Sodium/hydrogen exchanger

Overview
NameSodium/hydrogen exchanger
Smed IDSMED30016116
Length (bp)2125
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Sodium/hydrogen exchanger (SMED30016116) t-SNE clustered cells

Violin plots show distribution of expression levels for Sodium/hydrogen exchanger (SMED30016116) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Sodium/hydrogen exchanger (SMED30016116) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Sodium/hydrogen exchanger (SMED30016116) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016116

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parapharyngeal regionSMED30016116SMESG000006858.1 SmedASXL_010902SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016116SMESG000006858.1 dd_Smed_v4_19237_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016116SMESG000006858.1 dd_Smed_v6_19237_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A2 (solute carrier family 9 member A2 [Source:HGNC Symbol;Acc:HGNC:11072])

HSP 1 Score: 185.267 bits (469), Expect = 1.127e-48
Identity = 179/487 (36.76%), Postives = 272/487 (55.85%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMT--ELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL 1636
            D+  V+  F I+L++L   + K      H +   +PES +L+ VG   G I  F  + +    M  ++FFL LLPPIVL++ Y M TR F+   G    YAV+GT++N + IG +L+G+             ++TL   LLF SLI AVDPVAVLA+F +I V ++LY +VFGESLLNDAVTVVLY++ K+F   + I ++ +  GI +FF V +GG+LIG+  G I    TR   N    E   + L  Y+SYI A+    SGI+AI  C +   +Y   N+S +S   ++  ++M +++SE +IF+F+G S       W+  FV ++L  C++ RA+   +L  V N      R I +T  +  +I YGGLRGA+ + L  L+ A              ++L IT  + +I FTV   G+T++PLV+ L +K +  +  ++ +     L D   +GIE + G  G N  R+K  +F++ YLRK L
Sbjct:   74 DYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGII-FGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENIGTIFWYAVVGTLWNSIGIGVSLFGICQIEAFGLS----DITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIETIDVFAGIANFFVVGIGGVLIGIFLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLMWRALGVFVLTQVINRF----RTIPLTFKDQFIIAYGGLRGAICFALVFLLPAAVFP---------RKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIYCRLFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRKLL 542          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A3 (solute carrier family 9 member A3 [Source:HGNC Symbol;Acc:HGNC:11073])

HSP 1 Score: 185.267 bits (469), Expect = 1.309e-48
Identity = 187/518 (36.10%), Postives = 299/518 (57.72%), Query Frame = 2
Query:  161 SANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYL-RKFLQKSSVSYDDSLMKVIDKMSL 1696
            S    V  +++  V+D ++I+L++L   + K      H + + +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GT++N    G +LYGV   G+      +L + L   LLF SL+ AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G++F  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  +++     W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVA+ L VL+D +K+           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L R  +++S+    D ++ V  +++L
Sbjct:   39 SGGFQVVTFEWAHVQDPYVIALWILVASLAKIGFHLSHKVTSVVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMG----DLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMV--QLEPIDQVVLSYGGLRGAVAFALVVLLDGDKVK---------EKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNL 540          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A3 (solute carrier family 9 member A3 [Source:HGNC Symbol;Acc:HGNC:11073])

HSP 1 Score: 184.882 bits (468), Expect = 2.152e-48
Identity = 187/518 (36.10%), Postives = 299/518 (57.72%), Query Frame = 2
Query:  161 SANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYL-RKFLQKSSVSYDDSLMKVIDKMSL 1696
            S    V  +++  V+D ++I+L++L   + K      H + + +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GT++N    G +LYGV   G+      +L + L   LLF SL+ AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G++F  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  +++     W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVA+ L VL+D +K+           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L R  +++S+    D ++ V  +++L
Sbjct:   39 SGGFQVVTFEWAHVQDPYVIALWILVASLAKIGFHLSHKVTSVVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMG----DLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMV--QLEPIDQVVLSYGGLRGAVAFALVVLLDGDKVK---------EKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPRLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNL 540          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A1 (solute carrier family 9 member A1 [Source:HGNC Symbol;Acc:HGNC:11071])

HSP 1 Score: 176.792 bits (447), Expect = 7.917e-46
Identity = 188/560 (33.57%), Postives = 301/560 (53.75%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEE------KDKYE 1831
            V G D+  V+  F ISL++L   ++K     +  I++ +PES +L+ VG   G + +        F +  ++FFL LLPPI+L++ Y +  R F    G  +++AV+GT++N   +G  +Y V   G         N+ L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F   E +  + I LG +SFF V+LGG+L+G+++G+I    +R   +    E   + L  Y++Y+ A+    SGI+A+I  G+V   Y   NIS +S   ++  ++MW+++SE +IF+FLG S       W+  FV  +L  C++AR +    L    N   +   K++  +  +I YGGLRGA+A+ L  L+D +              +L +T  + +I FTV   G+T++PLV LL +K  +    S+ +  +   +D  L+GIE I G  G +  ++K+ RFN  Y++K L     S +  L+    KM +     +V   ESG  + +IP  +        +P  + +E       KDK E
Sbjct:   91 VLGIDYTHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIK-GVGETPPF-LQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLMYAVCLVGGEQIN----NIGLLDNLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFANYEHVGIVDIFLGFLSFFVVALGGVLVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHHWNWTFVISTLLFCLIARVLGVLGLTWFINKFRI--VKLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMC---------DLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELV---ESGG-MGKIPSAVSTVSMQNIHPKSLPSERILPALSKDKEE 629          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Match: SLC9A3 (solute carrier family 9 member A3 [Source:HGNC Symbol;Acc:HGNC:11073])

HSP 1 Score: 174.866 bits (442), Expect = 3.853e-45
Identity = 179/518 (34.56%), Postives = 289/518 (55.79%), Query Frame = 2
Query:  161 SANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYL-RKFLQKSSVSYDDSLMKVIDKMSL 1696
            S    V  +++  V+D ++I+L++L   + K      H + + +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GT++N    G +LYGV   G+      +L + L   LLF SL+ AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G++F  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  +++     W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVA+ L VL+D +K+           + L ++TT+ ++ FTV    L +         K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L R  +++S+    D ++ V  +++L
Sbjct:   39 SGGFQVVTFEWAHVQDPYVIALWILVASLAKIGFHLSHKVTSVVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVVGTVWNAATTGLSLYGVFLSGLMG----DLQIGLLDFLLFGSLMAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVALGGDNVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASSAETIIFMFLGISAVNPFIWTWNTAFVLLTLVFISVYRAIGVVLQTWLLNRYRMV--QLEPIDQVVLSYGGLRGAVAFALVVLLDGDKVK---------EKNLFVSTTIIVVFFTVIFQWLKV---------KRSEHREPRLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSHFDRKFLSRVLMRRSAQKSRDRILNVFHELNL 531          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 169.859 bits (429), Expect = 2.085e-44
Identity = 196/605 (32.40%), Postives = 321/605 (53.06%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTR-IYDNKFEVAV-IILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSV--SYD-DSLMKVIDKMSL--AMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHG 1972
            W +++V   ++I++++L   + K +   +  I+ + P+S +L+ VG + G I    + S    T++ + FFL LLPPI+ ++ Y M  R+ +  F   ++++V GTI+N   IG +L  +    +       ++ T   IL+FS+LI AVDPVAV+A+F +I V + L+  VFGE+L ND VTVVLY + K+F  +G+E +S L    G +SFF V+LGG  +G+IF I   L T+  YD +    V I +L Y++Y+ A+ +  S IIAI  CG++  +Y   N++  +   ++   +M A  SE VIF+FLG S    +  +   F+  +LF C++ RA   G++     L     +K  M +  ++ YGGLRGA+AY L V I A     +  A   F     IT T+ +I FTV   G+T++PLV  LKIK  +  D ++ ++     +D  +SG+E I+G  G     E   RFN   ++  L +     S+D  S+++  +K++L  A+  A VK +   + L  I  + R    +   P  I N++    +   LK   ES  +I +    +T F + L R   +    S   ++V G
Sbjct:   13 WKWDDVHHVYVITVWLLIASLAKILFNLMKPISKWCPDSSLLIIVGLALGWILHQTSLSGA--TLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLMAQYDLFT-----MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALGGAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISSQHHFDLYFICATLFFCLIYRA--IGIVVQCYILNRFRAKKFEMVDQFIMSYGGLRGAIAYGLVVSIPA-----SITAKPMF-----ITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKGHYTFIENFERFNAKVIKPVLMRHQKRESFDASSIVRAYEKITLEDAIKLAKVKNNIQNKRLERIKSKGRVAPIL---PDKISNQKTMTPKDLQLKRFMESGENIDSL---YTLFSDLLDRKLHEMNRPSVQITDVDG 592          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 169.859 bits (429), Expect = 2.487e-44
Identity = 197/617 (31.93%), Postives = 326/617 (52.84%), Query Frame = 2
Query:  149 RQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTR-IYDNKFEVAV-IILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSV--SYD-DSLMKVIDKMSL--AMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHG 1972
            +++ S    +  W +++V   ++I++++L   + K +   +  I+ + P+S +L+ VG + G I    + S    T++ + FFL LLPPI+ ++ Y M  R+ +  F   ++++V GTI+N   IG +L  +    +       ++ T   IL+FS+LI AVDPVAV+A+F +I V + L+  VFGE+L ND VTVVLY + K+F  +G+E +S L    G +SFF V+LGG  +G+IF I   L T+  YD +    V I +L Y++Y+ A+ +  S IIAI  CG++  +Y   N++  +   ++   +M A  SE VIF+FLG S    +  +   F+  +LF C++ RA   G++     L     +K  M +  ++ YGGLRGA+AY L V I A     +  A   F     IT T+ +I FTV   G+T++PLV  LKIK  +  D ++ ++     +D  +SG+E I+G  G     E   RFN   ++  L +     S+D  S+++  +K++L  A+  A VK +   + L  I  + R    +   P  I N++    +   LK   ES  +I +    +T F + L R   +    S   ++V G
Sbjct:   21 KELISDGFQLFTWKWDDVHHVYVITVWLLIASLAKILFNLMKPISKWCPDSSLLIIVGLALGWILHQTSLSGA--TLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLMAQYDLFT-----MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALGGAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISSQHHFDLYFICATLFFCLIYRA--IGIVVQCYILNRFRAKKFEMVDQFIMSYGGLRGAIAYGLVVSIPA-----SITAKPMF-----ITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKGHYTFIENFERFNAKVIKPVLMRHQKRESFDASSIVRAYEKITLEDAIKLAKVKNNIQNKRLERIKSKGRVAPIL---PDKISNQKTMTPKDLQLKRFMESGENIDSL---YTLFSDLLDRKLHEMNRPSVQITDVDG 612          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-3 (Probable Na(+)/H(+) antiporter nhx-3 [Source:UniProtKB/Swiss-Prot;Acc:O16452])

HSP 1 Score: 161.77 bits (408), Expect = 1.025e-41
Identity = 178/540 (32.96%), Postives = 295/540 (54.63%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAV---IILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVF--WSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQK--SSVSYD-DSLMKVIDKMSL--AMHYAIVKPSESGEYLHEIPERLR 1768
            W+++ +   ++I+ ++L   + K +   +  ++ ++P+S +L+ VG   G      T S V   ++ + FFL LLPPI+ ++ Y M  R+ ++ F   ++++VLGT++N   IG +L  ++   +       +  T   IL+FS+LI AVDPVAV+AIF +I V + L+  VFGE+L ND VTVVLY + K+F  +G+E +S      G +SFF V+LGG  IG+IF I T L T+ Y    ++     I LL Y++Y+ A+ +  S IIAI  CG++  +Y   NI+  +   ++   +M A  SE VIF+FLG  LS +    H  F+F   +L  C++ RA   G++     L     +K  + +  ++ YGGLRGA+AY L V I A     +  A   F     ITTT+ +I FTV   G+T++PLV  L +K  +  + ++ ++     +D  +SG+E I+G  G     E   RFN   ++  L +     S+D  S+++  +K++L  A+    VK +   + L ++   +R
Sbjct:   14 WNWDHIHKVYVITTWLLVASLAKILFNLMKPLSKWLPDSSLLIIVGLGLGYFLNQTTLSGVH--LDSHAFFLYLLPPIIFDAGYFMPNRALFKNFDSVLVFSVLGTLWNTFAIGGSLLIMSKYQLFT-----MPFTTFEILVFSALISAVDPVAVIAIFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSPWDYATGGLSFFVVALGGAAIGIIFAIATSLATK-YTQGIKILAPVFIFLLPYMAYLTAEMVSLSSIIAIAVCGMLMKQYIKGNITEAATNSVKYFTKMLAQCSETVIFMFLG--LSTLTSEHHVDFIFIGATLVFCLIYRA--IGIIVQCFILNKFRAKKFEVVDQFILSYGGLRGAIAYGLVVSIPA-----SIQAKPMF-----ITTTICVIYFTVFLQGITIRPLVNCLNVKKKEHREATMVESVYNKYLDYMMSGVEDIAGQRGHYSFIENFERFNAKVIKPVLMRHEKRQSFDATSIIRAYEKITLEDAIKLTKVKSTLQNKRLEKVKSEVR 531          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-3 (Probable Na(+)/H(+) antiporter nhx-3 [Source:UniProtKB/Swiss-Prot;Acc:O16452])

HSP 1 Score: 161.77 bits (408), Expect = 1.115e-41
Identity = 178/540 (32.96%), Postives = 295/540 (54.63%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAV---IILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVF--WSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQK--SSVSYD-DSLMKVIDKMSL--AMHYAIVKPSESGEYLHEIPERLR 1768
            W+++ +   ++I+ ++L   + K +   +  ++ ++P+S +L+ VG   G      T S V   ++ + FFL LLPPI+ ++ Y M  R+ ++ F   ++++VLGT++N   IG +L  ++   +       +  T   IL+FS+LI AVDPVAV+AIF +I V + L+  VFGE+L ND VTVVLY + K+F  +G+E +S      G +SFF V+LGG  IG+IF I T L T+ Y    ++     I LL Y++Y+ A+ +  S IIAI  CG++  +Y   NI+  +   ++   +M A  SE VIF+FLG  LS +    H  F+F   +L  C++ RA   G++     L     +K  + +  ++ YGGLRGA+AY L V I A     +  A   F     ITTT+ +I FTV   G+T++PLV  L +K  +  + ++ ++     +D  +SG+E I+G  G     E   RFN   ++  L +     S+D  S+++  +K++L  A+    VK +   + L ++   +R
Sbjct:   33 WNWDHIHKVYVITTWLLVASLAKILFNLMKPLSKWLPDSSLLIIVGLGLGYFLNQTTLSGVH--LDSHAFFLYLLPPIIFDAGYFMPNRALFKNFDSVLVFSVLGTLWNTFAIGGSLLIMSKYQLFT-----MPFTTFEILVFSALISAVDPVAVIAIFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSPWDYATGGLSFFVVALGGAAIGIIFAIATSLATK-YTQGIKILAPVFIFLLPYMAYLTAEMVSLSSIIAIAVCGMLMKQYIKGNITEAATNSVKYFTKMLAQCSETVIFMFLG--LSTLTSEHHVDFIFIGATLVFCLIYRA--IGIIVQCFILNKFRAKKFEVVDQFILSYGGLRGAIAYGLVVSIPA-----SIQAKPMF-----ITTTICVIYFTVFLQGITIRPLVNCLNVKKKEHREATMVESVYNKYLDYMMSGVEDIAGQRGHYSFIENFERFNAKVIKPVLMRHEKRQSFDATSIIRAYEKITLEDAIKLTKVKSTLQNKRLEKVKSEVR 550          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Match: nhx-9 (Probable Na(+)/H(+) antiporter nhx-9 [Source:UniProtKB/Swiss-Prot;Acc:P35449])

HSP 1 Score: 160.229 bits (404), Expect = 2.551e-41
Identity = 191/574 (33.28%), Postives = 304/574 (52.96%), Query Frame = 2
Query:  278 INAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTR-IYDNKFEVAV-IILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSV--SYD-DSLMKVIDKMSL--AMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHG 1972
            I+ + P+S +L+ VG + G I    + S    T++ + FFL LLPPI+ ++ Y M  R+ +  F   ++++V GTI+N   IG +L  +    +       ++ T   IL+FS+LI AVDPVAV+A+F +I V + L+  VFGE+L ND VTVVLY + K+F  +G+E +S L    G +SFF V+LGG  +G+IF I   L T+  YD +    V I +L Y++Y+ A+ +  S IIAI  CG++  +Y   N++  +   ++   +M A  SE VIF+FLG S    +  +   F+  +LF C++ RA   G++     L     +K  M +  ++ YGGLRGA+AY L V I A     +  A   F     IT T+ +I FTV   G+T++PLV  LKIK  +  D ++ ++     +D  +SG+E I+G  G     E   RFN   ++  L +     S+D  S+++  +K++L  A+  A VK +   + L  I  + R    +   P  I N++    +   LK   ES  +I +    +T F + L R   +    S   ++V G
Sbjct:    4 ISKWCPDSSLLIIVGLALGWILHQTSLSGA--TLDSHTFFLYLLPPIIFDAGYFMPNRALFENFDSVLVFSVFGTIWNTFAIGGSLLLMAQYDLFT-----MSFTTFEILVFSALISAVDPVAVIAVFEEIHVNEFLFINVFGEALFNDGVTVVLYQMFKSFALIGSENLSVLDYATGGLSFFVVALGGAAVGIIFAIAASLTTKYTYDVRILAPVFIFVLPYMAYLTAEMVSLSSIIAIAICGMLMKQYIKGNVTQAAANSVKYFTKMLAQSSETVIFMFLGLSTISSQHHFDLYFICATLFFCLIYRA--IGIVVQCYILNRFRAKKFEMVDQFIMSYGGLRGAIAYGLVVSIPA-----SITAKPMF-----ITATIAVIYFTVFLQGITIRPLVNFLKIKKKEERDPTMVESVYNKYLDYMMSGVEDIAGQKGHYTFIENFERFNAKVIKPVLMRHQKRESFDASSIVRAYEKITLEDAIKLAKVKNNIQNKRLERIKSKGRVAPIL---PDKISNQKTMTPKDLQLKRFMESGENIDSL---YTLFSDLLDRKLHEMNRPSVQITDVDG 552          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0299909)

