Alpha-aminoadipic semialdehyde synthase, mitochondrial

Overview
NameAlpha-aminoadipic semialdehyde synthase, mitochondrial
Smed IDSMED30016114
Length (bp)3193
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Alpha-aminoadipic semialdehyde synthase, mitochondrial (SMED30016114) t-SNE clustered cells

Violin plots show distribution of expression levels for Alpha-aminoadipic semialdehyde synthase, mitochondrial (SMED30016114) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Alpha-aminoadipic semialdehyde synthase, mitochondrial (SMED30016114) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Alpha-aminoadipic semialdehyde synthase, mitochondrial (SMED30016114) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016114

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30016114SMESG000042307.1 dd_Smed_v4_2894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
lateral region of the whole animalSMED30016114SMESG000042307.1 dd_Smed_v4_2894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016114SMESG000042307.1 dd_Smed_v4_2894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
medial muscle cellSMED30016114SMESG000042307.1 dd_Smed_v4_2894_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016114SMESG000042307.1 dd_Smed_v4_2894_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Human
Match: AASS (aminoadipate-semialdehyde synthase [Source:HGNC Symbol;Acc:HGNC:17366])

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 476/926 (51.40%), Postives = 633/926 (68.36%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
             V A+RRE +N WERRAPLAPK +K +   G+KVL+QPSNRRA  + +Y +AG I+QEDISEA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQ +F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E+DKHPE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P                   KF+P   + GCP LPH+L+AICDISAD GGSIEF+ ECTTI+ PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT+ FG +L PY+ EMI S+A  P E    SPVV++AVI SNG L   +KYI  LRES+  A+  ++ T   +R+VL+LGSG++ EP++ YL +D NI+IT+G   K ++  L  K++ +NP  +DI    E L  L+   ++V+S++P+  H L+ K CI    NMVTASY TP L++  K+VEDAGIT + E+GLDPG+DHM+A +  D   E G  I SY S+ GGLPAPE S NPLRYKFSWSP   LM  +  A Y+ +GKV  +  G   + A   M   PG NL+GYPNRDST Y + YG+++ HTL+RGTLRYKG+  A+   +++GL++ +  P        +TWKQ +C  + ++       LK AV +KL  D  +    E  GL  D ++ +  + L  +S +L  KL+Y   E+D+++M     ++ P   L+   + LV YGD NGF AMA TVG PTA+  KM+LDGEI  KG++ P S +IY P+L+R+K EGI     +TI
Sbjct:   24 AVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEE--KLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAP------------------GKFSPA-GVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGT---RRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYN-INPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMNVMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTLLRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLKEAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILERIKAEGIIYTTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Human
Match: AASS (aminoadipate-semialdehyde synthase [Source:HGNC Symbol;Acc:HGNC:17366])

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 476/926 (51.40%), Postives = 633/926 (68.36%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
