGLSLTERQIKIWFQNRRMKWKKDHNIPKLNGPG 190          
BLAST of DthoxE protein vs. TrEMBL
Match: A0A1S6KMI5 (Homeobox domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 215.312 bits (547), Expect = 2.975e-66
Identity = 122/122 (100.00%), Postives = 122/122 (100.00%), Query Frame = 2
Query:  650 MVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTXXXXXXXXXXXXXXXXXXXTDIEDHCSDTESLNT 1015
            MVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT
Sbjct:    1 MVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT 122          
BLAST of DthoxE protein vs. TrEMBL
Match: A0A094ZDF2 (Homeobox protein SMOX-1 (Fragment) OS=Schistosoma haematobium OX=6185 GN=MS3_00445 PE=3 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 1.444e-44
Identity = 76/89 (85.39%), Postives = 82/89 (92.13%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            ++VVYPWMNPK  ++ S D KR+RQTYTRYQTLELEKEFHFNKYLTRRRRIEIAH L+LTERQIKIWFQNRRMKWKKDHNI KLNGPGT
Sbjct:   41 NVVVYPWMNPK-GTDISVDQKRTRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHTLTLTERQIKIWFQNRRMKWKKDHNIAKLNGPGT 128          
BLAST of DthoxE protein vs. Ensembl Cavefish
Match: hoxb7a (homeobox B7 [Source:NCBI gene;Acc:103045369])

HSP 1 Score: 130.183 bits (326), Expect = 2.151e-35
Identity = 59/89 (66.29%), Postives = 69/89 (77.53%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            ++ +YPWM       + +D KR RQTY+RYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++     + P  
Sbjct:  133 NLRIYPWMR-----STGADRKRGRQTYSRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKTAHPSSPAA 216          
BLAST of DthoxE protein vs. Ensembl Cavefish
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:103034651])

HSP 1 Score: 128.257 bits (321), Expect = 1.208e-34
Identity = 61/85 (71.76%), Postives = 71/85 (83.53%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            ++ +YPWM  +MNS S     SD +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N+
Sbjct:  119 NIQIYPWMQ-RMNSHSGVGYGSDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNL 202          
BLAST of DthoxE protein vs. Ensembl Cavefish
Match: hoxb6a (homeobox protein Hox-B6a [Source:NCBI gene;Acc:103045875])

HSP 1 Score: 127.102 bits (318), Expect = 2.866e-34
Identity = 61/81 (75.31%), Postives = 69/81 (85.19%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSS---DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS + +     +R RQTYTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKK++ +
Sbjct:  130 VYPWMQ-RMNSCNGTFGNPGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKENKL 209          
BLAST of DthoxE protein vs. Ensembl Cavefish
Match: hoxb6b (homeobox protein Hox-B6b [Source:NCBI gene;Acc:103030519])

HSP 1 Score: 125.561 bits (314), Expect = 8.406e-34
Identity = 59/81 (72.84%), Postives = 69/81 (85.19%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS---SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            VYPWM  +MNS +    +  +R RQTYTR+QTLELEKEFHFN+YLTRRRRIEI+HAL LTERQIKIWFQNRRMKWKK++ +
Sbjct:  121 VYPWMQ-RMNSCNGIPGNTGRRGRQTYTRFQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKV 200          
BLAST of DthoxE protein vs. Ensembl Cavefish
Match: hoxb5b (homeobox protein Hox-B5b [Source:NCBI gene;Acc:103029979])

HSP 1 Score: 126.331 bits (316), Expect = 2.300e-33
Identity = 58/83 (69.88%), Postives = 66/83 (79.52%), Query Frame = 2
Query:  656 VYPWMNPKMNSE--SSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKL 898
            ++PWM     S   +  D KR+R  YTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKKD+ +  +
Sbjct:  188 IFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKDNKLKSM 270          
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Match: hoxb7a (homeobox B7a [Source:NCBI gene;Acc:58044])