HSP 1 Score: 172.17 bits (435), Expect = 4.707e-45
Identity = 184/487 (37.78%), Postives = 280/487 (57.49%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL 1636
            DF  VK  FII +++L   I K        ++   PES +L+ VG   G++  F T+  V   + PN FF  +LPPI+L++ Y M  R F+   G  ++ AV+GTIFN   IG +LY     G+           L  + LF+SLI AVDPVAVLA+F +I V + LY +VFGESLLNDAVTVV+Y +M+++  +G + I +  I  G+ SFF V+LGG  IG+I+G +T LVTR  D+    E   I ++ Y++Y+ A+    SGI+AI  CGI    Y  +NIS +S   ++  ++M ++ +E +IF+FLG +  +    W++ FV  ++  C V R +   LL+ + N   L   K+S  +  V+ YGGLRGAVA+ L +L+D   +           + + +TTT+ +I FTV   G+T+KPLVK+L +K A     ++ +  +   +D  ++GIE I G  G   +R+K  RF+N ++R  L
Sbjct:  189 DFARVKTPFIIGIWILSASIAKIGFHMTPKLHLIFPESCLLIVVGVVIGVVLYFCTDVAVS-PLTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGKMGIYGESETP---GLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTWFVVLTIAFCSVFRVIGVILLSALANRFRLH--KLSRVDQFVMSYGGLRGAVAFALVLLVDENVVK---------QKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTGNYNVRDKFKRFDNRFIRPLL 660          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0299911)

HSP 1 Score: 172.555 bits (436), Expect = 6.374e-45
Identity = 184/487 (37.78%), Postives = 280/487 (57.49%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL 1636
            DF  VK  FII +++L   I K        ++   PES +L+ VG   G++  F T+  V   + PN FF  +LPPI+L++ Y M  R F+   G  ++ AV+GTIFN   IG +LY     G+           L  + LF+SLI AVDPVAVLA+F +I V + LY +VFGESLLNDAVTVV+Y +M+++  +G + I +  I  G+ SFF V+LGG  IG+I+G +T LVTR  D+    E   I ++ Y++Y+ A+    SGI+AI  CGI    Y  +NIS +S   ++  ++M ++ +E +IF+FLG +  +    W++ FV  ++  C V R +   LL+ + N   L   K+S  +  V+ YGGLRGAVA+ L +L+D   +           + + +TTT+ +I FTV   G+T+KPLVK+L +K A     ++ +  +   +D  ++GIE I G  G   +R+K  RF+N ++R  L
Sbjct:  189 DFARVKTPFIIGIWILSASIAKIGFHMTPKLHLIFPESCLLIVVGVVIGVVLYFCTDVAVS-PLTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGKMGIYGESE---TPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTWFVVLTIAFCSVFRVIGVILLSALANRFRLH--KLSRVDQFVMSYGGLRGAVAFALVLLVDENVVK---------QKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTGNYNVRDKFKRFDNRFIRPLL 660          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0334172)

HSP 1 Score: 171.4 bits (433), Expect = 6.435e-44
Identity = 190/523 (36.33%), Postives = 295/523 (56.41%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSL--AMHYAIVKPSESGE 1738
            DF  VK  FII +++L   I K        ++   PES +L+ VG   G++  F T+  V   + PN FF  +LPPI+L++ Y M  R F+   G  ++ AV+GTIFN   IG +LY     G+           L  + LF+SLI AVDPVAVLA+F +I V + LY +VFGESLLNDAVTVV+Y +M+++  +G + I +  I  G+ SFF V+LGG  IG+I+G +T LVTR  D+    E   I ++ Y++Y+ A+    SGI+AI  CGI    Y  +NIS +S   ++  ++M ++ +E +IF+FLG +  +    W++ FV  ++  C V R +   LL+ + N   L   K+S  +  V+ YGGLRGAVA+ L +L+D   +           + + +TTT+ +I FTV   G+T+KPLVK+L +K A     ++ +  +   +D  ++GIE I G  G   +R+K  RF+N ++R  L +     +  +++   K+++  AM      PS  G+
Sbjct:  189 DFARVKTPFIIGIWILSASIAKIGFHMTPKLHLIFPESCLLIVVGVVIGVVLYFCTDVAVS-PLTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGKMGIYGESE---TPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTWFVVLTIAFCSVFRVIGVILLSALANRFRLH--KLSRVDQFVMSYGGLRGAVAFALVLLVDENVVK---------QKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTGNYNVRDKFKRFDNRFIRPLLIRDLKGAEPKIIETYSKLTMRDAMEVMRRNPSTIGQ 696          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0306016)

HSP 1 Score: 171.014 bits (432), Expect = 8.591e-44
Identity = 190/523 (36.33%), Postives = 295/523 (56.41%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSL--AMHYAIVKPSESGE 1738
            DF  VK  FII +++L   I K        ++   PES +L+ VG   G++  F T+  V   + PN FF  +LPPI+L++ Y M  R F+   G  ++ AV+GTIFN   IG +LY     G+           L  + LF+SLI AVDPVAVLA+F +I V + LY +VFGESLLNDAVTVV+Y +M+++  +G + I +  I  G+ SFF V+LGG  IG+I+G +T LVTR  D+    E   I ++ Y++Y+ A+    SGI+AI  CGI    Y  +NIS +S   ++  ++M ++ +E +IF+FLG +  +    W++ FV  ++  C V R +   LL+ + N   L   K+S  +  V+ YGGLRGAVA+ L +L+D   +           + + +TTT+ +I FTV   G+T+KPLVK+L +K A     ++ +  +   +D  ++GIE I G  G   +R+K  RF+N ++R  L +     +  +++   K+++  AM      PS  G+
Sbjct:  189 DFARVKTPFIIGIWILSASIAKIGFHMTPKLHLIFPESCLLIVVGVVIGVVLYFCTDVAVS-PLTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGKMGIYGESE---TPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTWFVVLTIAFCSVFRVIGVILLSALANRFRLH--KLSRVDQFVMSYGGLRGAVAFALVLLVDENVVK---------QKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTGNYNVRDKFKRFDNRFIRPLLIRDLKGAEPKIIETYSKLTMRDAMEVMRRNPSTIGQ 696          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Match: Nhe2 (gene:FBgn0040297 transcript:FBtr0306015)

HSP 1 Score: 170.244 bits (430), Expect = 1.264e-43
Identity = 190/523 (36.33%), Postives = 295/523 (56.41%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSL--AMHYAIVKPSESGE 1738
            DF  VK  FII +++L   I K        ++   PES +L+ VG   G++  F T+  V   + PN FF  +LPPI+L++ Y M  R F+   G  ++ AV+GTIFN   IG +LY     G+           L  + LF+SLI AVDPVAVLA+F +I V + LY +VFGESLLNDAVTVV+Y +M+++  +G + I +  I  G+ SFF V+LGG  IG+I+G +T LVTR  D+    E   I ++ Y++Y+ A+    SGI+AI  CGI    Y  +NIS +S   ++  ++M ++ +E +IF+FLG +  +    W++ FV  ++  C V R +   LL+ + N   L   K+S  +  V+ YGGLRGAVA+ L +L+D   +           + + +TTT+ +I FTV   G+T+KPLVK+L +K A     ++ +  +   +D  ++GIE I G  G   +R+K  RF+N ++R  L +     +  +++   K+++  AM      PS  G+
Sbjct:  189 DFARVKTPFIIGIWILSASIAKIGFHMTPKLHLIFPESCLLIVVGVVIGVVLYFCTDVAVS-PLTPNTFFFYMLPPIILDAGYFMPNRLFFDNLGTILLMAVVGTIFNIATIGGSLYACGKMGIYGESE---TPGLMDVFLFASLISAVDPVAVLAVFEEIHVNEILYIVVFGESLLNDAVTVVMYHMMESYNEIGLDKIIAQDIASGVGSFFVVALGGTAIGIIWGFLTGLVTRFTDHVRVIEPIFIFVMAYLAYLNAEIFHMSGILAITFCGITMKNYVESNISQKSHTTVKYALKMLSSSAETIIFMFLGVATVNNMHVWNTWFVVLTIAFCSVFRVIGVILLSALANRFRLH--KLSRVDQFVMSYGGLRGAVAFALVLLVDENVVK---------QKNMFVTTTIAVIYFTVFLQGITIKPLVKILNVKRANKRKPTMNERIHERFMDHLMAGIEDIVGKTGNYNVRDKFKRFDNRFIRPLLIRDLKGAEPKIIETYSKLTMRDAMEVMRRNPSTIGQ 696          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a1b (solute carrier family 9 member A1b [Source:ZFIN;Acc:ZDB-GENE-080225-42])

HSP 1 Score: 181.8 bits (460), Expect = 2.570e-48
Identity = 172/511 (33.66%), Postives = 281/511 (54.99%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRF------ATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI--YDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSL 1696
            ++  V+  F ISL++L   I+K     V  ++A +PES +L+ VG   G + R         +SQ+ F        L LLPPI+L++ Y +  R F    G  + +AVLGT+++   +G  LYG      +        + L   LLF S++ AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F+    +++  + LG++ FF VS+GG+L+G ++G +    +R   +    E   + L  Y++Y+ A+    SGI+A+I CG+V   Y   NIS +S   ++  ++MW+++SE +IF+FLG S       W+  FV  +L +C+++R +    L  + N   +   K+S  +  ++ YGGLRGA+A+ LA L+ +E             ++L +T  + +I FTV   G+T++PLV LL +K  K    S+ +  +   ++  L+GIE + G  G +  R+KI RFN  Y+ +FL     S +  L+    +M L
Sbjct:   35 NYQHVQMPFEISLWILLASILKLGFHLVPHVSAVVPESCVLIVVGLLVGGLIRVLGEDPPVLDSQLFF--------LCLLPPIILDAGYFLPIRPFMENVGTILTFAVLGTLWSAFFMGVALYGACQLEGAELA----GVDLLSCLLFGSIVSAVDPVAVLAVFQEIHINELLHILVFGESLLNDAVTVVLYHLFEEFVHRGEVTAGDVFLGVVCFFVVSVGGVLVGCVYGFLAAFTSRFTAHTRVIEPLFVFLYSYMAYLSAEVFHLSGIMALIACGVVMRPYVEANISHKSYTTIKYFLKMWSSVSETLIFIFLGVSTVAGPHAWNWTFVSLTLALCLLSRVLGVVGLTFIINKYRMV--KLSGKDQFIVAYGGLRGAIAFSLAFLLSSESCA---------MKDLFLTAVITVIFFTVFVQGMTIRPLVDLLAVKKKKQSKFSVNEEIHTQFLEHLLTGIEDVCGHYGHHHWRDKISRFNKRYMMRFLIGGERSQEPQLISFYKQMEL 522          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a3.2 (solute carrier family 9 member A3, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-060503-640])

HSP 1 Score: 182.956 bits (463), Expect = 4.987e-48
Identity = 183/526 (34.79%), Postives = 291/526 (55.32%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKG---WHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDR--KISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSV-SYDDSLMKVIDKMSLAMHYAIVKPSES 1732
            W ++ V+  ++++L++L   + K V    H I + IPES +L+ +G   G I   A  +Q  F + P  FF  LLP I+L+++Y M  + F+   G  +++A++GT +N   +G  L+    GG        LN+     LLF +L+ AVDPVAV+A+F ++ V + LY +VFGESLLND VTVVLY++  AF  LG   I++ +I  GI+SF  V+ GG  +G++F ++T ++TR+  N    E   II+LGY+SY+ A+ +  S I+++  CG+   +Y   N+  +S+  LR  +++ AN SE +IF+FLG  +S I++    W++GF+  +L   +V R     +     N +  + R   I +T+ +V+ YGGLRGAVAY LA  +D  K+           + L + TTL ++ FTV   G+TMKPLV  LK+K A   DL+L    N  + +  L+G+E I G +G N        F   Y+   L  S     +D ++    K+++      V   ES
Sbjct:   64 WKWHHVETPYLVALWILTCWLCKLVTELNHNITSVIPESGLLIILGFILGGIVWGADKAQT-FKLIPVNFFYYLLPQIILDASYCMPNKLFFGNLGAILVHAIIGTCWNAGTVGIALWACYEGGAMGT----LNIGCLQFLLFGALMSAVDPVAVIAVFEEVHVNEVLYILVFGESLLNDGVTVVLYNVFDAFVSLGGPKINAAEIIKGIVSFAVVAFGGSFLGVVFAVLTSMLTRVTKNVQIIEAGFIIVLGYLSYLTAEMLSLSAILSLTFCGVCCQKYINANMDEKSVTCLRYSLKVLANGSETMIFVFLG--VSAIDQTIWVWNTGFILLTLLFIVVFR----MMGVFFLNWILNQSRLIPIDLTDQLVMGYGGLRGAVAYGLAASLDENKIP---------EKNLMLGTTLIVVYFTVILQGITMKPLVNWLKVKKATQSDLTLNGKLNNRVFEHTLTGMEDICGRMGDNWWTRHWNHFEEKYVCWLLMTSEARKRNDKILDAFHKLNVEDATKYVNEGES 569          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 180.259 bits (456), Expect = 3.758e-47
Identity = 183/515 (35.53%), Postives = 284/515 (55.15%), Query Frame = 2
Query:  191 FNEVKDFFIISLFVLCLLIVKFVHFKV-HWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKG-WHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYD-DSLMKVIDKMSL--AMHY 1708
            ++ V+  ++++L+V    + K    ++ H I    PES +L+ +G   G I   A  +Q  F + P+ FF  LLP I+L+++Y M  + F+R  G  ++YA+ GT +N   +G +L+G    G       +LN+ L   LLF SLI AVDPVAV+A+F ++ V + L+ +VFGESLLND VTVVLY++   F  LG   I + +I  GI SF  V+ GG  +G+ F I+  L+TR   +    E   + L+GY+SY+ A+ +  S I++I  CG+   +Y   N+   S+  +R+ ++M AN SE +IFLFLG +    E   W++GF+  +L    + R +   +   + N   L    + + + +V+ YGGLRGAVAY LA ++D  ++           ++L I+TTL ++ FTV   G+TMKPLV+ LK+K A   DL L +  N    D  L+ +E I G IG N       RF   Y+   L K     + D L  +  K++L  AM+Y
Sbjct:   51 WHHVETPYLVALWVFVAGLAKLSVIQLNHSITGVFPESGLLIILGFILGGIVVGADKAQT-FKLLPSTFFYYLLPQIILDASYFMPNKLFFRNLGAILIYAIFGTCWNAAAVGLSLWGCHEAGAMG----DLNIGLLQFLLFGSLIAAVDPVAVIAVFEEVHVNEVLFILVFGESLLNDGVTVVLYNVFDGFVSLGGPMIDAAEIFKGICSFVVVAFGGSFVGVAFAILLSLLTRCTKHVQIIEAGFVFLVGYLSYLTAEMLSLSAILSITFCGVCCQKYINANMDERSVTTVRHAMKMLANGSETMIFLFLGVTAIDTEIWVWNTGFILLTLLFIFIYRIIGVFMFTWMLNKFRL--VPVELIDQVVMSYGGLRGAVAYGLAAMLDESRIP---------EKKLMISTTLIVVYFTVILQGITMKPLVQWLKVKRAAHSDLKLVEKLNNRAFDHILAAVEDICGRIGDNWWTRGWNRFEEKYISWLLMKPKARKNRDYLFNIFHKLNLEDAMNY 549          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 180.259 bits (456), Expect = 3.758e-47
Identity = 183/515 (35.53%), Postives = 284/515 (55.15%), Query Frame = 2
Query:  191 FNEVKDFFIISLFVLCLLIVKFVHFKV-HWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKG-WHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYD-DSLMKVIDKMSL--AMHY 1708
            ++ V+  ++++L+V    + K    ++ H I    PES +L+ +G   G I   A  +Q  F + P+ FF  LLP I+L+++Y M  + F+R  G  ++YA+ GT +N   +G +L+G    G       +LN+ L   LLF SLI AVDPVAV+A+F ++ V + L+ +VFGESLLND VTVVLY++   F  LG   I + +I  GI SF  V+ GG  +G+ F I+  L+TR   +    E   + L+GY+SY+ A+ +  S I++I  CG+   +Y   N+   S+  +R+ ++M AN SE +IFLFLG +    E   W++GF+  +L    + R +   +   + N   L    + + + +V+ YGGLRGAVAY LA ++D  ++           ++L I+TTL ++ FTV   G+TMKPLV+ LK+K A   DL L +  N    D  L+ +E I G IG N       RF   Y+   L K     + D L  +  K++L  AM+Y
Sbjct:   51 WHHVETPYLVALWVFVAGLAKLSVIQLNHSITGVFPESGLLIILGFILGGIVVGADKAQT-FKLLPSTFFYYLLPQIILDASYFMPNKLFFRNLGAILIYAIFGTCWNAAAVGLSLWGCHEAGAMG----DLNIGLLQFLLFGSLIAAVDPVAVIAVFEEVHVNEVLFILVFGESLLNDGVTVVLYNVFDGFVSLGGPMIDAAEIFKGICSFVVVAFGGSFVGVAFAILLSLLTRCTKHVQIIEAGFVFLVGYLSYLTAEMLSLSAILSITFCGVCCQKYINANMDERSVTTVRHAMKMLANGSETMIFLFLGVTAIDTEIWVWNTGFILLTLLFIFIYRIIGVFMFTWMLNKFRL--VPVELIDQVVMSYGGLRGAVAYGLAAMLDESRIP---------EKKLMISTTLIVVYFTVILQGITMKPLVQWLKVKRAAHSDLKLVEKLNNRAFDHILAAVEDICGRIGDNWWTRGWNRFEEKYISWLLMKPKARKNRDYLFNIFHKLNLEDAMNY 549          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Match: slc9a5 (solute carrier family 9 member A5 [Source:ZFIN;Acc:ZDB-GENE-080225-43])