             V A+RRE +N WERRAPLAPK +K +   G+KVL+QPSNRRA  + +Y +AG I+QEDISEA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQ +F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E+DKHPE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P                   KF+P   + GCP LPH+L+AICDISAD GGSIEF+ ECTTI+ PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT+ FG +L PY+ EMI S+A  P E    SPVV++AVI SNG L   +KYI  LRES+  A+  ++ T   +R+VL+LGSG++ EP++ YL +D NI+IT+G   K ++  L  K++ +NP  +DI    E L  L+   ++V+S++P+  H L+ K CI    NMVTASY TP L++  K+VEDAGIT + E+GLDPG+DHM+A +  D   E G  I SY S+ GGLPAPE S NPLRYKFSWSP   LM  +  A Y+ +GKV  +  G   + A   M   PG NL+GYPNRDST Y + YG+++ HTL+RGTLRYKG+  A+   +++GL++ +  P        +TWKQ +C  + ++       LK AV +KL  D  +    E  GL  D ++ +  + L  +S +L  KL+Y   E+D+++M     ++ P   L+   + LV YGD NGF AMA TVG PTA+  KM+LDGEI  KG++ P S +IY P+L+R+K EGI     +TI
Sbjct:   24 AVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEE--KLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAP------------------GKFSPA-GVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGT---RRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYN-INPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMNVMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTLLRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLKEAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILERIKAEGIIYTTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Human
Match: AASS (aminoadipate-semialdehyde synthase [Source:HGNC Symbol;Acc:HGNC:17366])

HSP 1 Score: 835.484 bits (2157), Expect = 0.000e+0
Identity = 406/732 (55.46%), Postives = 524/732 (71.58%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGF 2354
             V A+RRE +N WERRAPLAPK +K +   G+KVL+QPSNRRA  + +Y +AG I+QEDISEA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQ +F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E+DKHPE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P                   KF+P   + GCP LPH+L+AICDISAD GGSIEF+ ECTTI+ PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT+ FG +L PY+ EMI S+A  P E    SPVV++AVI SNG L   +KYI  LRES+  A+  ++ T   +R+VL+LGSG++ EP++ YL +D NI+IT+G   K ++  L  K++ +NP  +DI    E L  L+   ++V+S++P+  H L+ K CI    NMVTASY TP L++  K+VEDAGIT + E+GLDPG+DHM+A +  D   E G  I SY S+ GGLPAPE S NPLRYKFSWSP   LM  +  A Y+ +GKV  +  G   + A   M   PG NL+GYPNRDST Y + YG+++ HTL+RGTLRYKG 
Sbjct:   24 AVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEE--KLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAP------------------GKFSPA-GVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGT---RRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYN-INPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMNVMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTLLRGTLRYKGL 730          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Human
Match: AASS (aminoadipate-semialdehyde synthase [Source:HGNC Symbol;Acc:HGNC:17366])

HSP 1 Score: 615.15 bits (1585), Expect = 0.000e+0
Identity = 297/509 (58.35%), Postives = 380/509 (74.66%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQIT 1685
             V A+RRE +N WERRAPLAPK +K +   G+KVL+QPSNRRA  + +Y +AG I+QEDISEA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQ +F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E+DKHPE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P                   KF+P   + GCP LPH+L+AICDISAD GGSIEF+ ECTTI+ PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT+ FG +L PY+ EMI S+A  P E    SPVV++AVI SNG L   +KYI  LRES+  A+  ++ T   +R+VL+LGSG++ EP++ YL +D NI+IT