HSP 1 Score: 114.005 bits (284), Expect = 6.208e-32
Identity = 53/64 (82.81%), Postives = 59/64 (92.19%), Query Frame = 2
Query:  701 DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIP 892
            D KR RQTY+RYQTLELEKEFHFN+YLTRRRR+EIAH+L LTERQIKIWFQNRRMKWKK++  P
Sbjct:    3 DGKRGRQTYSRYQTLELEKEFHFNRYLTRRRRVEIAHSLCLTERQIKIWFQNRRMKWKKENRGP 66          
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 113.235 bits (282), Expect = 1.695e-31
Identity = 52/64 (81.25%), Postives = 57/64 (89.06%), Query Frame = 2
Query:  701 DHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIP 892
            + KRSR  YTR Q LELEKEFHFN+YLTRRRRIEIAH+L L+ERQIKIWFQNRRMKWKKDH +P
Sbjct:    1 ESKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHSLCLSERQIKIWFQNRRMKWKKDHKLP 64          
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005057.1 (pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 gene:ENSPMAG00000004598.1 transcript:ENSPMAT00000005057.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 111.694 bits (278), Expect = 9.863e-31
Identity = 52/81 (64.20%), Postives = 63/81 (77.78%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKL 898
            V+PWM P+         +R RQTY+RYQTLELEKEF FN YLTR+RRIE++H L L+ERQ+KIWFQNRRMKWKK++N  K 
Sbjct:   16 VFPWMRPQ-----GPARRRGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHVLGLSERQVKIWFQNRRMKWKKENNRDKF 91          
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011116.1 (pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 gene:ENSPMAG00000010089.1 transcript:ENSPMAT00000011116.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.9821 bits (245), Expect = 2.182e-26
Identity = 42/58 (72.41%), Postives = 55/58 (94.83%), Query Frame = 2
Query:  707 KRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            ++ R++Y+R+Q+LELEKEFHFN+YL RRRR+EIAH+L L+ERQ+KIWFQNRRMKWKK+
Sbjct:    2 RKGRRSYSRHQSLELEKEFHFNRYLARRRRVEIAHSLCLSERQVKIWFQNRRMKWKKE 59          
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011449.1 (pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gene:ENSPMAG00000010422.1 transcript:ENSPMAT00000011449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.5741 bits (205), Expect = 1.022e-20
Identity = 40/57 (70.18%), Postives = 49/57 (85.96%), Query Frame = 2
Query:  707 KRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 877
            ++ R  YT++QTLELEKEF F+ YLTR RR+EI+H LSLT+RQ+KIWFQNRRMK KK
Sbjct:    2 RKKRCPYTKHQTLELEKEFLFSMYLTRERRLEISHLLSLTDRQVKIWFQNRRMKLKK 58          
BLAST of DthoxE protein vs. Ensembl Yeast
Match: YOX1 (Homeobox transcriptional repressor; binds to Mcm1p and to early cell cycle boxes (ECBs) in the promoters of cell cycle-regulated genes expressed in M/G1 phase; expression is cell cycle-regulated; phosphorylated by Cdc28p; relocalizes from nucleus to cytoplasm upon DNA replication stress; YOX1 has a paralog, YHP1, that arose from the whole genome duplication [Source:SGD;Acc:S000004489])

HSP 1 Score: 46.2098 bits (108), Expect = 4.265e-6
Identity = 25/75 (33.33%), Postives = 42/75 (56.00%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLE-LEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKK 877
             +P   PK+++   +  KR R   T  Q L  L+ EF      ++ +RIE+A +  +TE+ ++IWFQN+R   K+
Sbjct:  162 TFPKKEPKIDNAPLARRKRRR---TSSQELSILQAEFEKCPAPSKEKRIELAESCHMTEKAVQIWFQNKRQAVKR 233          
BLAST of DthoxE protein vs. Ensembl Nematostella
Match: ANTHOX1A.NV (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGM8])

HSP 1 Score: 94.7449 bits (234), Expect = 1.674e-23
Identity = 45/67 (67.16%), Postives = 50/67 (74.63%), Query Frame = 2
Query:  710 RSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHN--IPKLNG 904
            R R  YTR Q LELEKEFHF +YLT+ RR E+A  L LTERQ+KIWFQNRRMKWKKD+   IP   G
Sbjct:   81 RKRMAYTRIQLLELEKEFHFTRYLTKERRTEMARMLDLTERQVKIWFQNRRMKWKKDNKPVIPTSRG 147          
BLAST of DthoxE protein vs. Ensembl Nematostella
Match: EDO42187 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S274])