HSP 1 Score: 165.622 bits (418), Expect = 4.570e-42
Identity = 182/514 (35.41%), Postives = 287/514 (55.84%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFV-HFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXX--XXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEK---GWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTEL--IVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSL 1696
            W+++ V+  +II+ ++L   + K + HF   +  A +PES +L+ +G + G +   A+  Q  + ++P LFFL LLP IV ++ Y M  R F+   G  +MYAV+GT++N    GF LYGV   GV      +++  L   LLF +LI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY +  +F+   P +        GI SF  VS+GG L+GLIF +I    TR        E   I LL Y++Y+ A+    S I+++  CGI   +Y   NIS +S   ++  ++  A+++E +IF+FLG  +S ++K    W +G V  +L   +V RA+         N      R + + ++  +V+ YGGLRGAVA+ L VL+D E +           ++  + TT+ ++ FTV   GLT+KPLVK LK+  +     ++ +  +    D  L+ +E I+G  G +  R+K  +F+ +YL K L + SV +   L +   K+++
Sbjct:   89 WEWSYVQTPYIIASWLLVASVAKILFHFSQRFTTA-VPESCMLILLGLALGTVVLLASKKQ-PYQLDPGLFFLFLLPTIVGDAGYFMPARLFFDNLGAILMYAVVGTLWNAFCTGFCLYGVKMAGVIDE---KVDAGLMEFLLFGALISAVDPVAVLAVFEEVHVNETLFIIVFGESLLNDAVTVVLYKVYISFVEVGPGNVNTADYFKGIASFLIVSIGGTLVGLIFAVILAFFTRFTKKVRIIEPMFIFLLVYLAYLTAELFSLSAILSLTFCGIGCNKYVEANISQKSRTTVKYTMKTLASIAETIIFIFLG--ISAVDKSKWAWDTGLVVSTLIFILVFRAMGVIGQTWFLNWF----RLVPLDKIDQVVMSYGGLRGAVAFALVVLLDKEHVKA---------KDYFVATTIVVVFFTVMFQGLTIKPLVKWLKVPRSTNRKPTINEEIHERAFDHILAAVEDIAGLNGYHHWRDKWEQFDKNYLSKLLLRKSVYHKSELWEAYQKINI 582          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: SLC9A3 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100492870])

HSP 1 Score: 188.734 bits (478), Expect = 7.320e-50
Identity = 215/651 (33.03%), Postives = 346/651 (53.15%), Query Frame = 2
Query:  119 LWIFVVLNLFRQISS--ANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRK-FLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASN--VHGYF---KEMQKVLHQKHKTITEK 2029
            LWI +     +Q+S    ++ +  + ++ V+D +II++++L   + K V    H +   +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+  Y    L++ +   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  +G   +++     G++SFF VS+GG LIG+ F  I  LVTR   +    E   I ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E ++F+FLG S    HI   W++ F+  +L    V R +   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  ++           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D   S IE +SG IG N IR+KI  F++ YL K F++KS+    D ++ V  ++++    + V   E    L  I  R    ++M    F        +  +  L   N S+V +          ++AL + R+  R   D  S+  +  Y    +  QK L+ +H+   ++
Sbjct:    3 LWIKI-----KQVSDIPTSLQIVTFKWHHVQDPYIIAVWILVASLAKIVFHISHKVTTVVPES-CLLIVLGLLLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFENLGTILLYAVIGTIWNAATTGLSLYGVYLTGIMGY----LDIGVLEFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVAIGGANVTAEDCVKGVVSFFVVSIGGTLIGIAFAYILSLVTRFTKHVRIIEPGFIFIISYLSYLTSEMLSLSAILAITFCGIFCQKYVKANISEQSATTVRYTMKMLASGAETIVFMFLGISAVNPHIWT-WNTAFILLTLVFISVYRVIGVVLQTWILNRYRMV--QLEIIDQVVMSYGGLRGAVAFALVALLDENRVK---------EKNLFVSTTIIVVYFTVIFQGLTIKPLVQWLKVKRSEHRERKLNEKLHSRAFDHICSAIEDVSGQIGHNYIRDKISSFDSKYLSKIFMRKSAQKTQDRILNVFHELNMKDAISYVAEGERRGSLAFI--RSSSTENMANVDFSSPRPSLSEPSVSYLLRENISAVCLD---------MQALEQRRKSVRDVEDILSHHTLQQYLYKPRRQQKHLYSRHEVTVDE 620          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: SLC9A3 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100492870])

HSP 1 Score: 187.578 bits (475), Expect = 1.287e-49
Identity = 210/633 (33.18%), Postives = 338/633 (53.40%), Query Frame = 2
Query:  167 NVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRK-FLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASN--VHGYF---KEMQKVLHQKHKTITEK 2029
            ++ +  + ++ V+D +II++++L   + K V    H +   +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+  Y    L++ +   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  +G   +++     G++SFF VS+GG LIG+ F  I  LVTR   +    E   I ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E ++F+FLG S    HI   W++ F+  +L    V R +   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  ++           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D   S IE +SG IG N IR+KI  F++ YL K F++KS+    D ++ V  ++++    + V   E    L  I  R    ++M    F        +  +  L   N S+V +          ++AL + R+  R   D  S+  +  Y    +  QK L+ +H+   ++
Sbjct:   26 SLQIVTFKWHHVQDPYIIAVWILVASLAKIVFHISHKVTTVVPES-CLLIVLGLLLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFENLGTILLYAVIGTIWNAATTGLSLYGVYLTGIMGY----LDIGVLEFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVAIGGANVTAEDCVKGVVSFFVVSIGGTLIGIAFAYILSLVTRFTKHVRIIEPGFIFIISYLSYLTSEMLSLSAILAITFCGIFCQKYVKANISEQSATTVRYTMKMLASGAETIVFMFLGISAVNPHIWT-WNTAFILLTLVFISVYRVIGVVLQTWILNRYRMV--QLEIIDQVVMSYGGLRGAVAFALVALLDENRVK---------EKNLFVSTTIIVVYFTVIFQGLTIKPLVQWLKVKRSEHRERKLNEKLHSRAFDHICSAIEDVSGQIGHNYIRDKISSFDSKYLSKIFMRKSAQKTQDRILNVFHELNMKDAISYVAEGERRGSLAFI--RSSSTENMANVDFSSPRPSLSEPSVSYLLRENISAVCLD---------MQALEQRRKSVRDVEDILSHHTLQQYLYKPRRQQKHLYSRHEVTVDE 630          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: SLC9A3 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100492870])

HSP 1 Score: 187.578 bits (475), Expect = 1.309e-49
Identity = 210/633 (33.18%), Postives = 338/633 (53.40%), Query Frame = 2
Query:  167 NVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRK-FLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASN--VHGYF---KEMQKVLHQKHKTITEK 2029
            ++ +  + ++ V+D +II++++L   + K V    H +   +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+  Y    L++ +   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  +G   +++     G++SFF VS+GG LIG+ F  I  LVTR   +    E   I ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E ++F+FLG S    HI   W++ F+  +L    V R +   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  ++           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D   S IE +SG IG N IR+KI  F++ YL K F++KS+    D ++ V  ++++    + V   E    L  I  R    ++M    F        +  +  L   N S+V +          ++AL + R+  R   D  S+  +  Y    +  QK L+ +H+   ++
Sbjct:   32 SLQIVTFKWHHVQDPYIIAVWILVASLAKIVFHISHKVTTVVPES-CLLIVLGLLLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFENLGTILLYAVIGTIWNAATTGLSLYGVYLTGIMGY----LDIGVLEFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVAIGGANVTAEDCVKGVVSFFVVSIGGTLIGIAFAYILSLVTRFTKHVRIIEPGFIFIISYLSYLTSEMLSLSAILAITFCGIFCQKYVKANISEQSATTVRYTMKMLASGAETIVFMFLGISAVNPHIWT-WNTAFILLTLVFISVYRVIGVVLQTWILNRYRMV--QLEIIDQVVMSYGGLRGAVAFALVALLDENRVK---------EKNLFVSTTIIVVYFTVIFQGLTIKPLVQWLKVKRSEHRERKLNEKLHSRAFDHICSAIEDVSGQIGHNYIRDKISSFDSKYLSKIFMRKSAQKTQDRILNVFHELNMKDAISYVAEGERRGSLAFI--RSSSTENMANVDFSSPRPSLSEPSVSYLLRENISAVCLD---------MQALEQRRKSVRDVEDILSHHTLQQYLYKPRRQQKHLYSRHEVTVDE 636          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: SLC9A3 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100492870])

HSP 1 Score: 187.578 bits (475), Expect = 1.349e-49
Identity = 210/633 (33.18%), Postives = 338/633 (53.40%), Query Frame = 2
Query:  167 NVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRK-FLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASN--VHGYF---KEMQKVLHQKHKTITEK 2029
            ++ +  + ++ V+D +II++++L   + K V    H +   +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+  Y    L++ +   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  +G   +++     G++SFF VS+GG LIG+ F  I  LVTR   +    E   I ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E ++F+FLG S    HI   W++ F+  +L    V R +   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  ++           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D   S IE +SG IG N IR+KI  F++ YL K F++KS+    D ++ V  ++++    + V   E    L  I  R    ++M    F        +  +  L   N S+V +          ++AL + R+  R   D  S+  +  Y    +  QK L+ +H+   ++
Sbjct:   26 SLQIVTFKWHHVQDPYIIAVWILVASLAKIVFHISHKVTTVVPES-CLLIVLGLLLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFENLGTILLYAVIGTIWNAATTGLSLYGVYLTGIMGY----LDIGVLEFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVAIGGANVTAEDCVKGVVSFFVVSIGGTLIGIAFAYILSLVTRFTKHVRIIEPGFIFIISYLSYLTSEMLSLSAILAITFCGIFCQKYVKANISEQSATTVRYTMKMLASGAETIVFMFLGISAVNPHIWT-WNTAFILLTLVFISVYRVIGVVLQTWILNRYRMV--QLEIIDQVVMSYGGLRGAVAFALVALLDENRVK---------EKNLFVSTTIIVVYFTVIFQGLTIKPLVQWLKVKRSEHRERKLNEKLHSRAFDHICSAIEDVSGQIGHNYIRDKISSFDSKYLSKIFMRKSAQKTQDRILNVFHELNMKDAISYVAEGERRGSLAFI--RSSSTENMANVDFSSPRPSLSEPSVSYLLRENISAVCLD---------MQALEQRRKSVRDVEDILSHHTLQQYLYKPRRQQKHLYSRHEVTVDE 630          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Match: SLC9A3 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100492870])

HSP 1 Score: 187.193 bits (474), Expect = 2.468e-49
Identity = 210/633 (33.18%), Postives = 338/633 (53.40%), Query Frame = 2
Query:  167 NVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRK-FLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASN--VHGYF---KEMQKVLHQKHKTITEK 2029
            ++ +  + ++ V+D +II++++L   + K V    H +   +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+  Y    L++ +   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  +G   +++     G++SFF VS+GG LIG+ F  I  LVTR   +    E   I ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E ++F+FLG S    HI   W++ F+  +L    V R +   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  ++           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D   S IE +SG IG N IR+KI  F++ YL K F++KS+    D ++ V  ++++    + V   E    L  I  R    ++M    F        +  +  L   N S+V +          ++AL + R+  R   D  S+  +  Y    +  QK L+ +H+   ++
Sbjct:   26 SLQIVTFKWHHVQDPYIIAVWILVASLAKIVFHISHKVTTVVPES-CLLIVLGLLLGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFENLGTILLYAVIGTIWNAATTGLSLYGVYLTGIMGY----LDIGVLEFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVAIGGANVTAEDCVKGVVSFFVVSIGGTLIGIAFAYILSLVTRFTKHVRIIEPGFIFIISYLSYLTSEMLSLSAILAITFCGIFCQKYVKANISEQSATTVRYTMKMLASGAETIVFMFLGISAVNPHIWT-WNTAFILLTLVFISVYRVIGVVLQTWILNRYRMV--QLEIIDQVVMSYGGLRGAVAFALVALLDENRVK---------EKNLFVSTTIIVVYFTVIFQGLTIKPLVQWLKVKRSEHRERKLNEKLHSRAFDHICSAIEDVSGQIGHNYIRDKISSFDSKYLSKIFMRKSAQKTQDRILNVFHELNMKDAISYVAEGERRGSLAFI--RSSSTENMANVDFSSPRPSLSEPSVSYLLRENISAVCLD---------MQALEQRRKSVRDVEDILSHHTLQQYLYKPRRQQKHLYSRHEVTVDE 630          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3 [Source:MGI Symbol;Acc:MGI:105064])

HSP 1 Score: 193.741 bits (491), Expect = 1.097e-51
Identity = 198/519 (38.15%), Postives = 301/519 (58.00%), Query Frame = 2
Query:  158 SSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIE-KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSL 1696
            S  +  V  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P LFF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG S  + +   W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVAY L VL+D +K+           + L ++TTL ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L ++S+    D ++ V  +++L
Sbjct:   33 SDGSFQVVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSIVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMV--QLETIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNL 535          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3 [Source:MGI Symbol;Acc:MGI:105064])

HSP 1 Score: 193.741 bits (491), Expect = 1.097e-51
Identity = 198/519 (38.15%), Postives = 301/519 (58.00%), Query Frame = 2
Query:  158 SSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIE-KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSL 1696
            S  +  V  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P LFF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG S  + +   W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVAY L VL+D +K+           + L ++TTL ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L ++S+    D ++ V  +++L
Sbjct:   33 SDGSFQVVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSIVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMV--QLETIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNL 535          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a3 (solute carrier family 9 (sodium/hydrogen exchanger), member 3 [Source:MGI Symbol;Acc:MGI:105064])

HSP 1 Score: 192.971 bits (489), Expect = 2.549e-51
Identity = 198/519 (38.15%), Postives = 301/519 (58.00%), Query Frame = 2
Query:  158 SSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIE-KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSL 1696
            S  +  V  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P LFF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG S  + +   W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVAY L VL+D +K+           + L ++TTL ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L ++S+    D ++ V  +++L
Sbjct:   33 SDGSFQVVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSIVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMV--QLETIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNL 535          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a2 (solute carrier family 9 (sodium/hydrogen exchanger), member 2 [Source:MGI Symbol;Acc:MGI:105075])

HSP 1 Score: 189.119 bits (479), Expect = 3.813e-50
Identity = 179/487 (36.76%), Postives = 274/487 (56.26%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMT--ELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL 1636
            D+  V+  F I+L++L   + K      H +   +PES +L+ VG   G I  F  + +    M  ++FFL LLPPIVL++ Y M TR F+  FG    YAV+GT++N + IG +L+G+             ++TL   LLF SLI AVDPVAVLA+F +I V ++LY +VFGESLLNDAVTVVLY++ K+F   + I ++ +  GI +FF V +GG+LIG++ G I    TR   N    E   + L  Y+SYI A+    SGI+AI  C +   +Y   N+S +S   ++  ++M +++SE +IF+F+G S       W+  FV ++L  C++ RA+   +L  V N      R I +T  +  +I YGGLRGA+ + L  L+ A              ++L IT  + +I FTV   G+T++PLV+ L +K +  +  ++ +  +    D   +GIE + G  G N  R+K  +F++ YLRK L
Sbjct:   75 DYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGII-FGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENFGTIFWYAVVGTLWNSIGIGVSLFGICQIEAFGLS----DITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIQTVDVFAGIANFFVVGIGGVLIGILLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLIWRALGVFVLTQVINWF----RTIPLTFKDQFIIAYGGLRGAICFALVFLLPATVFP---------RKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIHCRFFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRKLL 543          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Match: Slc9a1 (solute carrier family 9 (sodium/hydrogen exchanger), member 1 [Source:MGI Symbol;Acc:MGI:102462])