Sbjct:   24 AVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEE--KLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAP------------------GKFSPA-GVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGT---RRKVLVLGSGYISEPVLEYLSRDGNIEIT 508          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Celegans
Match: aass-1 (AminoAdipate-Semialdehyde Synthase homolog [Source:UniProtKB/TrEMBL;Acc:U4PFH6])

HSP 1 Score: 932.939 bits (2410), Expect = 0.000e+0
Identity = 461/934 (49.36%), Postives = 642/934 (68.74%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKF-FGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESK---RSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGG--DLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTN-VHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLN-GPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIM 2939
               IRRE++N WERRAPLAP  VK+L + G  VL+QPSNRRAY   +Y  AGAI++ED+SEA +I+ VK VP+D   LIPNKT+AFFSHTIKAQ+DNME+LDTIL+R IRL+DYEK+ DD+G+R+V FG++AG AG I+ILHGIG+RLLALGH+TPF+H+GLAHNY    MA  A+RD GY IAL  MP+S+GPL FVFTG+GNVSQGA+E+F  LP+E+V+   L  V   G   K+Y CVV+R DH+  +    FD +EF++ P+ Y S F+  IAPYASVIING+YW   SPRLITIPDAK+LL P +       +     ++S K   + + PGCP LPH LIA+CDISADPGGS+EF++ECTTIDKPF +YDA+ N S++ F    G LVCS+DNMPAQ+P  AT+ FG+LL P++++++ ++ +  F+  +    +KNA+I   G+LTP  +YI +LR+ K    SA  + +  T+ KR VL+LG+G V  P   +  K +++ +T+    + +   L    + +   ++DI  ++  +E+LI+ H++VVS++P+ +H L+ K CI   R+MVT+SY +P+LE   KA +DA +T + E GLDPGIDHM+A + FDD+ E G  I S++SF GGLPAPE+S+NPLRYKFSWSP+  L   +NPAKY++NGK+ E+ +G   D ++    +  +PG NL G+PNRDST Y   YGL N   T+IRGTLRY+GF D + +L  +GLLS         N GP +TWK+ +       +DIF  +L++ + EK+       S LE+ GLF D  +++ GTP+ T++ YL++ LA++ +E D+V++ H++  + P    ++  + LV YG+PNGF AMA TVGY TAI   M+L+ EIQ+ GI  P+  ++YRP LKRL+  GI    T T M
Sbjct:   31 TIGIRRETVNSWERRAPLAPTHVKRLTKSGVNVLIQPSNRRAYPIQDYISAGAIVREDLSEAHIIMSVKSVPIDQ--LIPNKTYAFFSHTIKAQQDNMEMLDTILQRNIRLLDYEKICDDKGKRLVMFGKWAGNAGFIDILHGIGLRLLALGHNTPFLHMGLAHNYNDSHMAINALRDIGYEIALDRMPRSLGPLIFVFTGSGNVSQGARELFEHLPHEYVDVATLPKVAQKGQLNKVYGCVVTRKDHFVPKHGGPFDKKEFEQFPDRYTSKFATEIAPYASVIINGVYWDAQSPRLITIPDAKNLLTPVQR---KKKKTNQTSRASTKSGGLYDTPGCPTLPHHLIALCDISADPGGSVEFMRECTTIDKPFAIYDADFNTSSDSFDAASGCLVCSIDNMPAQMPIEATEQFGNLLYPWLWDLLNTSNDQHFDRLQCRTEIKNAIITDQGKLTPNFEYIAQLRKDKAASASANSRVMGGTTDKR-VLLLGAGMVSGPFADFYSKQKDVNLTVATESQRDGQRLCTSPN-IQSVVVDIARESHTMERLIREHDLVVSLLPFNFHPLVAKMCISNQRDMVTSSYVSPELEALDKAAKDADVTIMNEAGLDPGIDHMLAMECFDDIKEHGGRITSFESFCGGLPAPEWSDNPLRYKFSWSPKGVLTALMNPAKYLKNGKIVEVPSGSVVDNLI---DIDFMPGLNLIGFPNRDSTKYSDVYGLGNDCKTIIRGTLRYQGFVDTVKALHSVGLLSGDNIDSFTSNIGPDLTWKELIASLSNQKLDIFPDSLRHIIEEKVGGK--GLSALENLGLFSDKVVDRHGTPIDTLAQYLAKILAFKDHESDLVVLNHDIGAQLPGGNSERHRISLVQYGNPNGFSAMARTVGYTTAIVSHMVLNNEIQRAGIQRPILKEVYRPALKRLRDFGIVPTHTITPM 952          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Celegans
Match: aass-1 (AminoAdipate-Semialdehyde Synthase homolog [Source:UniProtKB/TrEMBL;Acc:U4PFH6])