HSP 1 Score: 89.3521 bits (220), Expect = 1.329e-22
Identity = 44/58 (75.86%), Postives = 47/58 (81.03%), Query Frame = 2
Query:  707 KRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            KR R +YT  Q LELEKEFHFNKYL   RR EI+ AL LTERQ+KIWFQNRRMKWKKD
Sbjct:    2 KRHRTSYTNKQLLELEKEFHFNKYLCSSRRREISKALQLTERQVKIWFQNRRMKWKKD 59          
BLAST of DthoxE protein vs. Ensembl Nematostella
Match: ANTHOX7 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S272])

HSP 1 Score: 93.9745 bits (232), Expect = 2.224e-22
Identity = 58/132 (43.94%), Postives = 75/132 (56.82%), Query Frame = 2
Query:  542 CQHLGSNLFHDQH-------FKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSE---SSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGP 907
             Q  G+ LF D +       F   I S+   ++   + PN+    +YPWM  K +          KR R +YT  Q LELEKEFH+NKYL   RR E+A+A+ LTERQ+K+WFQNRRMK KKD    K +GP
Sbjct:   35 TQGFGAGLFLDTYTSHIGRDFDGPIGSIPVGSSNRESLPNYLLQPIYPWMRTKKSGSRGIGGKHTKRYRTSYTNRQLLELEKEFHYNKYLCGTRRRELANAMKLTERQVKVWFQNRRMKLKKDEK-QKEDGP 165          
BLAST of DthoxE protein vs. Ensembl Nematostella
Match: HOX6 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S277])

HSP 1 Score: 92.8189 bits (229), Expect = 1.076e-21
Identity = 43/69 (62.32%), Postives = 54/69 (78.26%), Query Frame = 2
Query:  674 PKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            P+   ++ S  ++ R T+T+ Q +ELEKEFHF+KYLTR RRIEIA  L LTE QIKIWFQNRRMKWK++
Sbjct:  143 PEEKEQNPSPSQKKRFTFTQRQLVELEKEFHFSKYLTRTRRIEIATTLKLTEMQIKIWFQNRRMKWKRE 211          
BLAST of DthoxE protein vs. Ensembl Nematostella
Match: EDO45896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRW6])

HSP 1 Score: 84.3445 bits (207), Expect = 8.255e-21
Identity = 38/60 (63.33%), Postives = 50/60 (83.33%), Query Frame = 2
Query:  710 RSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            ++R  Y+  Q +ELEKEFH+N+YL R RRIEIA +L LTE+Q+KIWFQNRRMKWKK++ +
Sbjct:    3 KNRTIYSTRQLVELEKEFHYNRYLCRPRRIEIAQSLELTEKQVKIWFQNRRMKWKKENKL 62          
BLAST of DthoxE protein vs. Ensembl Medaka
Match: HOXA7 (homeobox A7 [Source:NCBI gene;Acc:110015904])

HSP 1 Score: 129.028 bits (323), Expect = 6.274e-35
Identity = 58/76 (76.32%), Postives = 65/76 (85.53%), Query Frame = 2
Query:  656 VYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDH 883
            +YPWM       S  + KR RQTY+RYQTLELEKEFHFN+YL+RRRR+EIAHAL+LTERQIKIWFQNRRMKWKKDH
Sbjct:  112 MYPWMQA-----SDPNRKRGRQTYSRYQTLELEKEFHFNRYLSRRRRVEIAHALTLTERQIKIWFQNRRMKWKKDH 182          
BLAST of DthoxE protein vs. Ensembl Medaka
Match: hoxc6a (homeobox C6 [Source:NCBI gene;Acc:101173938])

HSP 1 Score: 127.487 bits (319), Expect = 2.199e-34
Identity = 60/83 (72.29%), Postives = 70/83 (84.34%), Query Frame = 2
Query:  656 VYPWMNPKMNSESS-----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            +YPWM  +MNS S+     +D +R RQ Y+RYQTLELEKEFHFN+YLTRRRRIEIA+AL LTERQIKIWFQNRRMKWKK+ N+
Sbjct:  121 IYPWMQ-RMNSHSAGVGYGTDRRRGRQIYSRYQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKESNL 202          
BLAST of DthoxE protein vs. Ensembl Medaka
Match: hoxb6b (homeobox protein Hox-B6b [Source:NCBI gene;Acc:101164012])