HSP 1 Score: 175.252 bits (443), Expect = 1.894e-45
Identity = 184/556 (33.09%), Postives = 298/556 (53.60%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEE------KDKYE 1831
            D+  V+  F ISL++L   ++K     +  I++ +PES +L+ VG   G + +        F +  ++FFL LLPPI+L++ Y +  R F    G  +++AV+GT++N   +G  LY V   G         N+ L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F   + +    I LG +SFF V+LGG+ +G+++G+I    +R   +    E   + L  Y++Y+ A+    SGI+A+I  G+V   Y   NIS +S   ++  ++MW+++SE +IF+FLG S       W+  FV  +L  C++AR +   +L    N   +   K++  +  +I YGGLRGA+A+ L  L+D +              +L +T  + +I FTV   G+T++PLV LL +K  +    S+ +  +   +D  L+GIE I G  G +  ++K+ RFN  Y++K L     S +  L+    KM +     +V   ESG  + +IP  +        +P  + ++       KDK E
Sbjct:   99 DYPHVRTPFEISLWILLACLMKIGFHVIPTISSIVPESCLLIVVGLLVGGLIK-GVGETPPF-LQSDVFFLFLLPPIILDAGYFLPLRQFTENLGTILIFAVVGTLWNAFFLGGLLYAVCLVGGEQIN----NIGLLDTLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFASYDSVGISDIFLGFLSFFVVALGGVFVGVVYGVIAAFTSRFTSHIRVIEPLFVFLYSYMAYLSAELFHLSGIMALIASGVVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGSHQWNWTFVISTLLFCLIARVLGVLVLTWFINKFRIV--KLTPKDQFIIAYGGLRGAIAFSLGYLLDKKHFPMC---------DLFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELV---ESGG-MGKIPSAVSTVSMQNIHPKAVTSDRILPALSKDKEE 633          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|P26433|SL9A3_RAT (Sodium/hydrogen exchanger 3 OS=Rattus norvegicus OX=10116 GN=Slc9a3 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 6.031e-51
Identity = 196/519 (37.76%), Postives = 301/519 (58.00%), Query Frame = 2
Query:  158 SSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSL 1696
            S  +  +  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P LFF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  ++  +   W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVAY L VL+D +K+           + L ++TTL ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L ++S+    D ++ V  +++L
Sbjct:   35 SGGSFQIVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSVVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVDPVIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMV--QLETIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEQREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNL 537          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|G3X939|SL9A3_MOUSE (Sodium/hydrogen exchanger 3 OS=Mus musculus OX=10090 GN=Slc9a3 PE=1 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 7.676e-51
Identity = 198/519 (38.15%), Postives = 301/519 (58.00%), Query Frame = 2
Query:  158 SSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIE-KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSL 1696
            S  +  V  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P LFF  LLPPIVL++ Y M  R F+   G  ++YAV+GTI+N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG S  + +   W++ FV  +L    V RA+   L   + N   +   ++   + +V+ YGGLRGAVAY L VL+D +K+           + L ++TTL ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L ++S+    D ++ V  +++L
Sbjct:   33 SDGSFQVVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSIVPES-ALLIVLGLVLGGIVWAADHIASFTLTPTLFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTIWNAATTGLSLYGVFLSGLMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFESFVTLGGDAVTGVDCVKGIVSFFVVSLGGTLVGVIFAFLLSLVTRFTKHVRIIEPGFVFVISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVNPDIWTWNTAFVLLTLVFISVYRAIGVVLQTWILNRYRMV--QLETIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTLIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKFLSKVLMRRSAQKSRDRILNVFHELNL 535          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|P26432|SL9A3_RABIT (Sodium/hydrogen exchanger 3 OS=Oryctolagus cuniculus OX=9986 GN=SLC9A3 PE=1 SV=1)

HSP 1 Score: 191.815 bits (486), Expect = 3.420e-50
Identity = 211/646 (32.66%), Postives = 338/646 (52.32%), Query Frame = 2
Query:  173 HVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYD-DSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSF------IEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSLQSDSARKDSHM 2074
             +  + ++ V+D +II+L+VL   + K V    H + + +PES  LL V          A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GT++N    G +LYGV   G+      EL + L   LLF SLI AVDPVAVLA+F ++ V + L+ IVFGESLLNDAVTVVLY++ ++F  LG + ++ +    GI+SFF VSLGG L+G++F  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  ++  +   W++ FV  +L    V RA+   L   + N   +   ++ + + +V+ YGGLRGAVA+ L  L+D  K+           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+  +L K L + S     D ++ V  +++L    + V   E    L                  FI +   D     +   P  S+V    + +   S       +++L + RR  R A D  +  H   ++      Q++K +  ++    S+  ++D  +
Sbjct:   42 QIVTFKWHHVQDPYIIALWVLVASLAKIVFHLSHKVTSVVPES-ALLIVLGLVLGGIVLAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFSNLGSILLYAVVGTVWNAATTGLSLYGVFLSGIMG----ELKIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNEVLFIIVFGESLLNDAVTVVLYNVFQSFVTLGGDKVTGVDCVKGIVSFFVVSLGGTLVGVVFAFLLSLVTRFTKHVRVIEPGFVFIISYLSYLTSEMLSLSSILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLGISAVDPLIWTWNTAFVLLTLLFVSVFRAIGVVLQTWLLNRYRMV--QLELIDQVVMSYGGLRGAVAFALVALLDGNKVK---------EKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKRSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWANFDRRFLSKLLMRQSAQKSRDRILNVFHELNLKDAISYVTEGERRGSLA-----------------FIRSPSTDNMVNVDFSTPRPSTVEASVSYLLRESASAVCLDMQSLEQRRRSVRDAEDVIT--HHTLQQYLYKPRQEYKHLYSRHVLSPSEDEKQDKEI 652          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|Q28362|SL9A3_DIDVI (Sodium/hydrogen exchanger 3 OS=Didelphis virginiana OX=9267 GN=SLC9A3 PE=1 SV=1)

HSP 1 Score: 190.274 bits (482), Expect = 1.315e-49
Identity = 213/648 (32.87%), Postives = 342/648 (52.78%), Query Frame = 2
Query:  173 HVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKG---WHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL-QKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTA-----NVPHTSF-IEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSLQSDSARKDSHM 2074
             +  + ++ V+D +II+L++L   + K V    H + + +PES  LL V         +A +    FT+ P +FF  LLPPIVL++ Y M  R F+   G  ++YAV+GT++N    G +LYGV   G+      +L++ L   LLF SLI AVDPVAVLA+F ++ V   L+ IVFGESLLNDAVTVVLY++  +F  LG + ++ +    GI+SFF VSLGG LIG+IF  +  LVTR   +    E   + ++ Y+SY+ ++ +  S I+AI  CGI   +Y   NIS +S   +R  ++M A+ +E +IF+FLG  +S ++     W++ F+  +L    V RA+   L   + N   +   ++ + + +V+ YGGLRGAVAY L VL+D +K+           + L ++TT+ ++ FTV   GLT+KPLV+ LK+K ++  +  L +  +    D  LS IE ISG IG N +R+K   F+   L K L ++S+    D ++ V  +++L    + V   E    L                  FI +   D     +   P  S+V    +     NV      ++AL + R+  R   DT +  H   ++      Q++K +  ++    ++  ++D  +
Sbjct:   48 QIVTFKWHHVQDPYIIALWILVASLAKIVFHLSHKVTSVVPES-ALLIVLGLILGGIVWAADHIASFTLTPTVFFFYLLPPIVLDAGYFMPNRLFFGNLGTILLYAVIGTVWNAATTGLSLYGVYLSGIMG----DLSIGLLDFLLFGSLIAAVDPVAVLAVFEEVHVNDVLFIIVFGESLLNDAVTVVLYNVFDSFVSLGADKVTGVDCVKGIVSFFVVSLGGTLIGIIFAFLLSLVTRFTKHVRIIEPGFVFIISYLSYLTSEMLSLSAILAITFCGICCQKYVKANISEQSATTVRYTMKMLASGAETIIFMFLG--ISAVDPAIWTWNTAFILLTLVFISVYRAIGVVLQTWLLNKYRMV--QLEIIDQVVMSYGGLRGAVAYALVVLLDEKKVK---------EKNLFVSTTIIVVFFTVIFQGLTIKPLVQWLKVKKSEHREPKLNEKLHGRAFDHILSAIEDISGQIGHNYLRDKWSNFDRKVLSKLLMRRSAQKSRDRILNVFHELNLKDAISYVAEGERRGSLA-----------------FIRSPSTDNIVNVDFSTPRPSTVEASVSYLLRENVSTVCLDMQALEQRRKSIRDTEDTVT--HHTLQQYLYKPRQEYKHLYSRHELTSNEDEKQDKEI 658          
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Match: sp|P48763|SL9A2_RAT (Sodium/hydrogen exchanger 2 OS=Rattus norvegicus OX=10116 GN=Slc9a2 PE=1 SV=1)

HSP 1 Score: 187.193 bits (474), Expect = 1.400e-48
Identity = 178/487 (36.55%), Postives = 273/487 (56.06%), Query Frame = 2
Query:  188 DFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMT--ELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFL 1636
            D+  V+  F I+L++L   + K      H +   +PES +L+ VG   G I  F  + +    M  ++FFL LLPPIVL++ Y M TR F+   G    YAV+GT++N + IG +L+G+             ++TL   LLF SLI AVDPVAVLA+F +I V ++LY +VFGESLLNDAVTVVLY++ K+F   + I ++ +  GI +FF V +GG+LIG++ G I    TR   N    E   + L  Y+SYI A+    SGI+AI  C +   +Y   N+S +S   ++  ++M +++SE +IF+F+G S       W+  FV ++L  C++ RA+   +L  V N      R I +T  +  +I YGGLRGA+ + L  L+ A              ++L IT  + +I FTV   G+T++PLV+ L +K +  +  ++ +  +    D   +GIE + G  G N  R+K  +F++ YLRK L
Sbjct:   75 DYPHVQIPFEITLWILLASLAKIGFHLYHKLPTIVPESCLLIMVGLLLGGII-FGVDEKSPPAMKTDVFFLYLLPPIVLDAGYFMPTRPFFENLGTIFWYAVVGTLWNSIGIGLSLFGICQIEAFGLS----DITLLQNLLFGSLISAVDPVAVLAVFENIHVNEQLYILVFGESLLNDAVTVVLYNLFKSFCQMKTIQTVDVFAGIANFFVVGIGGVLIGILLGFIAAFTTRFTHNIRVIEPLFVFLYSYLSYITAEMFHLSGIMAITACAMTMNKYVEENVSQKSYTTIKYFMKMLSSVSETLIFIFMGVSTVGKNHEWNWAFVCFTLAFCLIWRALGVFVLTQVINWF----RTIPLTFKDQFIIAYGGLRGAICFALVFLLPATVFP---------RKKLFITAAIVVIFFTVFILGITIRPLVEFLDVKRSNKKQQAVSEEIHCRFFDHVKTGIEDVCGHWGHNFWRDKFKKFDDKYLRKLL 543          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A183VR37 (Sodium/hydrogen exchanger OS=Trichobilharzia regenti OX=157069 GN=TRE_LOCUS2943 PE=3 SV=1)

HSP 1 Score: 390.193 bits (1001), Expect = 6.617e-121
Identity = 292/629 (46.42%), Postives = 410/629 (65.18%), Query Frame = 2
Query:  161 SANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQ----FTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLS----------------HIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYN-KSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRT---------RRQSRIASDT 1954
            S+++ VA W+F++ +    + LF+L ++++K  + +V +I+A+IPESF+L+ +G  FG + R+     V     + + P+LFF  LLPPIVL SAY +  R+F    G+ +++AVLGTIFNFL+IGF ++ +   G      P+L+  ++  LLFSSLIVAVDPVAVLAIF DIGVE  LY+IVFGESLLNDAVTVVLYDIM AF G E +S  +IG+GI SFFTVSLGGLLIG++FGIITCL+TRI  ++     ++LL Y SYI+AD + WSGII++IGCG+VQA Y F+N+   S+ ++RN+ ++ + +SE VIFLFLG E +S                      H+G++ W+L  C++ARAVV  L+  V N V     KIS T+ IV++YGGLRGAVA+ LA+LI   KL      +  +NREL +TTTLFIILFTVG  G+TMKPLVKLLKI++   + LSLF + N  + D  L+GIE + G  G+N++R+ I+R +  YLR+FLQ+   +YD  ++KV +K++L +HYA ++PS++   L +IPE L+Y   +       I         + NL N N+ ++     N+P  S IEA+  T         RR S I SDT
Sbjct:   50 SSDIVVAKWEFSDFEIHIAVMLFLLIMILIKMSYHRVPYISAYIPESFVLIVIGIIFGSVVRYGIEKGVTKKTVWKLTPSLFFTYLLPPIVLESAYSLYNRTFSEYLGVVLLFAVLGTIFNFLIIGFMMHILCQLGAFGE--PQLDFDVKGFLLFSSLIVAVDPVAVLAIFQDIGVELGLYYIVFGESLLNDAVTVVLYDIMDAFTGKEYVSGKEIGIGIASFFTVSLGGLLIGVLFGIITCLITRI-KSRLNAFTLLLLAYFSYIMADCVGWSGIISMIGCGLVQAAYAFHNLDRHSVTMVRNLTKVVSEMSESVIFLFLGIEVVSTXXXXXXXXXXXXXXXXXXXXXHTGYILWALVWCLIARAVVVFLMTAVINRVAFSQTKISFTQQIVLIYGGLRGAVAFSLAILIMPNKL----GPNGVYNRELIVTTTLFIILFTVGFMGITMKPLVKLLKIRMEAKQKLSLFDSLNDGIFDETLAGIEILVGSKGRNLMRDFILRVDEKYLRRFLQREPDTYDQKMLKVYEKIALKLHYATMRPSKTETILKDIPETLKYRFLTSHISTVSIPGLLSANCSMVNLPNANKLTIP---NNLPKMS-IEAMKDTESPISGTTRRRSSTITSDT 667          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A4Z2CVZ0 (Sodium/hydrogen exchanger OS=Schistosoma japonicum OX=6182 GN=EWB00_007042 PE=3 SV=1)

HSP 1 Score: 382.104 bits (980), Expect = 6.337e-118
Identity = 261/535 (48.79%), Postives = 372/535 (69.53%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQ----FTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLR 1768
            V  W F+E +    + +F+L ++++K  + +V +++ ++PESF+L+ +G  FG I R+     V     + + P LFF  LLPPIVL SAY +  R+F    G+ +++AVLGTIFNFL+IGF +YG+   G      P L++ ++  LLFSSLIVAVDPVAVLAIF DIGVE  LY+IVFGESLLNDAVTVVLYDIM AF G E ++  +IG+GI SFFTVS GGL IG+I+GIITCL+TRI  ++     ++LL Y SYI+AD + WSGII++IGCG+VQA Y F+N+   S+ ++RN+ ++ + +SE VIFLFLG  +   +  WH+G++ W+L  C++ARAVV   +  + N +   +  IS T+ IV++YGGLRGAVA+ L+VLI   KL      +  +NREL +TTTLFIILFTVG  G+TMKPLVKLL+I++   + LSLF + N  +ID  L+GIE + G IG+N +R+ I+R +  YLR+ LQ+    YD  ++KV +K++L MH+A ++PS++   L ++PE L+
Sbjct:   60 VVKWKFHEFEIHIAVMIFLLVMILIKMAYHRVPYLSLYLPESFVLIVIGIIFGAIVRYGIEKGVTKKSVWKLTPGLFFTYLLPPIVLESAYSLYNRTFSEYLGVVLIFAVLGTIFNFLIIGFIMYGIYIIGGFGQ--PLLDMDVKSFLLFSSLIVAVDPVAVLAIFQDIGVELGLYYIVFGESLLNDAVTVVLYDIMDAFTGKEIVTGREIGIGIASFFTVSFGGLFIGVIYGIITCLITRI-KSRLNAFTLLLLAYFSYIMADCVGWSGIISMIGCGLVQAAYAFHNLDRHSITMVRNLTKVVSEMSESVIFLFLGIEVVSTKLVWHTGYILWALVWCLIARAVVVFGITAIVNSIPFSNTHISFTQQIVLIYGGLRGAVAFSLSVLILPSKL----GPNGVYNRELIVTTTLFIILFTVGFMGITMKPLVKLLRIRMENKQKLSLFDSLNDSIIDETLAGIESLVGSIGRNAMRDLILRLDERYLRRVLQREPDVYDQKMLKVYEKIALKMHHATMRPSKTEIILKDLPETLK 587          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A430QDD2 (Sodium/hydrogen exchanger OS=Schistosoma bovis OX=6184 GN=DC041_0003450 PE=3 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 7.877e-117
Identity = 269/543 (49.54%), Postives = 383/543 (70.53%), Query Frame = 2
Query:  152 QISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFAT----NSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLR 1768
            QI S  V V  W+F+E +    + +F+L ++++K  + ++ +I+ +IPESF+L+ +G  FG I R+      N++  + + P LFF  LLPPIVL SAY +  R+F    G+ +++AV+GTI NFL+IGF +YG+          PEL++ ++  LLFSSLIVAVDPVAVLAIF DIGVE  LY+IVFGESLLNDAVTVVLYDIM AF G E ++  +IG+GI SFFTVS GGLLIGL+FGIITCL+TRI  ++     ++LL Y SYI+AD + WSGII++IGCG++QA Y F+N+   S+ ++RN+ ++ + +SE VIFLFLG  +  I+  WH+G++ W L  C++ARA+V  L+  + N  +L + +I+ T+ IV++YGGLRGAVA+ L+VLI   KL      +  +NREL ITTTLFIILFTVG  G+TMKPLVKLL+I++   + LSLF + N  +ID  L+GIE + G IG+N IR+ I RFN  YLRK LQ+ +  Y+  ++K+ +K++L MH+A ++PS++   L ++PE L+
Sbjct:   44 QIESEIV-VVKWEFHEFEIHIAVMVFLLIMILIKMAYHRIPYISIYIPESFVLIIIGIIFGAIVRYGIDQGINNKTVWKLTPVLFFTYLLPPIVLESAYSLYNRTFSEYLGVVLIFAVIGTILNFLIIGFVMYGIYKMNGFGQ--PELDMDVKAFLLFSSLIVAVDPVAVLAIFQDIGVELGLYYIVFGESLLNDAVTVVLYDIMDAFTGKEIVTGKEIGIGIASFFTVSFGGLLIGLLFGIITCLITRI-KSRLNAFSLLLLAYFSYIMADCVGWSGIISMIGCGLIQAAYAFHNLDKHSITMVRNLTKVVSEMSESVIFLFLGIEVVSIKLVWHTGYILWGLIWCLIARAIVVFLITAIVNYTSLSNTQITFTQQIVLIYGGLRGAVAFSLSVLILPNKL----GPNGLYNRELIITTTLFIILFTVGFMGITMKPLVKLLRIRMESKQMLSLFDSLNDSIIDETLAGIECLIGTIGRNAIRDLIQRFNEQYLRKLLQRDTDIYNQKMLKIYEKIALKMHHATMRPSKTELILKDLPETLK 578          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A183NXZ9 (Sodium/hydrogen exchanger OS=Schistosoma mattheei OX=31246 GN=SMTD_LOCUS6985 PE=3 SV=1)