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 459/934 (49.14%), Postives = 636/934 (68.09%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKF-FGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESK---RSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGG--DLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTN-VHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLN-GPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIM 2939
               IRRE++N WERRAPLAP  VK+L + G  VL+QPSNRRAY   +Y  AGAI++ED+SEA +I+ VK VP+D   LIPNKT+AFFSHTIKAQ+DNME+LDTIL+R IRL+DYEK+ DD+G+R+V FG++AG AG I+ILHGIG+RLLALGH+TPF+H+GLAHNY    MA  A+RD GY IAL  MP+S+GPL FVFTG+GNVSQGA+E+F  LP+E+V+   L  V   G   K+Y CVV+R DH+  +    FD +EF++ P+ Y S F+  IAPYASVIING+YW   SPRLITIPDAK+LL P +                       + PGCP LPH LIA+CDISADPGGS+EF++ECTTIDKPF +YDA+ N S++ F    G LVCS+DNMPAQ+P  AT+ FG+LL P++++++ ++ +  F+  +    +KNA+I   G+LTP  +YI +LR+ K    SA  + +  T+ KR VL+LG+G V  P   +  K +++ +T+    + +   L    + +   ++DI  ++  +E+LI+ H++VVS++P+ +H L+ K CI   R+MVT+SY +P+LE   KA +DA +T + E GLDPGIDHM+A + FDD+ E G  I S++SF GGLPAPE+S+NPLRYKFSWSP+  L   +NPAKY++NGK+ E+ +G   D ++    +  +PG NL G+PNRDST Y   YGL N   T+IRGTLRY+GF D + +L  +GLLS         N GP +TWK+ +       +DIF  +L++ + EK+       S LE+ GLF D  +++ GTP+ T++ YL++ LA++ +E D+V++ H++  + P    ++  + LV YG+PNGF AMA TVGY TAI   M+L+ EIQ+ GI  P+  ++YRP LKRL+  GI    T T M
Sbjct:   31 TIGIRRETVNSWERRAPLAPTHVKRLTKSGVNVLIQPSNRRAYPIQDYISAGAIVREDLSEAHIIMSVKSVPIDQ--LIPNKTYAFFSHTIKAQQDNMEMLDTILQRNIRLLDYEKICDDKGKRLVMFGKWAGNAGFIDILHGIGLRLLALGHNTPFLHMGLAHNYNDSHMAINALRDIGYEIALDRMPRSLGPLIFVFTGSGNVSQGARELFEHLPHEYVDVATLPKVAQKGQLNKVYGCVVTRKDHFVPKHGGPFDKKEFEQFPDRYTSKFATEIAPYASVIINGVYWDAQSPRLITIPDAKNLLTPVQR---------------------YDTPGCPTLPHHLIALCDISADPGGSVEFMRECTTIDKPFAIYDADFNTSSDSFDAASGCLVCSIDNMPAQMPIEATEQFGNLLYPWLWDLLNTSNDQHFDRLQCRTEIKNAIITDQGKLTPNFEYIAQLRKDKAASASANSRVMGGTTDKR-VLLLGAGMVSGPFADFYSKQKDVNLTVATESQRDGQRLCTSPN-IQSVVVDIARESHTMERLIREHDLVVSLLPFNFHPLVAKMCISNQRDMVTSSYVSPELEALDKAAKDADVTIMNEAGLDPGIDHMLAMECFDDIKEHGGRITSFESFCGGLPAPEWSDNPLRYKFSWSPKGVLTALMNPAKYLKNGKIVEVPSGSVVDNLI---DIDFMPGLNLIGFPNRDSTKYSDVYGLGNDCKTIIRGTLRYQGFVDTVKALHSVGLLSGDNIDSFTSNIGPDLTWKELIASLSNQKLDIFPDSLRHIIEEKVGGK--GLSALENLGLFSDKVVDRHGTPIDTLAQYLAKILAFKDHESDLVVLNHDIGAQLPGGNSERHRISLVQYGNPNGFSAMARTVGYTTAIVSHMVLNNEIQRAGIQRPILKEVYRPALKRLRDFGIVPTHTITPM 934          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Fly
Match: LKRSDH (gene:FBgn0286198 transcript:FBtr0343404)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 488/937 (52.08%), Postives = 665/937 (70.97%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESK-RSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGL-TNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEM-NIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            +R   S V AIRRE  ++WERRAP  P  V++LV+   KV+VQPSNRRAY    Y QAGA +QEDIS+AS+I GVK+VP+D   LIP KT+ FFSHTIKAQE NM LLD ILE+KIRLIDYE+++D++G R VAFG+YAG+AGM+NILHGIG+RLLALGHHTPFMHIG AHNYR   MA+QAIRDCGY I+LG MPKSIGPLTFVFTG+GNVSQGAQE+F +LP E+V PE L+ V  HG+  K+Y C VSR+DH  RR   GFD +E+D+ PE YISTFS  IAPYASVI+NGIYWA  SP+LI+IPDAK+LL+P  TPW P+ +                  G P LPHR++AICDISADPGGSIEF+ ECTTID PFCLYDA++N   + F GPGVLVCS+DNMP QLPR +TD FG LL P+++++IKS+A+ P  +   S  +++A+IASNG+LT   +YI +LRES+   +R +   ++   ++VL+LG+G V  PL+ +L +++++ IT+    K E   LA ++  V+   +D+      L++L    ++VVS++P+  H ++ ++C+ +  +MVTASY   ++    +  +  G+T + EVGLDPGIDH++A +   ++ + G  + S+ S+ GGLPAPE S N LRYKFSWSP   L+  L+ AKY+  G++ EI  GG+LM + + +  LPGF L+G+PNRDST Y   YGL  +VHTL+RGT+RYKGF++++  +  +GL+ P+P   LH +GP +TW+Q +   M M +  IF   LK  + E++ +       +E  GL  D  + K  TPL T+SHYLS++LA+E++ERD+V++ HEV ++WP+ + ++  +  VVYG P G  AMA TVG P AI  KMILDGEIQ++G++LP + DIYRPML+RL+ EG+   ET+  ++