HSP 1 Score: 126.331 bits (316), Expect = 8.939e-34
Identity = 59/83 (71.08%), Postives = 71/83 (85.54%), Query Frame = 2
Query:  653 VVYPWMNPKMNSESS----SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNI 889
            ++YPWM  +MN+ S+    +  +R RQTYTRYQTLELEKEFHFN+YLTRRRRIEI+HAL LTERQIKIWFQNRRMKWKK++ +
Sbjct:  153 LIYPWMQ-RMNACSAGPFGTSGRRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEISHALCLTERQIKIWFQNRRMKWKKENKL 234          
BLAST of DthoxE protein vs. Ensembl Medaka
Match: ENSORLT00000021320.2 (homeobox protein Hox-B5a [Source:NCBI gene;Acc:101169786])

HSP 1 Score: 127.487 bits (319), Expect = 1.403e-33
Identity = 58/84 (69.05%), Postives = 67/84 (79.76%), Query Frame = 2
Query:  656 VYPWMNPKMNSE--SSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLN 901
            ++PWM     S   +  D KR+R  YTRYQTLELEKEFHFN+YLTRRRRIEIAHAL LTERQIKIWFQNRRMKWKKD+ +  ++
Sbjct:  217 IFPWMRKLHISHDMTGPDGKRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKKDNKVKSMS 300          
BLAST of DthoxE protein vs. Ensembl Medaka
Match: hoxd4a (homeobox D4a [Source:NCBI gene;Acc:30329])

HSP 1 Score: 125.946 bits (315), Expect = 1.681e-33
Identity = 61/89 (68.54%), Postives = 68/89 (76.40%), Query Frame = 2
Query:  653 VVYPWMNP----KMNSE-SSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNG 904
            VVYPWM       +N + + S+ KRSR  YTR Q LELEKEFHFN+YLTRRRRIEIAH L L+ERQIKIWFQNRRMKWKKDH +P   G
Sbjct:  144 VVYPWMKKVHVTTVNPDYTGSEPKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKDHKLPNTKG 232          
BLAST of DthoxE protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 511.146 bits (1315), Expect = 0.000e+0
Identity = 319/319 (100.00%), Postives = 319/319 (100.00%), Query Frame = 2
Query:   59 MKLMYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSIXXXXXXXXXXXXXXXXXXXXXXXGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSXXXXXXXXXXISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTXXXXXXXXXXXXXXXXXXXTDIEDHCSDTESLNT 1015
            MKLMYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSITESSYNSMKNSSSFTSPSTLNNSGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSNNPTNNNNNNISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT
Sbjct:    1 MKLMYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSITESSYNSMKNSSSFTSPSTLNNSGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSNNPTNNNNNNISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT 319          
BLAST of DthoxE protein vs. Planmine SMEST
Match: SMESG000079807.1 (SMESG000079807.1)

HSP 1 Score: 504.597 bits (1298), Expect = 0.000e+0
Identity = 316/316 (100.00%), Postives = 316/316 (100.00%), Query Frame = 2
Query:   68 MYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSIXXXXXXXXXXXXXXXXXXXXXXXGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSXXXXXXXXXXISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLXXXXXXXXXXXXXXDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTXXXXXXXXXXXXXXXXXXXTDIEDHCSDTESLNT 1015
            MYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSITESSYNSMKNSSSFTSPSTLNNSGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSNNPTNNNNNNISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT
Sbjct:    1 MYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSITESSYNSMKNSSSFTSPSTLNNSGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYLYRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSNNPTNNNNNNISHIRALGNNAICQHLGSNLFHDQHFKSDIPSLHSPNNIINNSPNHNDMVVYPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEKLEAKTDIEDHCSDTESLNT 316          
BLAST of DthoxE protein vs. Planmine SMEST
Match: SMESG000022667.1 (SMESG000022667.1)

HSP 1 Score: 150.214 bits (378), Expect = 1.066e-42
Identity = 69/91 (75.82%), Postives = 83/91 (91.21%), Query Frame = 2
Query:  647 DMVVYPWMNPKMNSES--SSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGT 913
            ++++Y WMNPK  +++  SS++KR+RQTYTR+QTLELEKEFHFNKYLTRRRRIEIAH+L LTERQIKIWFQNRRMKWKK+HNI KL GPG+
Sbjct:  142 NVMLYSWMNPKSGADNPNSSNNKRTRQTYTRHQTLELEKEFHFNKYLTRRRRIEIAHSLILTERQIKIWFQNRRMKWKKEHNIAKLTGPGS 232          
BLAST of DthoxE protein vs. Planmine SMEST
Match: SMESG000044469.1 (SMESG000044469.1)