HSP 1 Score: 378.637 bits (971), Expect = 2.492e-116
Identity = 268/543 (49.36%), Postives = 383/543 (70.53%), Query Frame = 2
Query:  152 QISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFAT----NSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLR 1768
            QI S  V V  W+F+E +    + +F+L ++++K  + ++ +I+ +IPESF+L+ +G  FG I R+      N++  + + P LFF  LLPPIVL SAY +  R+F    G+ +++AV+GTI NFL+IGF +YG+          P+L++ ++  LLFSSLIVAVDPVAVLAIF DIGVE  LY+IVFGESLLNDAVTVVLYDIM AF G E ++  +IG+GI SFFTVS GGLLIGL+FGIITCL+TRI  ++     ++LL Y SYI+AD + WSGII++IGCG++QA Y F+N+   S+ ++RN+ ++ + +SE VIFLFLG  +  I+  WH+G++ W L  C++ARA+V  L+  + N  +L + +I+ T+ IV++YGGLRGAVA+ L+VLI   KL      +  +NREL ITTTLFIILFTVG  G+TMKPLVKLL+I++   + LSLF + N  +ID  L+GIE + G IG+N IR+ I RFN  YLRK LQ+ +  Y+  ++K+ +K++L MH+A ++PS++   L ++PE L+
Sbjct:   48 QIESEIV-VVKWEFHEFEIHIAVMVFLLIMILIKMAYHRIPYISIYIPESFVLIIIGIIFGAIVRYGIEQGINNKTVWKLTPALFFTYLLPPIVLESAYSLYNRTFSEYLGVVLIFAVIGTILNFLIIGFVMYGIYKMNGFGQ--PQLDMDIKAFLLFSSLIVAVDPVAVLAIFQDIGVELGLYYIVFGESLLNDAVTVVLYDIMDAFTGKEIVTGKEIGIGIASFFTVSFGGLLIGLLFGIITCLITRI-KSRLNAFSLLLLAYFSYIMADCVGWSGIISMIGCGLIQAAYAFHNLDKHSITMVRNLTKVVSEMSESVIFLFLGIEVVSIKLVWHTGYILWGLIWCLIARAIVVFLITAIVNYTSLSNTQITFTQQIVLIYGGLRGAVAFSLSVLILPNKL----GPNGLYNRELIITTTLFIILFTVGFMGITMKPLVKLLRIRMENKQMLSLFDSLNDSIIDETLAGIECLIGTIGRNAIRDLIQRFNEQYLRKLLQRDTDIYNQKMLKIYEKIALKMHHATMRPSKTELILKDLPETLK 582          
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Match: A0A448XMC2 (Sodium/hydrogen exchanger OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS33530 PE=3 SV=1)

HSP 1 Score: 379.022 bits (972), Expect = 7.086e-116
Identity = 264/555 (47.57%), Postives = 386/555 (69.55%), Query Frame = 2
Query:  167 NVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFA-TNSQVQ-FTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLR---YNKSMKFYPFFIGNEE 1816
             +  A W F+E      I +F+L ++I+K V+ ++ W++A++PES IL+ +G  FG + RFA  +S ++ + + P LFF  LLPPIVL SAY +  R+F    GI ++YAVLGTI NFL+IG  +YG+   G   +  P L+L ++  LLFSSLIVAVDPVAVLAIF DIGV+  LY++VFGESLLNDAVTVVLY IM+AF G E IS  +IG+G  SFFTVSLGGLL+G++ GI TC +T+ + +  EV ++++LGY +YI+ D + WSGII++IGCG+VQA Y F+N+ P ++++++ + +M A LSE VIFLF+G  L      WH+GF FWSL +C+++R +V  +L  + N V ++  KIS+TE  +++YGGLRGAVA+ L+VLI  E L       +   + + IT+TLFIILFTVG  G+TMKPLV+LLKIK+    +LSLF   N +++D AL+ IE ISG+ G+N++RE  IR ++ Y+R+ LQ+   ++D  ++KV +KM+L +HYA +  +++  +L E+PE ++    NK++    FF+   E
Sbjct:   96 GIRAASWLFDEFYIHITIMVFLLIVIILKMVYHRLEWLSAYVPESLILICLGVIFGTLIRFAHVDSNIETWKLTPKLFFEFLLPPIVLESAYSLYNRTFGEFLGIILIYAVLGTIMNFLIIGPVMYGLDLVGAMGW--PTLHLDIKGYLLFSSLIVAVDPVAVLAIFQDIGVDLGLYYMVFGESLLNDAVTVVLYQIMQAFAGKEEISGEEIGVGFASFFTVSLGGLLVGVVVGIATCFITQ-FSSSMEVIIVLMLGYFAYIMGDVVGWSGIISMIGCGLVQASYAFHNLRPSNVMIVKKVSKMAAELSEAVIFLFIGIELFRDNMIWHTGFHFWSLTMCLISRLIVVLVLTAIINWVRVDGFKISITEQFIVIYGGLRGAVAFSLSVLIREESLGQGLLGIRL--KGIFITSTLFIILFTVGFMGMTMKPLVRLLKIKMQANFELSLFNKLNEHILDQALAAIETISGEKGRNVVREFCIRIDDRYVRRVLQRDPETHDQKIVKVYEKMALKLHYATIGANQAELHLDELPETIKSKLLNKTLSTANFFVSPSE 645          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000053304.1 (solute carrier family 9 member A1 [Source:NCBI gene;Acc:103040045])

HSP 1 Score: 191.43 bits (485), Expect = 4.244e-51
Identity = 181/539 (33.58%), Postives = 302/539 (56.03%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI--YDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMK 1786
            V  +D+  VK  F+I L++L   ++K     +  +++ +PES +L+ VG   G IF+     +    +  +LFFL LLPPI+L++ Y +  R F    G  +++AV+GT++N   IG  LYGV     ++       + L P LLF ++I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + + G   ++   + LGI+SF  V+LGG+++G I+G+++   +R   +    E   + +  Y++Y+ A+    SGI+A+I CG V   Y   NIS +S   ++  ++MW+++SE +IF+FLG S    +  W+  FV  ++ +C+VAR +    L  + N   +   K++  +  +I YGGLRGA+A+ L  L+D +             R++ +T  + +I FTV   G+T++PLV LL +K  +    S+ +  +   +D  L+GIE I G  G +  ++K+ RFN  Y++K L     S +  L+    KM +     +V   ESG  + ++P  +    SM+
Sbjct:   77 VLSFDYGHVKPPFVIFLWILLASLMKLGFHLIPRLSSIVPESCLLIVVGLLMGGIFKLV--GETPPILRSDLFFLYLLPPIILDAGYFLPIRPFTENLGTILIFAVVGTLWNSFFIGGLLYGVCQIEGTLS-----TVGLLPCLLFGAIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEYAGAGAVTVTDVFLGIVSFLVVALGGVMVGAIYGVLSAFTSRFTAHTRVIEPLFVFVYSYLAYLSAEVFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGDHKWNWTFVVTTIILCMVARVLGVISLTYLINKFRIV--KLTTKDQFIIAYGGLRGAIAFSLGYLLDTDHFP---------MRKMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELV---ESGGGV-KVPSAMPSTVSMQ 593          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000015459.2 (solute carrier family 9 member A1 [Source:NCBI gene;Acc:103040045])

HSP 1 Score: 191.43 bits (485), Expect = 4.244e-51
Identity = 181/539 (33.58%), Postives = 302/539 (56.03%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI--YDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMK 1786
            V  +D+  VK  F+I L++L   ++K     +  +++ +PES +L+ VG   G IF+     +    +  +LFFL LLPPI+L++ Y +  R F    G  +++AV+GT++N   IG  LYGV     ++       + L P LLF ++I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + + G   ++   + LGI+SF  V+LGG+++G I+G+++   +R   +    E   + +  Y++Y+ A+    SGI+A+I CG V   Y   NIS +S   ++  ++MW+++SE +IF+FLG S    +  W+  FV  ++ +C+VAR +    L  + N   +   K++  +  +I YGGLRGA+A+ L  L+D +             R++ +T  + +I FTV   G+T++PLV LL +K  +    S+ +  +   +D  L+GIE I G  G +  ++K+ RFN  Y++K L     S +  L+    KM +     +V   ESG  + ++P  +    SM+
Sbjct:   77 VLSFDYGHVKPPFVIFLWILLASLMKLGFHLIPRLSSIVPESCLLIVVGLLMGGIFKLV--GETPPILRSDLFFLYLLPPIILDAGYFLPIRPFTENLGTILIFAVVGTLWNSFFIGGLLYGVCQIEGTLS-----TVGLLPCLLFGAIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEYAGAGAVTVTDVFLGIVSFLVVALGGVMVGAIYGVLSAFTSRFTAHTRVIEPLFVFVYSYLAYLSAEVFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFIFLGVSTVAGDHKWNWTFVVTTIILCMVARVLGVISLTYLINKFRIV--KLTTKDQFIIAYGGLRGAIAFSLGYLLDTDHFP---------MRKMFLTAIITVIFFTVFVQGMTIRPLVDLLAVKKKQETKRSINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNKKYVKKCLIAGERSKEPQLIAFYHKMEMKQAIELV---ESGGGV-KVPSAMPSTVSMQ 593          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: slc9a3.1 (sodium/hydrogen exchanger 3-like [Source:NCBI gene;Acc:103034097])

HSP 1 Score: 180.259 bits (456), Expect = 3.786e-47
Identity = 186/511 (36.40%), Postives = 289/511 (56.56%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK---FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYD-DSLMKVIDKMSL 1696
            W ++ ++  ++++L+VL   + K V      + +F PES +L+  G   G I   A  +Q  F + P  FF  LLP I+L++ Y M  + F+   G  +++AV+GT++N   +G +L+G   GG       +LN+ L   LLF SL+ AVDPVAV+A+F ++ V + L+  VFGESLLND VTVVLY++  AF  LG E I++ +I  GI+SFF VS GG  IG+IF II  L+T+ Y  K    E   I +LGY+SY+ A+ +  S I+++  CG+   +Y   N+  +S+  +R  ++++AN SE +IF+FLG  ++  +   W++GF+  ++   I+ R +    L    N   L    I + + +V+ YGGLRGAVAY LA  +D  ++           + L I+TTL ++ FTV   GLTMKP+VK LK+K  +  DL L +  N    +  L+ +E I G IG N       RF + Y+  FL K     + D L  +  K+++
Sbjct:   55 WKWHHIETPYLVALWVLVCWLCKLVVQLNTRLKSFFPESGLLIICGFILGGIVWGADKAQT-FKLTPRNFFYFLLPQIILDTGYFMPNKLFFSNLGAILVHAVIGTVWNAGAVGVSLWGCWLGGAMG----DLNIGLLQFLLFGSLLAAVDPVAVIAVFEEVHVNEVLFIWVFGESLLNDGVTVVLYNVFDAFVSLGGEKINAGEIIKGIVSFFVVSFGGSAIGVIFAIIISLLTK-YTGKVQIIEAGFIFVLGYLSYLTAEMLSLSAILSVTFCGVCCQKYVNANMDEKSVTAVRYAMKVFANGSETMIFVFLGVTAIDSVIWVWNTGFICLTILFAIIYRFIGVFTLTWFLNQYRLV--PIEVIDQLVMSYGGLRGAVAYGLAASLDETRIP---------EKNLIISTTLIVVYFTVVIQGLTMKPIVKWLKVKRVEPTDLKLIEKVNNRACEHVLAAMEDIVGRIGDNWWTRGWKRFEDTYITWFLMKPEARKNRDYLFSIFHKLNM 548          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: ENSAMXT00000013913.2 (pep primary_assembly:Astyanax_mexicanus-2.0:24:20541358:20558833:1 gene:ENSAMXG00000013508.2 transcript:ENSAMXT00000013913.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 174.866 bits (442), Expect = 6.927e-46
Identity = 188/572 (32.87%), Postives = 292/572 (51.05%), Query Frame = 2
Query:  230 VLCLLIVKFVHFKVHW---INAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLR--YNKSMKFYPFFIGNEEKD---KYEIENLKNPNESSVSIKTANVPHTSFIEALSR 1921
            VL +++        HW   I A +PES +L+ VG   G +  +         ++   FFL LLPPIVL++ Y +  R F+   G  + YAVLGT++N L IG +LYG+   G          ++L   LLF SLI AVDPVAVL++F +I V ++L+ +VFGESLLNDAVTVVLY + ++FL                  TVS   +L G    ++  L  ++    F    + L  Y+SY+ ++ + +SGI+AI+ C +   +Y   N+S  S   ++  ++MW+++SE +IF+FLG S       W   FV  +LF+C++ RA   G+L L   +  L    ++  +  +I YGGLRGA+ + L  LI+   +           + L ITTT+ +ILFTV   G+T+KPLV+LL +K  K    ++ +  +  L+D  LSGIE + G  GQ+  ++K  +FN  YL++FL +       S++++  ++            E  E + E  E       +S    P     EE D   K    NL+N N   ++  + +  H  F    SR
Sbjct:   55 VLWIMLASLAKLGFHWSGRIPAVVPESCLLIMVGLLVGGVI-YGVRHTAPPVLSAEAFFLYLLPPIVLDAGYFLPGRLFFENLGTILWYAVLGTLWNVLGIGLSLYGLCRLGGWGLE----EVSLLHFLLFGSLIAAVDPVAVLSVFEEIHVNEQLHILVFGESLLNDAVTVVLYKLFESFLRMP---------------TVSSVDILAGGCQFVVVGLGAQVIAPLF----VFLYSYLSYLTSEMLHFSGIMAIVTCAVTMKQYVEANVSERSNTTIKYFLKMWSSVSETLIFIFLGVSTIQDVHMWSWPFVSSTLFLCLLWRA--LGVLLLTAVVNKLRRNAVTFRDQFIIAYGGLRGAICFSLVFLIEDFPM-----------KRLFITTTIVVILFTVFVQGMTIKPLVELLDVKRKKRALPTVSEEIHSRLLDHLLSGIEDVVGCWGQHYWKDKFEQFNTKYLKRFLIREDKQPKSSIVRLYQEL------------ERREQMGEDDEGTEDSQTQSRSLLP-----EEMDSIRKILSNNLRNFNNKHITAYSRHTLHQDFTVDASR 572          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Match: slc9a3.1 (sodium/hydrogen exchanger 3-like [Source:NCBI gene;Acc:103034097])