Sbjct:   16 TRQRHSRVIAIRREDQSVWERRAPFGPTHVQKLVKQNVKVIVQPSNRRAYPMQAYMQAGAHIQEDISDASVIFGVKQVPID--ALIPGKTYCFFSHTIKAQESNMPLLDAILEKKIRLIDYERIIDERGARQVAFGKYAGVAGMVNILHGIGLRLLALGHHTPFMHIGPAHNYRNSSMARQAIRDCGYEISLGMMPKSIGPLTFVFTGSGNVSQGAQEVFSELPIEYVPPEMLRKVAEHGNQNKLYGCEVSRSDHLERREGGGFDAKEYDEFPERYISTFSTKIAPYASVIVNGIYWAVGSPKLISIPDAKNLLRPANTPWLPTSK------------------GSPALPHRMLAICDISADPGGSIEFMNECTTIDTPFCLYDADRNKDTKSFKGPGVLVCSIDNMPTQLPRESTDLFGELLAPHVHDIIKSDAKKPLAEENFSYPIQSAIIASNGQLTEGFQYIQELRESQSHRSRHKMEGSSESDKKVLVLGAGMVSAPLVEWLHREKDVSITVCSQVKEEADRLAQQYAGVDSVYLDVNESTGHLQELCGRADVVVSLLPYSLHGMVARYCVAEGTHMVTASYLNDEISGLHEEAKAKGVTIMNEVGLDPGIDHLLALECIHEVQDKGAVVESFVSYCGGLPAPEHSNNALRYKFSWSPRGVLLNTLSAAKYLSQGQIVEISGGGELMSSPRSLDFLPGFALEGFPNRDSTKYGNLYGLGRDVHTLLRGTIRYKGFSESIKPMQLLGLIDPEPHALLHPSGPDVTWRQLVIHLMGMSDSTIFYENLKQKLTERIGD----VDGIESLGLLDDTPVVKLNTPLDTLSHYLSKRLAFERDERDLVVLRHEVGIRWPDGRREERGINFVVYGQPQGHSAMAMTVGKPAAIAAKMILDGEIQERGVLLPFTPDIYRPMLQRLRSEGLTATETSRWLN 928          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Fly
Match: LKRSDH (gene:FBgn0286198 transcript:FBtr0079495)

HSP 1 Score: 1023.08 bits (2644), Expect = 0.000e+0
Identity = 488/937 (52.08%), Postives = 665/937 (70.97%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESK-RSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGL-TNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEM-NIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            +R   S V AIRRE  ++WERRAP  P  V++LV+   KV+VQPSNRRAY    Y QAGA +QEDIS+AS+I GVK+VP+D   LIP KT+ FFSHTIKAQE NM LLD ILE+KIRLIDYE+++D++G R VAFG+YAG+AGM+NILHGIG+RLLALGHHTPFMHIG AHNYR   MA+QAIRDCGY I+LG MPKSIGPLTFVFTG+GNVSQGAQE+F +LP E+V PE L+ V  HG+  K+Y C VSR+DH  RR   GFD +E+D+ PE YISTFS  IAPYASVI+NGIYWA  SP+LI+IPDAK+LL+P  TPW P+ +                  G P LPHR++AICDISADPGGSIEF+ ECTTID PFCLYDA++N   + F GPGVLVCS+DNMP QLPR +TD FG LL P+++++IKS+A+ P  +   S  +++A+IASNG+LT   +YI +LRES+   +R +   ++   ++VL+LG+G V  PL+ +L +++++ IT+    K E   LA ++  V+   +D+      L++L    ++VVS++P+  H ++ ++C+ +  +MVTASY   ++    +  +  G+T + EVGLDPGIDH++A +   ++ + G  + S+ S+ GGLPAPE S N LRYKFSWSP   L+  L+ AKY+  G++ EI  GG+LM + + +  LPGF L+G+PNRDST Y   YGL  +VHTL+RGT+RYKGF++++  +  +GL+ P+P   LH +GP +TW+Q +   M M +  IF   LK  + E++ +       +E  GL  D  + K  TPL T+SHYLS++LA+E++ERD+V++ HEV ++WP+ + ++  +  VVYG P G  AMA TVG P AI  KMILDGEIQ++G++LP + DIYRPML+RL+ EG+   ET+  ++
Sbjct:   16 TRQRHSRVIAIRREDQSVWERRAPFGPTHVQKLVKQNVKVIVQPSNRRAYPMQAYMQAGAHIQEDISDASVIFGVKQVPID--ALIPGKTYCFFSHTIKAQESNMPLLDAILEKKIRLIDYERIIDERGARQVAFGKYAGVAGMVNILHGIGLRLLALGHHTPFMHIGPAHNYRNSSMARQAIRDCGYEISLGMMPKSIGPLTFVFTGSGNVSQGAQEVFSELPIEYVPPEMLRKVAEHGNQNKLYGCEVSRSDHLERREGGGFDAKEYDEFPERYISTFSTKIAPYASVIVNGIYWAVGSPKLISIPDAKNLLRPANTPWLPTSK------------------GSPALPHRMLAICDISADPGGSIEFMNECTTIDTPFCLYDADRNKDTKSFKGPGVLVCSIDNMPTQLPRESTDLFGELLAPHVHDIIKSDAKKPLAEENFSYPIQSAIIASNGQLTEGFQYIQELRESQSHRSRHKMEGSSESDKKVLVLGAGMVSAPLVEWLHREKDVSITVCSQVKEEADRLAQQYAGVDSVYLDVNESTGHLQELCGRADVVVSLLPYSLHGMVARYCVAEGTHMVTASYLNDEISGLHEEAKAKGVTIMNEVGLDPGIDHLLALECIHEVQDKGAVVESFVSYCGGLPAPEHSNNALRYKFSWSPRGVLLNTLSAAKYLSQGQIVEISGGGELMSSPRSLDFLPGFALEGFPNRDSTKYGNLYGLGRDVHTLLRGTIRYKGFSESIKPMQLLGLIDPEPHALLHPSGPDVTWRQLVIHLMGMSDSTIFYENLKQKLTERIGD----VDGIESLGLLDDTPVVKLNTPLDTLSHYLSKRLAFERDERDLVVLRHEVGIRWPDGRREERGINFVVYGQPQGHSAMAMTVGKPAAIAAKMILDGEIQERGVLLPFTPDIYRPMLQRLRSEGLTATETSRWLN 928          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Zebrafish