HSP 1 Score: 111.694 bits (278), Expect = 2.951e-29
Identity = 52/82 (63.41%), Postives = 67/82 (81.71%), Query Frame = 2
Query:  647 DMVVYPWMNP----KMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKD 880
            +   +PWM      K  S+ S+++KRSRQ Y+R QTLELEKEF++N+YLTRRRRIEIA+++ L+ERQIKIWFQNRRMK+KKD
Sbjct:   82 NFPAFPWMQKSNTRKNKSDRSAEYKRSRQAYSRQQTLELEKEFYYNQYLTRRRRIEIANSVCLSERQIKIWFQNRRMKYKKD 163          
BLAST of DthoxE protein vs. Planmine SMEST
Match: SMESG000071019.1 (SMESG000071019.1)

HSP 1 Score: 116.316 bits (290), Expect = 3.277e-29
Identity = 51/65 (78.46%), Postives = 58/65 (89.23%), Query Frame = 2
Query:  698 SDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKDHNIP 892
            SD KR+R  YTR Q LELEKEFHFNKYLTR+RRIEIA +L L+ERQ+KIWFQNRRMKWKKDH++P
Sbjct:  223 SDSKRNRTAYTRQQILELEKEFHFNKYLTRKRRIEIAQSLQLSERQVKIWFQNRRMKWKKDHHLP 287          
The following BLAST results are available for this feature:
BLAST of DthoxE protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXB79.556e-3773.26homeobox B7 [Source:HGNC Symbol;Acc:HGNC:5118][more]
HOXA76.475e-3676.19homeobox A7 [Source:HGNC Symbol;Acc:HGNC:5108][more]
HOXB61.204e-3475.61homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117][more]
HOXB61.204e-3475.61homeobox B6 [Source:HGNC Symbol;Acc:HGNC:5117][more]
HOXC63.427e-3474.07homeobox C6 [Source:HGNC Symbol;Acc:HGNC:5128][more]
back to top
BLAST of DthoxE protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab-55.512e-2766.67Homeobox protein mab-5 [Source:UniProtKB/Swiss-Pr... [more]
lin-397.082e-2659.30Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
lin-397.082e-2659.30Homeobox protein lin-39 [Source:UniProtKB/Swiss-P... [more]
php-38.263e-1757.81Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
php-38.263e-1757.81Posterior Hox gene Paralog [Source:UniProtKB/TrEM... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Antp4.119e-3378.67gene:FBgn0260642 transcript:FBtr0081649[more]
Antp4.119e-3378.67gene:FBgn0260642 transcript:FBtr0081656[more]
Antp4.880e-3378.67gene:FBgn0260642 transcript:FBtr0081648[more]
Antp4.880e-3378.67gene:FBgn0260642 transcript:FBtr0081651[more]
Antp4.953e-3377.33gene:FBgn0260642 transcript:FBtr0081653[more]
back to top
BLAST of DthoxE protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxc6a5.430e-3565.98homeobox C6a [Source:NCBI gene;Acc:30346][more]
hoxb7a1.585e-3473.08homeobox B7a [Source:NCBI gene;Acc:58044][more]
hoxb6a1.863e-3475.31homeobox B6a [Source:NCBI gene;Acc:30341][more]
hoxb6b8.396e-3475.95homeobox B6b [Source:NCBI gene;Acc:58053][more]
hoxb6b8.396e-3475.95homeobox B6b [Source:NCBI gene;Acc:58053][more]
back to top
BLAST of DthoxE protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cd2768.939e-3680.26CD276 molecule [Source:Xenbase;Acc:XB-GENE-921537][more]
HOXB71.950e-3574.68homeobox B7 [Source:NCBI gene;Acc:100494663][more]
zdhhc156.196e-3568.89zinc finger DHHC-type containing 15 [Source:Xenbas... [more]
HOXB62.379e-3475.61homeobox B6 [Source:NCBI gene;Acc:100124320][more]
ppm1j9.605e-3468.97protein phosphatase, Mg2+/Mn2+ dependent 1J [Sourc... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hoxb71.299e-3673.26homeobox B7 [Source:MGI Symbol;Acc:MGI:96188][more]
Hoxa71.614e-3680.26homeobox A7 [Source:MGI Symbol;Acc:MGI:96179][more]
Hoxb65.973e-3555.12homeobox B6 [Source:MGI Symbol;Acc:MGI:96187][more]
Hoxb65.973e-3555.12homeobox B6 [Source:MGI Symbol;Acc:MGI:96187][more]
Hoxc68.976e-3474.07homeobox C6 [Source:MGI Symbol;Acc:MGI:96197][more]
back to top
BLAST of DthoxE protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9TT89|HXB7_BOVIN4.626e-3774.42Homeobox protein Hox-B7 OS=Bos taurus OX=9913 GN=H... [more]
sp|A1YFA5|HXB7_GORGO5.771e-3774.42Homeobox protein Hox-B7 OS=Gorilla gorilla gorilla... [more]
sp|P18864|HXB7_RAT2.775e-3673.26Homeobox protein Hox-B7 OS=Rattus norvegicus OX=10... [more]
sp|P09629|HXB7_HUMAN4.589e-3673.26Homeobox protein Hox-B7 OS=Homo sapiens OX=9606 GN... [more]
sp|P09024|HXB7_MOUSE9.089e-3673.26Homeobox protein Hox-B7 OS=Mus musculus OX=10090 G... [more]