HSP 1 Score: 174.096 bits (440), Expect = 4.580e-45
Identity = 186/528 (35.23%), Postives = 295/528 (55.87%), Query Frame = 2
Query:  137 LNLFRQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVH-WINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK---FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYD-DSLMKVIDKMSL 1696
            L L  + +  N  +    +  V++ +++ +++L   + K    +++  + +F PES +L+  G   G I   A  +Q  F + P  FF  LLP I+L++ Y M  + F+   G  +++AV+GT++N   +G +L+G   GG       +LN+ L   LLF SL+ AVDPVAV+A+F ++ V + L+  VFGESLLND VTVVLY++  AF  LG E I++ +I  GI+SFF VS GG  IG+IF II  L+T+ Y  K    E   I +LGY+SY+ A+ +  S I+++  CG+   +Y   N+  +S+  +R  ++++AN SE +IF+FLG  ++  +   W++GF+  ++   I+ R +    L    N   L    I + + +V+ YGGLRGAVAY LA  +D  ++           + L I+TTL ++ FTV   GLTMKP+VK LK+K  +  DL L +  N    +  L+ +E I G IG N       RF + Y+  FL K     + D L  +  K+++
Sbjct:   32 LQLHSETNLTNAFIVKVQWQHVENPYLVVIWILVAGVAKMSVVQLNTRLKSFFPESGLLIICGFILGGIVWGADKAQT-FKLTPRNFFYFLLPQIILDTGYFMPNKLFFSNLGAILVHAVIGTVWNAGAVGVSLWGCWLGGAMG----DLNIGLLQFLLFGSLLAAVDPVAVIAVFEEVHVNEVLFIWVFGESLLNDGVTVVLYNVFDAFVSLGGEKINAGEIIKGIVSFFVVSFGGSAIGVIFAIIISLLTK-YTGKVQIIEAGFIFVLGYLSYLTAEMLSLSAILSVTFCGVCCQKYVNANMDEKSVTAVRYAMKVFANGSETMIFVFLGVTAIDSVIWVWNTGFICLTILFAIIYRFIGVFTLTWFLNQYRL--VPIEVIDQLVMSYGGLRGAVAYGLAASLDETRIP---------EKNLIISTTLIVVYFTVVIQGLTMKPIVKWLKVKRVEPTDLKLIEKVNNRACEHVLAAMEDIVGRIGDNWWTRGWKRFEDTYITWFLMKPEARKNRDYLFSIFHKLNM 542          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Match: slc9a3.1 (solute carrier family 9 member A3, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-060503-545])

HSP 1 Score: 124.405 bits (311), Expect = 6.908e-30
Identity = 176/641 (27.46%), Postives = 312/641 (48.67%), Query Frame = 2
Query:  185 WDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIF-NDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFL--GTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI--YDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEK-GWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDS-LMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSL----QSDSARKDSHM 2074
            WD   V++ ++I++++L   + K        + + +PES +L+ +G   G +    ++   +FT+ P  FF  LLPPIVL+++Y M  R  +   G  ++YAV+GT++N    G +LYG    G  V     +++ L    +F+ +  +++ V++LA++  +I +        F  +++ND    VLY +   F+  G E I ++    G  SF  VSLGG  +G++F  +  LVTR   + +  E   + L  Y++Y+ A+ +  S I+AI  CGI   +Y   NIS +S   ++  ++M A+ +E +IF+FLG S     K  W++ F+  +L    V R +    L  + N   +    +   E  V+ YGGLRGAVA+ L  L+D    +G     + F     ++ T+ ++ FTV   GLT+KPLVK LK+K ++  + +L +  +    D  L+ IE ++G+ G +  R+K  +F+  +L + L + S   + S +  V  ++++    + V   E    L  I  R      M    F +   +  +  I N+   N S V +          ++A+   R+  R   D  +  H   +E       +HK    KYG      QS+  R+++ +
Sbjct:   14 WD--HVQEPYVIAVWILVASLAKIAFHLSSRVTSVVPESCLLIVLGIVLGGVV-LGSSRYAEFTLTPTAFFFYLLPPIVLDASYTMPNRLLFDNLGTILVYAVVGTLWNAAATGLSLYGAHLAGALVI----MSVNLVDYGIFNDIFCSIENVSILALYETEIQIMPLSLIHTFNRTIINDLSNKVLYKVFDTFVEVGAENIQTVDYMKGFASFLVVSLGGTAVGVVFAFMLSLVTRCTKHVHAIEPGFVFLFAYLAYLSAEMLSLSAILAITFCGICCKKYVDANISVQSQTTIKFTMKMLASGAETIIFMFLGISAVDTHKWTWNTAFILLTLIFVSVYRVIGVVALTWLLNRFRMV--PLGPIEQAVMSYGGLRGAVAFALVALLD----EGHVPEKRLF-----VSATIIVVFFTVIVQGLTIKPLVKWLKVKRSEEREPTLTEELHERAFDHILAAIEDVAGEYGHHYWRDKFEQFDKRHLSRLLMRQSARRNKSEIWDVYHRLNIQDAISFVDQGERSGSLAFI--RTPSGDKMSSVNFSMARLQAPEASISNMLRLNLSCVCLD---------MQAVEAGRKSVRDREDIVT--HRMLQENLVSTATQHK---HKYGRYTLAGQSEQDRQETEI 620          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000903.1 (pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 gene:ENSPMAG00000000825.1 transcript:ENSPMAT00000000903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 102.064 bits (253), Expect = 4.866e-25
Identity = 82/190 (43.16%), Postives = 116/190 (61.05%), Query Frame = 2
Query:  428 SAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLT---LRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIA 982
            + Y M  R F    G  + YAVLGT++N   +G TL+ V          P L L    L  +LLF+SLI AVDPVAVLA+F +I V ++L+ +VFGESLLNDAVTVVLY++ +AF   + ++S+ + LG   F  V LGG+LIG + G++  L TR  D+    E   + L  Y++Y++A+    SGI+A
Sbjct:   18 AGYFMPVRPFLDNLGTILWYAVLGTLWNVFGVGLTLHAVCALV------PSLGLASLGLVHLLLFASLISAVDPVAVLAVFEEIHVNEQLHILVFGESLLNDAVTVVLYNLFRAFSTMKVVTSVDVLLGATKFLVVGLGGVLIGALLGMVAALTTRFSDHTRVIEPLFVFLYSYLAYLIAEMFQLSGIMA 201          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Yeast
Match: NHX1 (Na+/H+ and K+/H+ exchanger; required for intracellular sequestration of Na+ and K+; located in the vacuole and late endosome compartments; required for osmotolerance to acute hypertonic shock and for vacuolar fusion; ortholog of human NHE9, which is linked to autism [Source:SGD;Acc:S000002864])

HSP 1 Score: 99.3673 bits (246), Expect = 3.893e-22
Identity = 114/413 (27.60%), Postives = 201/413 (48.67%), Query Frame = 2
Query:  188 DFNEVKD--FFIISLFVLCLLIVKFV----HFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXX--XXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKF---EVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLG-ESLSHIE-----------------KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAE 1339
            D N V +  F   +LF++ LL++  +    +     I A + E+ + +  G   GLI R +    +Q T+  N  +   +LLPPI+LNS YE+   +F+      +++A+ GT  + ++IG  LY  T  G+       ++++    +   + + A DPV +L+IFN   V+ +LY I+FGESLLNDA+++V+++  + F G     S       +   T S+  L+  LI  ++  L+   +  ++   E  +I+L+ Y SY  ++    SGI++++ CGI    Y + N+S  S I ++ I ++ A LSE  IF++LG E  + +E                   W + F   S F+  + R      ++ +         +I     ++  + GLRGAV   LA+ I  E
Sbjct:   50 DLNPVTEEMFSSWALFIMLLLLISALWSSYYLTQKRIRA-VHETVLSIFYGMVIGLIIRMSPGHYIQDTVTFNSSYFFNVLLPPIILNSGYELNQVNFFNNMLSILIFAIPGTFISAVVIGIILYIWTFLGLE-----SIDISFADAMSVGATLSATDPVTILSIFNAYKVDPKLYTIIFGESLLNDAISIVMFETCQKFHGQPATFSSVFEGAGLFLMTFSVSLLIGVLIGILVALLLKHTHIRRYPQIESCLILLIAYESYFFSNGCHMSGIVSLLFCGITLKHYAYYNMSRRSQITIKYIFQLLARLSENFIFIYLGLELFTEVELVYKPLLIIVAAISICVARWCAVFPL-SQFVNWIYRVKTIRSMSGITGENISVPDEIPYNYQMMTFWAGLRGAVGVALALGIQGE 455          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO34103 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7SQC1])

HSP 1 Score: 155.992 bits (393), Expect = 5.740e-41
Identity = 174/493 (35.29%), Postives = 275/493 (55.78%), Query Frame = 2
Query:  149 RQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVH---WINAFIPESFILLAVGTSFGLIFRFA--TNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFN--------FLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQN 1582
              I S NV  A +DFN V   F I L++L   I  F     H    + +  PES +++ +G  FG I R +  T   V F  + ++FFL +LPPIVL + Y +  R+F+   G  +++AV+GT+FN        F   GFTLYGV+           + + L   L+F  LI AVDPVAVLA+F ++ V   LY IVFGESLLNDAVTVVLY + +     + ++  +I LG  +F  VSLGG L+G+++G  T  VT+  D+    E   + ++ Y++Y+ A+    SGI++I+ C IV   Y   NIS +S   ++  ++M ++ SE +IFLFLG +L   +  W +  VF +L    V RA+    L  + N     + K+S  +  ++ YGG+RGAV++ LA+L++ +            ++ + +TTT+ +++FT+   G T+KP+VK L +K+ + +  S++K  N   ++  ++GIE +SG  G  
Sbjct:    8 HDIPSFNV--ATFDFNHVAGPFTIMLWIL---IASFAKLGFHLSFMLESVFPESSLVIILGVIFGGIIRLSGLTTEDVPF-FSSDIFFLFMLPPIVLEAGYFLQDRAFFDNIGTILLFAVVGTLFNAFTVGGLLFHFPGFTLYGVSHI---------IGIPLMHYLVFGVLISAVDPVAVLAVFEEVNVNVMLYIIVFGESLLNDAVTVVLYHLFEKLSEMDEVTHKEILLGFANFLVVSLGGTLMGVLWGFFTAFVTKYTDHVRVIEPIFVFIMSYMAYLCAEMFHLSGILSIVTCAIVMKPYVEMNISRKSHTTIKYFMKMLSSCSETLIFLFLGIALVTYDHVWSTELVFLTLLFISVYRAIGVVFLTYLANRFGRLN-KLSGVDQFIMCYGGIRGAVSFSLAILLNPKHFP---------DKGMLVTTTIVVVIFTIFVQGTTIKPIVKALNVKLQEHKKPSMYKELNDKFLEHLVAGIEEVSGFRGHG 475          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO43052 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7RZU4])

HSP 1 Score: 132.494 bits (332), Expect = 1.210e-32
Identity = 102/314 (32.48%), Postives = 157/314 (50.00%), Query Frame = 2
Query:  428 SAYEMTTRSFYRVFGICIMYAVLGTIFNF-----LLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXX-----XXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYD----NKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL-SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAV 1324
            + Y M  R F+R  G  + YA  GT  +      L+ GF ++   T        PE        LLF +LI A DPV VLAIF+DI V+ ++Y +VFGES+LNDAV +VLY  ++++L   P        +     +  F  +  G  +IG     I  LVT++         E A++ L+ Y ++++A+   WSGI+A++ CGI Q  YT+ N++ ES       +E+   ++E  IF ++G S+ +     W+ GF+ WS     V R     +  L   L     R I      ++ + GLRGA+A+ LAV
Sbjct:  143 AGYSMQKRYFFRNLGAILTYAFFGTTISCFATGSLIYGFNVWTGVTKDFDY---PE-------CLLFGALISATDPVTVLAIFHDIHVDVDMYALVFGESVLNDAVAIVLYRAIESYLAYNPREMREFDLMSCAQALSDFVAIFTGSFVIGCSMSCINALVTKLTKLGSFPILETALLFLMSYCTFLMAEIANWSGIVAVLFCGITQQHYTYKNLTDESRARTLQTLELLNFMAENFIFTYIGLSVFAFTSHQWNPGFIGWSFLAIFVGR--FLNIYPLTFFLNLGRTRTIPANFQHMMFFSGLRGAIAFALAV 444          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO40671 (Sodium/hydrogen exchanger [Source:UniProtKB/TrEMBL;Acc:A7S6K9])

HSP 1 Score: 122.479 bits (306), Expect = 2.566e-29
Identity = 97/307 (31.60%), Postives = 159/307 (51.79%), Query Frame = 2
Query:  428 SAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFL---GTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYD----NKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIE-KGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAV 1324
            + Y+M  R F+R  G  + YA  GT  + ++ G  +Y  T            +      LLF +LI A DPV +LAIF+D+ V+ +LY +VFGES++NDAV +VL+  ++++L    +      +    +  F  V  G   +G + G++T L+T++         E A+  LL + ++++A+    +GI+A++ CGI QA YT+NN+S ES    + I  +   L+E  IF ++G S+   E   W  GF+ W      + R     +  L   L    +RKI      ++ + GLRGAVA+ LA+
Sbjct:  135 AGYDMKKRFFFRNIGAILAYAFAGTTISCMVFGVIVYAYTKFATVYK-----DFDFLECLLFGALISATDPVTILAIFHDLHVDVDLYALVFGESVMNDAVAIVLFRSIESYLLDNASGVFQVDKFFSSVGVFIGVFSGSFFLGFLMGLVTALITKLTKISDFPLLETALFFLLSWSTFLMAEAAGLTGIVAVLFCGISQAHYTYNNLSDESKHNTKQIFALLNFLAENFIFSYMGLSVFTFEYHQWKPGFIAWCFIGIAIGR--FLNIYPLSFLLNLGRNRKIPYNLQHMMFFSGLRGAVAFALAM 434          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Match: EDO49297 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RH57])

HSP 1 Score: 51.6026 bits (122), Expect = 1.087e-6
Identity = 65/240 (27.08%), Postives = 116/240 (48.33%), Query Frame = 2
Query:  668 IGVEQELYFIVFGESLLNDAVTVVLYDI-----MKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKF-EVAVIILLGYISYILADTIMW-SGIIAIIGCGI-VQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICI------VARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLA--VLIDAE 1339
            +G  ++L  I+ GESLLND + +V+Y I       +   TE             FF ++ G + +          + R++++   E+ + ++  Y+++ + + ++  SG+IA++  GI V A+ T  +ISPE  + L    EM A L+  +IF+  G  +  +E+  HS   F +  + +      V RA+V   L+ +   +       +    +V+ +GGLRGAV   LA  V ID E
Sbjct:    5 LGTSKQLATIIEGESLLNDGMAIVMYKIFYNLSFSSLTPTEIGLYFPRVAVGGYFFGLAAGKITVF--------WLQRVFNDAMVEITITLVSTYLTFYIGEEVLGISGVIAVVILGIEVNAQKT--SISPEVEVFLHRFWEMLAYLANTLIFIMAGVVI--VEQTLHSFEPFDAFLLVVDYLGITVIRALVISSLSPILMHIGY---GFTWQTAVVVCWGGLRGAVGLALALQVYIDHE 229          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: slc9a3.2 (solute carrier family 9 member A3 [Source:NCBI gene;Acc:100529178])