Match: aass (aminoadipate-semialdehyde synthase [Source:ZFIN;Acc:ZDB-GENE-061220-8])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 473/925 (51.14%), Postives = 656/925 (70.92%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
            V AIRRE +N+WERRAPLAP+ V+++   G KVLVQPSNRRA  +  Y++AGA++QEDISEASLIIGVK+ P + +   P KT+AFFSHTIKAQE NM LLD +L++++RLIDYEKM+D  G R+VAFGQ+AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  A QA+RDCGY I+LG MPKSIGPLTFVFTGTGNVS+GAQ++F +LP EFVEP  LK+V + GD  K+YA V+SR+ H  RRSD  +DP E++ HPELY S F   +APY + +INGIYW P +PRL+   DA+ L++P           V    SS  +       GCP LPH+ +AICDISAD GGSIEF+ ECTTI+KPFC+YDA Q++ ++   G G+L+CS+DN+PAQLP  AT++FG  L PY+ EM+ S+A  P E+   SP V++AVI SNG+LTP  +YI KLRE + S   Q LK   G ++VL+LG+G+V  P+I YL +D   Q+T+      +   +A ++      ++DI +    LE LIK H+IV+SM+P+ +H  + KHCIK   NMVTASY +P +++  K+ EDAGIT + E+GLDPGIDHM+A +  D     G  + SY SF GGLPAPE S+NPLRYKFSWSP   L+  ++PA Y+++ ++  +  GG L+  +K+M  +PGFNL+G+PNRDST Y + YG+ + HTLIRGTLR++GF+ AM   +++GL++ +P P L      ++WK+ +CKQ+ ++  +     ++AV+EK+ +D F+   L+  GL  +  +    T LA ++ +L  KL+++K ERD++IM ++V ++ P  +L+   + LVVYGDP+G+ AMA TVGYP AI   M+L+GE+  KG+V+P+   IY P+LKRL+ EG++ +  +++
Sbjct:   32 VIAIRREDVNVWERRAPLAPRHVREITAAGHKVLVQPSNRRAIHDRYYEKAGAVIQEDISEASLIIGVKRPPEEKV--YPRKTYAFFSHTIKAQEANMGLLDDLLKKEVRLIDYEKMVDPNGYRIVAFGQWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQAIQAVRDCGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQDIFNELPCEFVEPHELKEVSLSGDLTKVYATVISRHHHLMRRSDGLYDPLEYENHPELYTSHFRDTVAPYTTCLINGIYWDPHTPRLLRRLDAQRLIRP-----------VVTTSSSADY-------GCPALPHKFLAICDISADTGGSIEFMTECTTIEKPFCMYDANQHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLFPYVMEMLPSDATKPLEEEDFSPQVRDAVITSNGKLTPKFEYIQKLRERRESE--QILKK-GGMKRVLLLGAGYVSGPVIEYLTRDAGTQVTVASNLLNQAEEMATRYPNTIAVMLDITSQEGHLESLIKDHDIVISMLPYSFHPQVAKHCIKLKVNMVTASYLSPAMKELQKSAEDAGITIVNEMGLDPGIDHMLAMECIDQAKADGCTVESYSSFCGGLPAPECSDNPLRYKFSWSPYGVLLNTISPAIYLKDNQIVSVPPGGALLDVTKEMDFMPGFNLEGFPNRDSTKYAEPYGIESAHTLIRGTLRFRGFSSAMSGFVKLGLINTEPCPLLDHTASPVSWKELLCKQIGLSATVSNSVFEDAVYEKIGKDDFRMQSLKWLGLLGEEPVPHAETILAAVAKHLEAKLSFDKGERDMIIMRNDVGIRHPTGELETKHISLVVYGDPSGYSAMAKTVGYPAAIAAHMVLNGELTTKGLVVPMVKSIYSPVLKRLQDEGLQFITKSSV 933          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Zebrafish
Match: aass (aminoadipate-semialdehyde synthase [Source:ZFIN;Acc:ZDB-GENE-061220-8])

HSP 1 Score: 1006.13 bits (2600), Expect = 0.000e+0
Identity = 473/925 (51.14%), Postives = 656/925 (70.92%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
            V AIRRE +N+WERRAPLAP+ V+++   G KVLVQPSNRRA  +  Y++AGA++QEDISEASLIIGVK+ P + +   P KT+AFFSHTIKAQE NM LLD +L++++RLIDYEKM+D  G R+VAFGQ+AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  A QA+RDCGY I+LG MPKSIGPLTFVFTGTGNVS+GAQ++F +LP EFVEP  LK+V + GD  K+YA V+SR+ H  RRSD  +DP E++ HPELY S F   +APY + +INGIYW P +PRL+   DA+ L++P           V    SS  +       GCP LPH+ +AICDISAD GGSIEF+ ECTTI+KPFC+YDA Q++ ++   G G+L+CS+DN+PAQLP  AT++FG  L PY+ EM+ S+A  P E+   SP V++AVI SNG+LTP  +YI KLRE + S   Q LK   G ++VL+LG+G+V  P+I YL +D   Q+T+      +   +A ++      ++DI +    LE LIK H+IV+SM+P+ +H  + KHCIK   NMVTASY +P +++  K+ EDAGIT + E+GLDPGIDHM+A +  D     G  + SY SF GGLPAPE S+NPLRYKFSWSP   L+  ++PA Y+++ ++  +  GG L+  +K+M  +PGFNL+G+PNRDST Y + YG+ + HTLIRGTLR++GF+ AM   +++GL++ +P P L      ++WK+ +CKQ+ ++  +     ++AV+EK+ +D F+   L+  GL  +  +    T LA ++ +L  KL+++K ERD++IM ++V ++ P  +L+   + LVVYGDP+G+ AMA TVGYP AI   M+L+GE+  KG+V+P+   IY P+LKRL+ EG++ +  +++