back to top
BLAST of DthoxE protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
O769395.369e-14181.46DthoxE protein OS=Girardia tigrina OX=6162 GN=Dtho... [more]
Q9XY039.511e-9687.04PLOX6-Dj (Fragment) OS=Dugesia japonica OX=6161 GN... [more]
Q246818.466e-9283.77DNA-binding protein (Fragment) OS=Girardia tigrina... [more]
A0A1S6KMI52.975e-66100.00Homeobox domain-containing protein OS=Schmidtea me... [more]
A0A094ZDF21.444e-4485.39Homeobox protein SMOX-1 (Fragment) OS=Schistosoma ... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb7a2.151e-3566.29homeobox B7 [Source:NCBI gene;Acc:103045369][more]
hoxc6a1.208e-3471.76homeobox C6 [Source:NCBI gene;Acc:103034651][more]
hoxb6a2.866e-3475.31homeobox protein Hox-B6a [Source:NCBI gene;Acc:103... [more]
hoxb6b8.406e-3472.84homeobox protein Hox-B6b [Source:NCBI gene;Acc:103... [more]
hoxb5b2.300e-3369.88homeobox protein Hox-B5b [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hoxb7a6.208e-3282.81homeobox B7a [Source:NCBI gene;Acc:58044][more]
hoxd4a1.695e-3181.25homeobox D4a [Source:NCBI gene;Acc:30329][more]
ENSPMAT00000005057.19.863e-3164.20pep scaffold:Pmarinus_7.0:GL483321:9136:13526:-1 g... [more]
ENSPMAT00000011116.12.182e-2672.41pep scaffold:Pmarinus_7.0:GL482944:7995:8174:-1 ge... [more]
ENSPMAT00000011449.11.022e-2070.18pep scaffold:Pmarinus_7.0:GL493006:3300:3479:1 gen... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
YOX14.265e-633.33Homeobox transcriptional repressor; binds to Mcm1p... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
ANTHOX1A.NV1.674e-2367.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO421871.329e-2275.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
ANTHOX72.224e-2243.94Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
HOX61.076e-2162.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458968.255e-2163.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DthoxE protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HOXA76.274e-3576.32homeobox A7 [Source:NCBI gene;Acc:110015904][more]
hoxc6a2.199e-3472.29homeobox C6 [Source:NCBI gene;Acc:101173938][more]
hoxb6b8.939e-3471.08homeobox protein Hox-B6b [Source:NCBI gene;Acc:101... [more]
ENSORLT00000021320.21.403e-3369.05homeobox protein Hox-B5a [Source:NCBI gene;Acc:101... [more]
hoxd4a1.681e-3368.54homeobox D4a [Source:NCBI gene;Acc:30329][more]
back to top
BLAST of DthoxE protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000079807.10.000e+0100.00SMESG000079807.1[more]
SMESG000079807.10.000e+0100.00SMESG000079807.1[more]
SMESG000022667.11.066e-4275.82SMESG000022667.1[more]
SMESG000044469.12.951e-2963.41SMESG000044469.1[more]
SMESG000071019.13.277e-2978.46SMESG000071019.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016117 ID=SMED30016117|Name=DthoxE protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1121bp
GTTACATTAAACTCTAAAATCGAATTAATAATAATTTGTCCATTTACATA
TATATGATATGAAACTAATGTATCCAAATTATCATTCCGTTATGCCAGAA
TTTCAATTAAATTGTGAATCAGAAATCTCCTCCAACACAACCATTGGCTA
TGATCATCCAGTTTCCATAACAGAATCTTCATACAATTCAATGAAGAACT
CTTCGAGTTTTACTAGCCCGTCGACGCTGAACAATTCCGGATTAGAATTA
CCTCCGAATTTTTCAATTCCAAGATATTCGGATGAATTCCTATTGACAGG
AAATCAAGACTCATCGAAAAGTTTACCGAATTACTCCCAACAGTCTTGTT
ATTACCTCTATAGGAAACCCTCGAGAACCGAAACTCAAAATCTGAATTTG
CCGTATTCTGGAGCTTGGAAAAATTCCAGCCTATTTTGTCATGGAACGAT
TAACTCAAACTACGAAACGGATTCCAACAATCCTACTAATAATAACAACA
ATAATATTTCTCATATTCGAGCTCTCGGAAACAATGCAATTTGTCAACAT
CTCGGATCGAATCTATTTCATGATCAGCATTTCAAATCCGACATACCTTC
ATTGCACAGTCCTAATAATATCATCAACAACTCTCCCAATCACAATGACA
TGGTTGTTTACCCATGGATGAATCCCAAAATGAATTCAGAATCATCAAGC
GACCACAAACGATCCAGACAAACCTATACACGATATCAAACTCTGGAGCT
GGAAAAAGAATTTCATTTCAATAAATACCTCACTCGACGGAGAAGAATAG
AAATCGCTCACGCATTATCTTTAACGGAAAGGCAAATCAAAATATGGTTT
CAAAACAGGAGAATGAAATGGAAAAAAGACCACAACATCCCGAAACTAAA
CGGCCCAGGAACATTGGAACAATACGAGCAACAATTCGAGAAAGAGCAAC
TGGAGAAACTGGAAGCAAAGACCGATATTGAGGACCATTGCTCCGACACA
GAATCATTGAACACGTAAACCACTTGTATCACCCGGTTCATCAATTTGTA
GAAATTATTTGTACAGCGCTAAAGATGCATGCCAAAGCGTAAAAAAGAAT
TTAAAAAAATAATAATCGAAA
back to top