HSP 1 Score: 185.652 bits (470), Expect = 4.518e-49
Identity = 182/510 (35.69%), Postives = 292/510 (57.25%), Query Frame = 2
Query:  191 FNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAF--LGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDN--KFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKG---WHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSV-SYDDSLMKVIDKMSL 1696
            +  VK  +++++++L   + K V    H + + IPES +L+  G   G I  +  + Q  F++ P +FF  LLP I+++S Y M  + F+   G  +++A++GT +N   +G +L+G   GG       +L++ L   LLF SLI AVDPVAVLA+F  + V   L+ +VFGESLLND VTVVL+++  AF  LG   I +++I  GIISFF V+ GG L+G++FGI+ C +TR   N    E   I ++GY+SY+ A+ +  S I++ + CG+   +Y   N++  S+  ++ ++++ AN SE +IF+FLG  +S I+K    W++GF+  +L    V R +   LL    N   L    +   + +++ +GGLRGAVAY LAV++D +K+           + L ++TTL ++ FTV   G+ MKP+V  LK+K A + DL+L +     + D  L  +E ISG IG N  R+K   F   ++   L K S     D +  V  +++L
Sbjct:   51 WEHVKAPYLVAVWILVCFLCKLVIEANHHVTSIIPESALLICAGFILGGII-WGADHQQTFSLTPVVFFYYLLPSIIVDSGYHMPNKLFFSNLGAILVHAIIGTCWNAATLGLSLWGCQKGGAMG----DLDIGLLQYLLFGSLIAAVDPVAVLAVFEQVHVNDVLFILVFGESLLNDGVTVVLFNVFDAFVTLGGAQIDAVEIIKGIISFFVVAFGGSLLGMVFGILMCFLTRCTKNIEIIEPGFIFVVGYLSYLTAEMLSLSAILSCVFCGVCCQKYINANMNENSVKTVKYVMKVLANGSETMIFVFLG--ISAIDKTIWVWNTGFILLTLLFIFVYRFIGVFLLTWPLNRYRL--VPLEFIDQLIMGFGGLRGAVAYGLAVMMDEKKIK---------EKNLMVSTTLIVVFFTVIIQGILMKPVVTWLKVKRATLHDLTLIEKVQNRVFDHMLVAVEDISGQIGHNYFRDKWKNFEEKWMMWMLMKPSARKTQDHVFSVFHQLNL 542          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000042935.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 182.956 bits (463), Expect = 3.582e-48
Identity = 177/529 (33.46%), Postives = 295/529 (55.77%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIP 1756
            V  ++++ +K  F +SL+VL   ++K     V  +++ +PES +L+ VG   G + +    S++   ++   FFL+LLPPI+L++ Y +  R F    G  +M+AV+GT++N   IG  L+ V     +       +L L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F     ++ L   LG+ISF  V+ GG+L+G I+GI+    +R   +    E   + +  YI+Y+ A+    SGI+A+I CG V   Y   NIS +S   ++  ++MW+++SE +IF+ LG +       W+  FV  ++F+C+VAR +    L  + N   +   K++  +  ++ YGGLRGA+A+ L  L++ E        D+   R + +T  + +I FTV   G+T+KPLV+LL +K  +    S+ +  ++  +D  L+GIE I G  G +  ++K+ RFN  Y++K+L     S +  L+    K+       +V+    G+    +P
Sbjct:   68 VLSFEYDHIKTPFEVSLWVLFASLMKLGFHLVPRLSSIVPESCLLIVVGLLVGGLSKLIGESELP-KLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLT----HLGLLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFGGVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGGPHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRI--VKLTTKDQFIVAYGGLRGAIAFSLGFLLEVE--------DEEM-RHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYGHHHWKDKMNRFNRKYVKKWLIAGERSKEPQLIAFYHKLEFKQAIQLVESGAGGKLSSALP 580          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000046726.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 181.8 bits (460), Expect = 8.043e-48
Identity = 177/529 (33.46%), Postives = 295/529 (55.77%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIP 1756
            V  ++++ +K  F +SL+VL   ++K     V  +++ +PES +L+ VG   G + +    S++   ++   FFL+LLPPI+L++ Y +  R F    G  +M+AV+GT++N   IG  L+ V     +       +L L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F     ++ L   LG+ISF  V+ GG+L+G I+GI+    +R   +    E   + +  YI+Y+ A+    SGI+A+I CG V   Y   NIS +S   ++  ++MW+++SE +IF+ LG +       W+  FV  ++F+C+VAR +    L  + N   +   K++  +  ++ YGGLRGA+A+ L  L++ E        D+   R + +T  + +I FTV   G+T+KPLV+LL +K  +    S+ +  ++  +D  L+GIE I G  G +  ++K+ RFN  Y++K+L     S +  L+    K+       +V+    G+    +P
Sbjct:   68 VLSFEYDHIKTPFEVSLWVLFASLMKLGFHLVPRLSSIVPESCLLIVVGLLVGGLSKLIGESELP-KLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLT----HLGLLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFGGVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGGPHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRI--VKLTTKDQFIVAYGGLRGAIAFSLGFLLEVE--------DEEM-RHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYGHHHWKDKMNRFNRKYVKKWLIAGERSKEPQLIAFYHKLEFKQAIQLVESGAGGKLSSALP 580          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: ENSORLT00000036886.1 (sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:101169232])

HSP 1 Score: 181.8 bits (460), Expect = 8.043e-48
Identity = 177/529 (33.46%), Postives = 295/529 (55.77%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK--FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIP 1756
            V  ++++ +K  F +SL+VL   ++K     V  +++ +PES +L+ VG   G + +    S++   ++   FFL+LLPPI+L++ Y +  R F    G  +M+AV+GT++N   IG  L+ V     +       +L L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F     ++ L   LG+ISF  V+ GG+L+G I+GI+    +R   +    E   + +  YI+Y+ A+    SGI+A+I CG V   Y   NIS +S   ++  ++MW+++SE +IF+ LG +       W+  FV  ++F+C+VAR +    L  + N   +   K++  +  ++ YGGLRGA+A+ L  L++ E        D+   R + +T  + +I FTV   G+T+KPLV+LL +K  +    S+ +  ++  +D  L+GIE I G  G +  ++K+ RFN  Y++K+L     S +  L+    K+       +V+    G+    +P
Sbjct:   68 VLSFEYDHIKTPFEVSLWVLFASLMKLGFHLVPRLSSIVPESCLLIVVGLLVGGLSKLIGESELP-KLDSGNFFLVLLPPIILDAGYFLPIRPFMENLGTILMFAVVGTLWNAFFIGSVLFAVCQIPAAGLT----HLGLLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFSAFGTVTVLDGFLGVISFLIVAFGGVLVGAIYGILAAFTSRFTSHMRVIEPLFVFVYSYIAYLSAELFHLSGIMALIACGAVMRPYVEANISHKSHTTIKYFLKMWSSVSETLIFILLGVATVGGPHNWNWIFVTSTVFLCLVARVIGVIGLTFIINKFRI--VKLTTKDQFIVAYGGLRGAIAFSLGFLLEVE--------DEEM-RHIFLTAIITVIFFTVFVQGMTIKPLVELLAVKKKQEAKRSINEEIHIQFLDHLLTGIEDICGHYGHHHWKDKMNRFNRKYVKKWLIAGERSKEPQLIAFYHKLEFKQAIQLVESGAGGKLSSALP 580          
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Match: slc9a1b (Na(+)/H(+) exchanger beta [Source:NCBI gene;Acc:101159279])

HSP 1 Score: 177.948 bits (450), Expect = 1.188e-46
Identity = 174/522 (33.33%), Postives = 297/522 (56.90%), Query Frame = 2
Query:  176 VAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI--YDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESG 1735
            V  +++  V   F+ISL++L  L++K     +  ++  +PES +L+ VG   G + +     Q    ++  LFFL LLPPI+L++ Y +  R F    G  +++AV+GT++N   IG  ++ V     +  G    ++ L   LLF S+I AVDPVAVLA+F +I + + L+ +VFGESLLNDAVTVVLY + + F     ++     LG++SFF VS+GG+++G+I+G++    +R   +    E   + L  Y++Y+ A+    SGI+++I CG++   Y   NIS +S   ++  ++MW+++SE +IF+FLG S       W+  FV ++L +C+++R +    L  + N   +   K++  +  ++ YGGLRGA+A+ L  L+        TD +K   +++ +T  + +I FTV   G+T++PLV+LL +K  K    S+ +  +   +D  L+GIE I G  G +  ++K+ RFN  Y++K+L     S +  L+   +KM +     +V   ESG
Sbjct:   69 VLAFNYEHVSKPFVISLWILLALLMKLGFHIIPRVSHIVPESCLLIFVGLLVGGVIK--AMDQTPPVLDTKLFFLYLLPPIILDAGYFLPIRPFTENMGTILVFAVVGTLWNAFFIGGMMFAVCQIEAARVG----HVDLLSCLLFGSIISAVDPVAVLAVFEEIHINELLHILVFGESLLNDAVTVVLYHLFEEFAHEGTVTVGDALLGVVSFFVVSVGGVMVGVIYGVLGAFTSRFTSHSRVIEPLFVFLYSYMAYLSAEVFHLSGIMSLIACGVIMRPYVEANISHKSYTTIKYFLKMWSSVSETLIFIFLGVSTVEGPHNWNWIFVIFTLILCLLSRVLGVVGLTFIINKFRI--IKLTKKDQFIVAYGGLRGAIAFSLGFLL--------TDTEK---KDMFLTAIITVIFFTVFVQGMTIRPLVELLAVKKKKESKASINEEIHTQFLDHLLTGIEDICGHYGHHHWKDKLNRFNRTYVKKWLIAGDRSSEPQLISFYNKMEMKEAMMLV---ESG 568          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000006858.1 (SMESG000006858.1)

HSP 1 Score: 1110.13 bits (2870), Expect = 0.000e+0
Identity = 667/667 (100.00%), Postives = 667/667 (100.00%), Query Frame = 2
Query:   89 MLNWKFSQVVLWIFVVLNLFRQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSLQSDSARKDSHMDETVL 2089
            MLNWKFSQVVLWIFVVLNLFRQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMNPNLFFLILLPPIVLNSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLYGVTTGGVSVYGGPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPISSLQIGLGIISFFTVSLGGLLIGLIFGIITCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAVVCGLLALVNNLVNLEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQITTTLFIILFTVGAHGLTMKPLVKLLKIKIAKVEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSLQSDSARKDSHMDETVL
Sbjct:    1 MLNWKFSQVVLWIFVVLNLFRQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMNPNLFFLILLPPIVLNSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLYGVTTGGVSVYGGPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPISSLQIGLGIISFFTVSLGGLLIGLIFGIITCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAVVCGLLALVNNLVNLEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQITTTLFIILFTVGAHGLTMKPLVKLLKIKIAKVEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANVPHTSFIEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGSLQSDSARKDSHMDETVL 667          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000013689.1 (SMESG000013689.1)

HSP 1 Score: 280.026 bits (715), Expect = 6.151e-84
Identity = 248/599 (41.40%), Postives = 369/599 (61.60%), Query Frame = 2
Query:  113 VVLWIFVVLNLFRQISSANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNKFEV--AVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGW-HSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKL-DGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKM---SLAMHYAIVKPSESGEYLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIEN--LKNPNESSVSIKTA 1882
            +VL +F  ++     +S  + VA WD  E   + + SLF+  + + K  + K  +I+A+IPESF+L+ +G   G I        V   + P LFFLILLPPIVL+SAY+M  R+F  + GI +++AV GTI +F +IG +L+G+     +    P++N  L  ILLFSS IVAVDPVAVLAIF D+ V++ELY+++FGESLLNDAVT+VLYDI+K  +     +   I LG +SFFTVSLGGLL+G+I G+++ L+TR + +K E+   +II   Y+SYI+A +I WSGI++IIGCGIVQA Y F NI     + +RN VE+ A +SE +IF++LG     +EK + H  F   + F+C++AR +V  +L L+ N   ++ RKIS TE+ +  YGGLRGAVA+ LA LI  E +  G T+  K   + L + TTL II+ TV   G T+KPL KLLK+K  + + LS++   N  +I+   + +EGI    G+N    ++  F+N Y+R +L       D+ + K++ ++   SLA+HYA +    +   L  IP+ L        +P    NE+ D+  I+N  ++   ++S S+K A
Sbjct:    6 IVLMVFGCVHCSSDHNSTTIQVAQWDVKETGKYIVFSLFIFFVSLGKLCYMKFKFISAYIPESFLLILLGILTGFICH-EVELDVSVKLTPELFFLILLPPIVLDSAYQMYNRTFGNILGIVLIFAVFGTILSFAIIGMSLFGLQKLNNNFL--PDVNDKLMAILLFSSFIVAVDPVAVLAIFKDLKVDKELYYMIFGESLLNDAVTIVLYDIIKELMIIGDTNVKNISLGFVSFFTVSLGGLLVGVITGVLSVLLTR-FQSKREIHCVMIIATAYLSYIIAYSIHWSGIMSIIGCGIVQAAYGFRNIEKSMQLTVRNFVELTAGVSESIIFVYLGIEFFKVEKVFDHIEFQISAFFLCLIARFIVIFVLRLLINFAKVDQRKISWTEMFIAAYGGLRGAVAFSLATLIIPEIVWKGDTENRKEM-KMLFVKTTLMIIILTVAVMGTTIKPLAKLLKVKSEEKKILSVYNELNNAVIENLTATLEGIIDQKGRNSYLIQLANFDNLYIRPWLVNEPC--DNKVFKILKRLEQVSLALHYANLDGEYAQRKLTNIPKGL--------WPKLKENEQ-DERSIDNKVIELIRKTSKSVKKA 588          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000069099.1 (SMESG000069099.1)

HSP 1 Score: 258.455 bits (659), Expect = 4.385e-76
Identity = 231/644 (35.87%), Postives = 368/644 (57.14%), Query Frame = 2
Query:  206 DFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRF-----ATNSQVQF-TMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI-YDNKF-EVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESL--SHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKP--SESGE-YLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPN-ESSVSIKTANVPHTSF--IEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTI---TEKYGSLQSDSARKDSHMDE 2080
            ++ I S+FVL +  +K  +   H  +  IPES +LL  G   GL F++     A+N  + F ++N + FF +LLPPI+L +++ M  R+F       +++AV+ T+ NF+ IG  L  ++          ++N++     +FS+LIVAVDPVAVLAIF +I V+  LY++VFGESLLND V+VVLY+ M      + I+  ++   +ISF  V LGG +IG I  + TCL+TR  Y     E  +++L GY+SY+LA  I WSGII++I  G+ QA Y F NI+ +SLI+++ + ++ +N+SE VIF+ LG S+  +HI     + F FWS+F+C+  R +   LL+ + N  +   RKI+  E  +I YGGLRG +AYCLA+LID+       D  ++    +  T             G+TMKPLV LL+I+IAK ++LSLF   +   ID  L+G+E I G  G+N I E     +  Y+R FLQ+  +  ++ +MKV +KM+L +H A   P  ++  E YL+++  +LR N +++ Y    G      +   NLK+ N E ++ +    +    F  I+ +   R+ S I  D A     + ++M  +L++K +++   + KYG+++  S +   H D 
Sbjct:   42 NYVIFSVFVLVICGIKVWYNWAHGFSKIIPESNLLLFCGVVLGLCFKWFYKGAASNPALSFFSINSDRFFNLLLPPIILEASFAMYHRTFASNIVGVLVFAVIATMLNFVFIGLGLTYISHYRGLSLSVSQVNIS--TFWVFSALIVAVDPVAVLAIFQEIHVDNNLYYLVFGESLLNDGVSVVLYETMIILSRFDKITINELVRTVISFLLVCLGGGVIGCIISVFTCLMTRFTYKTPLTEPVLVMLFGYLSYLLAGMIKWSGIISMIVYGVFQATYGFQNITQKSLILIKRLSKILSNVSEAVIFIHLGVSVTDTHISL---TSFTFWSVFLCLYGRYIFTLLLSGMINYFDFNIRKIAWNEQFIIAYGGLRGGIAYCLALLIDSTVPVSKHDIQQTTIFIIFFTIFFM---------GMTMKPLVTLLQIEIAKPDELSLFVQISESAIDHLLAGMEEIIGMKGRNAIHEFFANIDEIYIRPFLQRDPLGREEKIMKVFEKMNLTIHMATTAPVGTQMAEYYLNKLKPQLR-NWTIENYSKPDG--LTSLHGSANLKSFNVEEAIPVANKQIVFNEFENIDTILAPRQSSEIHMDHAR----FAQKMSSMLNRKRRSLAVTSPKYGTMRIGS-KASRHNDS 663          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000011089.1 (SMESG000011089.1)

HSP 1 Score: 255.758 bits (652), Expect = 1.084e-74
Identity = 222/555 (40.00%), Postives = 339/555 (61.08%), Query Frame = 2
Query:  161 SANVHVAGWDFNEVKDFFIISLFVLCLLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQ--VQFTMXXXXXXXXXXXXXXXXSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRIYDNK----FEVAVIILLGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEKGWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXE-DLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGEYLHEIPER------LRYNKSMK 1786
            S    V  W F+++K++ I  LF++ ++++K  +  +  ++ F+PES +LL VG  FG+I +F    +  V F + P+LFF +LLPPI+L S+Y +  ++F       +++A+ GT+FNFL+IGF L+G T  G+         L+L   LLFSSLIVAVDPVAVLAIFND+GV ++LY++VFGESLLNDAV VVLY++M+ F     I +  I LG+ISFFTVSLGG++IG+I G+++CL+ RI  ++     E  ++I +GY SY++ +   WSGII+II CG++Q  Y    +   S +VL+  V++ A++ E +IFLFLG  +   +  W   F+  +L +C+ AR +V   L+ + N +++  R I M E  +I YGGLRGAVA+ LAVLID +K+  +++  K+      ++TTL IILFT+   G+T+KPLVK L+I     + + SLFK  N  L+++   GI+GI G+ G+  +      F+N Y+R FLQ         + +V  K++  M  +I          H IP        +R N  +K
Sbjct:   55 SETFKVIDWKFDKLKNYIIYCLFIIVVILMKIGYHHMPRLSKFVPESCLLLIVGILFGVIIKFLLKKENVVYFKLTPDLFFCVLLPPIILESSYSLYHKNFMDNLLAILIFAIFGTLFNFLIIGFALFGFTQIGLMKKLK----LSLLHCLLFSSLIVAVDPVAVLAIFNDVGVNEDLYYLVFGESLLNDAVCVVLYEMMQEFALMSEIGTKNIILGVISFFTVSLGGMVIGIIVGVLSCLMVRIMGDRNTVFLEPVILISMGYFSYLIGNLFGWSGIISIITCGLIQVAYAVPGMKDSSNLVLKRFVKVLASICEPIIFLFLGVEIVIGDHSWEISFIMCALILCMAARFIVIFGLSGIINFIHVNMRNIPMQEKFIIAYGGLRGAVAFSLAVLID-DKIFESSEVSKN----TIVSTTLIIILFTIIIQGMTVKPLVKCLQITKINKDSNFSLFKELNESLLESTSKGIQGIIGNCGRYYLLMITENFSNKYIRPFLQGKEYRNRGKIFEVNAKINSIMLASINNDPSLKSQFHRIPNSYKNLLTIRENPQLK 600          
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Match: SMESG000052120.1 (SMESG000052120.1)