Sbjct:   32 VIAIRREDVNVWERRAPLAPRHVREITAAGHKVLVQPSNRRAIHDRYYEKAGAVIQEDISEASLIIGVKRPPEEKV--YPRKTYAFFSHTIKAQEANMGLLDDLLKKEVRLIDYEKMVDPNGYRIVAFGQWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQAIQAVRDCGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQDIFNELPCEFVEPHELKEVSLSGDLTKVYATVISRHHHLMRRSDGLYDPLEYENHPELYTSHFRDTVAPYTTCLINGIYWDPHTPRLLRRLDAQRLIRP-----------VVTTSSSADY-------GCPALPHKFLAICDISADTGGSIEFMTECTTIEKPFCMYDANQHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLFPYVMEMLPSDATKPLEEEDFSPQVRDAVITSNGKLTPKFEYIQKLRERRESE--QILKK-GGMKRVLLLGAGYVSGPVIEYLTRDAGTQVTVASNLLNQAEEMATRYPNTIAVMLDITSQEGHLESLIKDHDIVISMLPYSFHPQVAKHCIKLKVNMVTASYLSPAMKELQKSAEDAGITIVNEMGLDPGIDHMLAMECIDQAKADGCTVESYSSFCGGLPAPECSDNPLRYKFSWSPYGVLLNTISPAIYLKDNQIVSVPPGGALLDVTKEMDFMPGFNLEGFPNRDSTKYAEPYGIESAHTLIRGTLRFRGFSSAMSGFVKLGLINTEPCPLLDHTASPVSWKELLCKQIGLSATVSNSVFEDAVYEKIGKDDFRMQSLKWLGLLGEEPVPHAETILAAVAKHLEAKLSFDKGERDMIIMRNDVGIRHPTGELETKHISLVVYGDPSGYSAMAKTVGYPAAIAAHMVLNGELTTKGLVVPMVKSIYSPVLKRLQDEGLQFITKSSV 933          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Zebrafish
Match: aass (aminoadipate-semialdehyde synthase [Source:ZFIN;Acc:ZDB-GENE-061220-8])

HSP 1 Score: 276.944 bits (707), Expect = 8.103e-86
Identity = 130/198 (65.66%), Postives = 162/198 (81.82%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKS 734
            ++     V AIRRE +N+WERRAPLAP+ V+++   G KVLVQPSNRRA  +  Y++AGA++QEDISEASLIIGVK+ P + +   P KT+AFFSHTIKAQE NM LLD +L++++RLIDYEKM+D  G R+VAFGQ+AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  A QA+RDCGY I+LG MPKS
Sbjct:   25 NQQNHKSVIAIRREDVNVWERRAPLAPRHVREITAAGHKVLVQPSNRRAIHDRYYEKAGAVIQEDISEASLIIGVKRPPEEKV--YPRKTYAFFSHTIKAQEANMGLLDDLLKKEVRLIDYEKMVDPNGYRIVAFGQWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQAIQAVRDCGYEISLGLMPKS 220          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Match: nob1 (NIN1 (RPN12) binding protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1016105])

HSP 1 Score: 1021.92 bits (2641), Expect = 0.000e+0
Identity = 493/937 (52.61%), Postives = 660/937 (70.44%), Query Frame = 3
Query:  114 NLVFIKKYG----SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            N+V  +  G    SR     V AIRRE IN WERRAPLAPK VK+L   G+KVLVQPSNRRA  E EY +AG I+QEDI EASLI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+ +IRLIDYEKM+D +G RVVAFGQ+AG+AGMIN+LHG+G+R LALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LK+V   GD +K+YA V+SR+ H  R++D  +DP E+DK+PELY S F+  IAPY + +INGIYW P +PRL+T  DA+ LL P K+                     +   GCP+LPH+L+AI DISAD GGSIEF+ ECTTID PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PYI EM+ SNA  P E    SPVV+NAVIAS+G LTP +KYI KLRES+  A+L T  T   K+++L+LGSG+V EP+I+YL +D N++IT     K ++  L+ ++    P  +DI  + E L  LIK H++VVS++P+  H  + K CIK   N+VTASY +P +++  +  EDAGI  + E+GLDPG+DHM+A + FD   + G  + SY SF GGLPAPEFS+NPLRYKFSWSP + L   + PA Y+++G++  I AGG L+ +   M   PG NL+G+PNRDST Y + YG+   HTL+RGTLRYKGF +AM   +Q+GL++  P P L +N P ITW++ +C  M ++     G LK  V+ KL+++      LE FGL  +  +    + +  ++ +L   L++   ERD++++ +++ ++ P   L+  ++ LVVYGD NG+ AMA TVGYPTAI  KM+LDGE++ +G+V+PL+ +IY P+L+R+K+EGI