protein sequence of SMED30016117-orf-1

>SMED30016117-orf-1 ID=SMED30016117-orf-1|Name=SMED30016117-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=320bp
MKLMYPNYHSVMPEFQLNCESEISSNTTIGYDHPVSITESSYNSMKNSSS
FTSPSTLNNSGLELPPNFSIPRYSDEFLLTGNQDSSKSLPNYSQQSCYYL
YRKPSRTETQNLNLPYSGAWKNSSLFCHGTINSNYETDSNNPTNNNNNNI
SHIRALGNNAICQHLGSNLFHDQHFKSDIPSLHSPNNIINNSPNHNDMVV
YPWMNPKMNSESSSDHKRSRQTYTRYQTLELEKEFHFNKYLTRRRRIEIA
HALSLTERQIKIWFQNRRMKWKKDHNIPKLNGPGTLEQYEQQFEKEQLEK
LEAKTDIEDHCSDTESLNT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000103central nervous system
PLANA:0002089reproductive organ
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017995Homeobox_antennapedia
IPR020479Homeobox_metazoa
IPR001356Homeobox_dom
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0003700transcription factor activity, sequence-specific DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 286..306
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 195..276
e-value: 9.5E-33
score: 114.0
NoneNo IPR availablePANTHERPTHR45659:SF4HOMEOTIC PROTEIN ULTRABITHORAXcoord: 58..306
NoneNo IPR availablePANTHERPTHR45659FAMILY NOT NAMEDcoord: 58..306
IPR017995Homeobox protein, antennapedia typePRINTSPR00025ANTENNAPEDIAcoord: 199..206
score: 46.61
coord: 217..232
score: 66.96
IPR020479Homeobox domain, metazoaPRINTSPR00024HOMEOBOXcoord: 253..263
score: 66.0
coord: 238..249
score: 51.06
coord: 263..272
score: 83.3
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 216..278
e-value: 1.2E-26
score: 104.5
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 217..273
e-value: 2.7E-21
score: 75.1
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 214..274
score: 21.54
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 217..275
e-value: 1.09097E-24
score: 92.6916
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 249..272
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 194..273