HSP 1 Score: 197.593 bits (501), Expect = 7.917e-55
Identity = 166/462 (35.93%), Postives = 267/462 (57.79%), Query Frame = 2
Query:  428 SAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLXXXXXXXXXXXXXPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQELYFIVFGESLLNDAVTVVLYDIMKAFLGTEPXXXXXXXXXXXXFFTVSXXXXXXXXXXXXXTCLVTRI-YDNKFEVAVIIL-LGYISYILADTIMWSGIIAIIGCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEK-GWHSGFVFWSLFICIVARAXXXXXXXXXXXXXXXEDRKISMTELIVIVYGGLRGAVAYCLAVLI-DAEKLDGTTDADKSFNRELQXXXXXXXXXXXVGAHGLTMXXXXXXXXXXXXXXEDLSLFKTTNVYLIDTALSGIEGISGDIGQNIIREKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMH--YAIVKPSESGE-YLHEIPERLRYNKSMKFY 1792
            SA+ M    F       +++A++ T+ NF+ +   L+ +   GV      E++     IL+F SLI ++DPVAVLAIF +I V+  LY++VFGESLLND V VVLY++++     E    +      ISF  V +GG L G +F  ITC+++R  Y       +I+  +  ++Y++AD + WS II++I  G++Q  Y F+NI+ +SLIV++ ++++ ANLSE +IFL LG +L  I+   W+S F  W+LF+CI  R  +  LL+   N   L  R+I  TE  +I YGG+RG ++YCLAVL+ D+  +D T+  + +           FIILFTV   G+T+ PLVK+L+IKI++ + LSL    N  ++   L+ IE I    G+N   E +   NN ++   LQ+   +Y+  L++    + L ++  Y+    +E G+ +L ++   L+ N+  +FY
Sbjct:   12 SAFAMYHVDFMANILPVLIFAIIATVLNFIFLSLFLWILLIIGVMESSINEIS-----ILIFCSLITSIDPVAVLAIFQEIHVDNNLYYLVFGESLLNDGVAVVLYNVLRQLAAVEIWRGMHYFKSCISFLAVVVGGGLTGFMFSAITCIISRFSYKAPLSEPIIVFGMSMVAYLVADVLGWSVIISMIMFGLIQVAYNFHNITHKSLIVIKRVIKILANLSESIIFLCLGVTLFEIDDFQWNSSFSLWALFLCIYVRFSITFLLSAFINRYELAVREIYWTEQYIIAYGGMRGGISYCLAVLLSDSNGVDKTSIMNATI----------FIILFTVVFQGITIGPLVKILQIKISEEDGLSLIDQINETILTHLLATIESIVDLKGRNSFYEFLFNVNNLFILPILQRDPETYESRLIETFKAIDLRLYLAYSCGNNTELGKTFLRKLKPNLQNNR-FEFY 457          
The following BLAST results are available for this feature:
BLAST of Sodium/hydrogen exchanger vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9A21.127e-4836.76solute carrier family 9 member A2 [Source:HGNC Sym... [more]
SLC9A31.309e-4836.10solute carrier family 9 member A3 [Source:HGNC Sym... [more]
SLC9A32.152e-4836.10solute carrier family 9 member A3 [Source:HGNC Sym... [more]
SLC9A17.917e-4633.57solute carrier family 9 member A1 [Source:HGNC Sym... [more]
SLC9A33.853e-4534.56solute carrier family 9 member A3 [Source:HGNC Sym... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nhx-92.085e-4432.40Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
nhx-92.487e-4431.93Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
nhx-31.025e-4132.96Probable Na(+)/H(+) antiporter nhx-3 [Source:UniP... [more]
nhx-31.115e-4132.96Probable Na(+)/H(+) antiporter nhx-3 [Source:UniP... [more]
nhx-92.551e-4133.28Probable Na(+)/H(+) antiporter nhx-9 [Source:UniP... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nhe24.707e-4537.78gene:FBgn0040297 transcript:FBtr0299909[more]
Nhe26.374e-4537.78gene:FBgn0040297 transcript:FBtr0299911[more]
Nhe26.435e-4436.33gene:FBgn0040297 transcript:FBtr0334172[more]
Nhe28.591e-4436.33gene:FBgn0040297 transcript:FBtr0306016[more]
Nhe21.264e-4336.33gene:FBgn0040297 transcript:FBtr0306015[more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a1b2.570e-4833.66solute carrier family 9 member A1b [Source:ZFIN;Ac... [more]
slc9a3.24.987e-4834.79solute carrier family 9 member A3, tandem duplicat... [more]
slc9a3.13.758e-4735.53solute carrier family 9 member A3, tandem duplicat... [more]
slc9a3.13.758e-4735.53solute carrier family 9 member A3, tandem duplicat... [more]
slc9a54.570e-4235.41solute carrier family 9 member A5 [Source:ZFIN;Acc... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SLC9A37.320e-5033.03solute carrier family 9 member A3 [Source:NCBI gen... [more]
SLC9A31.287e-4933.18solute carrier family 9 member A3 [Source:NCBI gen... [more]
SLC9A31.309e-4933.18solute carrier family 9 member A3 [Source:NCBI gen... [more]
SLC9A31.349e-4933.18solute carrier family 9 member A3 [Source:NCBI gen... [more]
SLC9A32.468e-4933.18solute carrier family 9 member A3 [Source:NCBI gen... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Slc9a31.097e-5138.15solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a31.097e-5138.15solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a32.549e-5138.15solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a23.813e-5036.76solute carrier family 9 (sodium/hydrogen exchanger... [more]
Slc9a11.894e-4533.09solute carrier family 9 (sodium/hydrogen exchanger... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P26433|SL9A3_RAT6.031e-5137.76Sodium/hydrogen exchanger 3 OS=Rattus norvegicus O... [more]
sp|G3X939|SL9A3_MOUSE7.676e-5138.15Sodium/hydrogen exchanger 3 OS=Mus musculus OX=100... [more]
sp|P26432|SL9A3_RABIT3.420e-5032.66Sodium/hydrogen exchanger 3 OS=Oryctolagus cunicul... [more]
sp|Q28362|SL9A3_DIDVI1.315e-4932.87Sodium/hydrogen exchanger 3 OS=Didelphis virginian... [more]
sp|P48763|SL9A2_RAT1.400e-4836.55Sodium/hydrogen exchanger 2 OS=Rattus norvegicus O... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183VR376.617e-12146.42Sodium/hydrogen exchanger OS=Trichobilharzia regen... [more]
A0A4Z2CVZ06.337e-11848.79Sodium/hydrogen exchanger OS=Schistosoma japonicum... [more]
A0A430QDD27.877e-11749.54Sodium/hydrogen exchanger OS=Schistosoma bovis OX=... [more]
A0A183NXZ92.492e-11649.36Sodium/hydrogen exchanger OS=Schistosoma mattheei ... [more]
A0A448XMC27.086e-11647.57Sodium/hydrogen exchanger OS=Protopolystoma xenopo... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000053304.14.244e-5133.58solute carrier family 9 member A1 [Source:NCBI gen... [more]
ENSAMXT00000015459.24.244e-5133.58solute carrier family 9 member A1 [Source:NCBI gen... [more]
slc9a3.13.786e-4736.40sodium/hydrogen exchanger 3-like [Source:NCBI gene... [more]
ENSAMXT00000013913.26.927e-4632.87pep primary_assembly:Astyanax_mexicanus-2.0:24:205... [more]
slc9a3.14.580e-4535.23sodium/hydrogen exchanger 3-like [Source:NCBI gene... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
slc9a3.16.908e-3027.46solute carrier family 9 member A3, tandem duplicat... [more]
ENSPMAT00000000903.14.866e-2543.16pep scaffold:Pmarinus_7.0:GL477267:34875:46041:-1 ... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
NHX13.893e-2227.60Na+/H+ and K+/H+ exchanger; required for intracell... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO341035.740e-4135.29Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO430521.210e-3232.48Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO406712.566e-2931.60Sodium/hydrogen exchanger [Source:UniProtKB/TrEMB... [more]
EDO492971.087e-627.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
slc9a3.24.518e-4935.69solute carrier family 9 member A3 [Source:NCBI gen... [more]
ENSORLT00000042935.13.582e-4833.46sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000046726.18.043e-4833.46sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
ENSORLT00000036886.18.043e-4833.46sodium/hydrogen exchanger 1 [Source:NCBI gene;Acc:... [more]
slc9a1b1.188e-4633.33Na(+)/H(+) exchanger beta [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Sodium/hydrogen exchanger vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006858.10.000e+0100.00SMESG000006858.1[more]
SMESG000013689.16.151e-8441.40SMESG000013689.1[more]
SMESG000069099.14.385e-7635.87SMESG000069099.1[more]
SMESG000011089.11.084e-7440.00SMESG000011089.1[more]
SMESG000052120.17.917e-5535.93SMESG000052120.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016116 ID=SMED30016116|Name=Sodium/hydrogen exchanger|organism=Schmidtea mediterranea sexual|type=transcript|length=2125bp
GCAAATGTAGATATTAAGATGGGTAAAACCGTTTGCTTTAAATTCTGTAT
TAATTTGAGCTATTAACTTTTATAATTAATTGTTGTCAATGTTAAACTGG
AAATTTAGTCAAGTGGTTTTGTGGATTTTCGTTGTCCTAAATTTATTTCG
ACAAATTTCTTCTGCGAATGTCCACGTGGCAGGTTGGGATTTTAATGAAG
TGAAAGATTTCTTTATTATTTCATTATTTGTTTTGTGCTTGTTGATTGTG
AAATTTGTCCATTTCAAAGTTCATTGGATAAATGCTTTCATTCCGGAATC
TTTTATTCTTTTGGCAGTCGGAACAAGTTTCGGTTTAATATTTCGATTTG
CTACCAATTCCCAAGTTCAATTTACTATGAATCCGAATCTATTTTTTCTG
ATTCTTTTACCCCCGATTGTACTGAATTCTGCGTACGAAATGACAACAAG
ATCATTCTATAGGGTGTTTGGTATATGTATTATGTATGCTGTTTTGGGGA
CGATTTTTAACTTTTTATTAATTGGCTTTACTCTTTATGGCGTAACAACT
GGAGGGGTTTCAGTTTATGGCGGTCCAGAATTAAATTTAACATTAAGACC
AATTTTACTATTTTCATCGCTTATTGTCGCTGTAGATCCTGTTGCGGTTT
TGGCTATATTTAACGATATAGGCGTGGAACAAGAACTATATTTCATTGTT
TTCGGAGAATCACTGTTGAATGATGCGGTTACTGTCGTTCTGTATGACAT
AATGAAAGCATTTCTTGGCACAGAACCGATAAGTTCTTTACAAATCGGAC
TTGGAATTATATCATTTTTTACGGTAAGTTTAGGCGGTCTTTTGATTGGA
TTAATATTTGGAATAATAACCTGTTTAGTAACTCGAATTTACGATAATAA
ATTTGAAGTGGCGGTCATAATTCTTTTGGGGTATATTAGCTATATTTTAG
CGGATACTATCATGTGGTCGGGAATAATTGCAATTATTGGTTGTGGAATT
GTCCAAGCCGAGTACACATTCAACAATATTTCACCTGAATCATTAATAGT
ACTAAGAAATATTGTAGAGATGTGGGCAAATTTAAGTGAAGGGGTAATAT
TTTTATTTTTAGGAGAAAGTCTTTCTCACATTGAAAAAGGATGGCATTCT
GGATTTGTTTTCTGGTCATTGTTTATTTGCATTGTGGCTAGAGCTGTTGT
GTGTGGATTGCTTGCTTTGGTTAATAATTTGGTCAATTTAGAAGACAGAA
AAATATCTATGACGGAACTTATAGTTATCGTTTATGGAGGTCTAAGAGGA
GCTGTCGCGTATTGCCTCGCAGTCCTGATTGATGCTGAAAAACTAGACGG
AACTACTGATGCAGATAAATCATTTAACAGGGAACTTCAAATCACAACTA
CCCTCTTTATTATTTTATTTACTGTTGGAGCTCATGGTCTCACAATGAAA
CCTTTAGTTAAACTTTTAAAAATAAAAATCGCCAAAGTTGAAGATTTAAG
TTTATTCAAAACAACTAATGTTTATCTGATTGATACAGCACTTTCGGGTA
TTGAAGGAATCTCCGGGGATATTGGACAAAATATAATTCGAGAGAAAATT
ATCAGATTTAACAATCATTATTTACGGAAATTTCTTCAAAAATCTTCCGT
TTCATACGATGACAGTCTCATGAAGGTTATAGACAAGATGTCTCTGGCTA
TGCATTATGCGATTGTAAAACCAAGTGAATCCGGCGAATATCTACATGAA
ATTCCCGAAAGACTCAGATATAATAAATCCATGAAATTTTATCCCTTTTT
TATTGGAAATGAGGAGAAAGACAAATATGAAATTGAAAATTTGAAAAATC
CAAATGAAAGCTCAGTCTCTATAAAAACTGCCAACGTTCCTCATACTTCA
TTTATTGAAGCTTTGTCAAGGACAAGAAGACAGAGTCGCATCGCATCCGA
CACAGCAAGTAATGTTCACGGATATTTCAAGGAAATGCAGAAGGTTCTTC
ACCAAAAACATAAAACTATTACCGAAAAATATGGCAGCCTCCAATCAGAC
AGTGCCCGCAAAGACTCACACATGGATGAAACTGTTCTTTAAGTTTATTT
TATAATTGATAAATTTGGTTTGGCG
back to top

protein sequence of SMED30016116-orf-1

>SMED30016116-orf-1 ID=SMED30016116-orf-1|Name=SMED30016116-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=668bp
MLNWKFSQVVLWIFVVLNLFRQISSANVHVAGWDFNEVKDFFIISLFVLC
LLIVKFVHFKVHWINAFIPESFILLAVGTSFGLIFRFATNSQVQFTMNPN
LFFLILLPPIVLNSAYEMTTRSFYRVFGICIMYAVLGTIFNFLLIGFTLY
GVTTGGVSVYGGPELNLTLRPILLFSSLIVAVDPVAVLAIFNDIGVEQEL
YFIVFGESLLNDAVTVVLYDIMKAFLGTEPISSLQIGLGIISFFTVSLGG
LLIGLIFGIITCLVTRIYDNKFEVAVIILLGYISYILADTIMWSGIIAII
GCGIVQAEYTFNNISPESLIVLRNIVEMWANLSEGVIFLFLGESLSHIEK
GWHSGFVFWSLFICIVARAVVCGLLALVNNLVNLEDRKISMTELIVIVYG
GLRGAVAYCLAVLIDAEKLDGTTDADKSFNRELQITTTLFIILFTVGAHG
LTMKPLVKLLKIKIAKVEDLSLFKTTNVYLIDTALSGIEGISGDIGQNII
REKIIRFNNHYLRKFLQKSSVSYDDSLMKVIDKMSLAMHYAIVKPSESGE
YLHEIPERLRYNKSMKFYPFFIGNEEKDKYEIENLKNPNESSVSIKTANV
PHTSFIEALSRTRRQSRIASDTASNVHGYFKEMQKVLHQKHKTITEKYGS
LQSDSARKDSHMDETVL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000418head
PLANA:0000420parapharyngeal region
Vocabulary: INTERPRO
TermDefinition
IPR018422Cation/H_exchanger_CPA1
IPR004709NaH_exchanger
IPR006153Cation/H_exchanger
Vocabulary: biological process
TermDefinition
GO:0006885regulation of pH
GO:0006814sodium ion transport
GO:0055085transmembrane transport
GO:0006812cation transport
GO:0006810transport
GO:0006811ion transport
GO:0035725sodium ion transmembrane transport
GO:1902600hydrogen ion transmembrane transport
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0015385sodium:proton antiporter activity
GO:0015299solute:proton antiporter activity
GO:0015297antiporter activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004709Na+/H+ exchangerPRINTSPR01084NAHEXCHNGRcoord: 101..112
score: 67.75
coord: 130..138
score: 44.55
coord: 176..186
score: 63.42
coord: 115..129
score: 29.34
IPR004709Na+/H+ exchangerTIGRFAMTIGR00840TIGR00840coord: 34..559
e-value: 1.2E-121
score: 404.7
IPR006153Cation/H+ exchangerPFAMPF00999Na_H_Exchangercoord: 48..458
e-value: 1.2E-60
score: 205.3
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 647..667
NoneNo IPR availablePANTHERPTHR10110:SF126NA(+)/H(+) EXCHANGER PROTEIN 7coord: 24..604
NoneNo IPR availableSIGNALP_EUKSignalP-TMSignalP-TMcoord: 1..25
score: 0.705
NoneNo IPR availableTMHMMTMhelixcoord: 9..31
NoneNo IPR availableTMHMMTMhelixcoord: 355..377
NoneNo IPR availableTMHMMTMhelixcoord: 127..149
NoneNo IPR availableTMHMMTMhelixcoord: 41..59
NoneNo IPR availableTMHMMTMhelixcoord: 272..305
NoneNo IPR availableTMHMMTMhelixcoord: 200..222
NoneNo IPR availableTMHMMTMhelixcoord: 237..259
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 392..414
NoneNo IPR availableTMHMMTMhelixcoord: 169..191
NoneNo IPR availableTMHMMTMhelixcoord: 320..342
NoneNo IPR availableTMHMMTMhelixcoord: 435..452
NoneNo IPR availableTMHMMTMhelixcoord: 93..115
IPR018422Cation/H+ exchanger, CPA1 familyPANTHERPTHR10110SODIUM/HYDROGEN EXCHANGERcoord: 24..604