Sbjct:    3 NIVMTRMKGGGVSSRHHHKAVLAIRREDINAWERRAPLAPKHVKELTSLGYKVLVQPSNRRAIHEKEYIKAGGIIQEDIQEASLIVGVKRPPEE--KLLPKKTYAFFSHTIKAQEANMSLLDEILKMEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINMLHGLGLRFLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKEVSKTGDLRKVYATVLSRHHHLVRKTDGVYDPVEYDKNPELYTSRFNTDIAPYTTCLINGIYWDPHTPRLLTRQDAQRLLAPVKSS-------------------TVATEGCPELPHKLLAIGDISADTGGSIEFMTECTTIDMPFCMYDADQHIIHDSVEGCGILMCSIDNLPAQLPIEATEYFGDMLFPYIEEMLMSNATKPMEQQTFSPVVRNAVIASSGSLTPKYKYIQKLRESREHAQLMTQGT---KKKILVLGSGYVSEPVINYLTRDPNVEITAVSMVKDQVDHLSKRYHNTTPIAMDIFKNEEKLSALIKKHDLVVSLLPYSAHPSVAKKCIKNKVNLVTASYISPAMKELQQGAEDAGIIIVGEMGLDPGLDHMLAMECFDKAKDVGAKVESYISFCGGLPAPEFSDNPLRYKFSWSPLAVLFNTVQPATYLKDGQIVNIAAGGSLLESVTAMDCFPGLNLEGFPNRDSTKYAEPYGIQTAHTLMRGTLRYKGFCNAMSGFVQLGLINSDPCPLLGMNAPAITWRELLCHLMNVSSSTSIGLLKELVYNKLDKNDSNMETLEWFGLLSEEPVPVADSIVGALAKHLEMMLSFGPGERDMIVLRNDIGIRHPSGHLECKNISLVVYGDVNGYSAMAKTVGYPTAIAAKMVLDGEVESRGLVIPLTKNIYGPILERVKEEGI 915          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Match: nob1 (NIN1 (RPN12) binding protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1016105])

HSP 1 Score: 1018.84 bits (2633), Expect = 0.000e+0
Identity = 489/924 (52.92%), Postives = 655/924 (70.89%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            +R     V AIRRE IN WERRAPLAPK VK+L   G+KVLVQPSNRRA  E EY +AG I+QEDI EASLI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+ +IRLIDYEKM+D +G RVVAFGQ+AG+AGMIN+LHG+G+R LALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LK+V   GD +K+YA V+SR+ H  R++D  +DP E+DK+PELY S F+  IAPY + +INGIYW P +PRL+T  DA+ LL P K+                     +   GCP+LPH+L+AI DISAD GGSIEF+ ECTTID PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PYI EM+ SNA  P E    SPVV+NAVIAS+G LTP +KYI KLRES+  A+L T  T   K+++L+LGSG+V EP+I+YL +D N++IT     K ++  L+ ++    P  +DI  + E L  LIK H++VVS++P+  H  + K CIK   N+VTASY +P +++  +  EDAGI  + E+GLDPG+DHM+A + FD   + G  + SY SF GGLPAPEFS+NPLRYKFSWSP + L   + PA Y+++G++  I AGG L+ +   M   PG NL+G+PNRDST Y + YG+   HTL+RGTLRYKGF +AM   +Q+GL++  P P L +N P ITW++ +C  M ++     G LK  V+ KL+++      LE FGL  +  +    + +  ++ +L   L++   ERD++++ +++ ++ P   L+  ++ LVVYGD NG+ AMA TVGYPTAI  KM+LDGE++ +G+V+PL+ +IY P+L+R+K+EGI
Sbjct:   18 ARHHHKAVLAIRREDINAWERRAPLAPKHVKELTSLGYKVLVQPSNRRAIHEKEYIKAGGIIQEDIQEASLIVGVKRPPEE--KLLPKKTYAFFSHTIKAQEANMSLLDEILKMEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINMLHGLGLRFLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKEVSKTGDLRKVYATVLSRHHHLVRKTDGVYDPVEYDKNPELYTSRFNTDIAPYTTCLINGIYWDPHTPRLLTRQDAQRLLAPVKSS-------------------TVATEGCPELPHKLLAIGDISADTGGSIEFMTECTTIDMPFCMYDADQHIIHDSVEGCGILMCSIDNLPAQLPIEATEYFGDMLFPYIEEMLMSNATKPMEQQTFSPVVRNAVIASSGSLTPKYKYIQKLRESREHAQLMTQGT---KKKILVLGSGYVSEPVINYLTRDPNVEITAVSMVKDQVDHLSKRYHNTTPIAMDIFKNEEKLSALIKKHDLVVSLLPYSAHPSVAKKCIKNKVNLVTASYISPAMKELQQGAEDAGIIIVGEMGLDPGLDHMLAMECFDKAKDVGAKVESYISFCGGLPAPEFSDNPLRYKFSWSPLAVLFNTVQPATYLKDGQIVNIAAGGSLLESVTAMDCFPGLNLEGFPNRDSTKYAEPYGIQTAHTLMRGTLRYKGFCNAMSGFVQLGLINSDPCPLLGMNAPAITWRELLCHLMNVSSSTSIGLLKELVYNKLDKNDSNMETLEWFGLLSEEPVPVADSIVGALAKHLEMMLSFGPGERDMIVLRNDIGIRHPSGHLECKNISLVVYGDVNGYSAMAKTVGYPTAIAAKMVLDGEVESRGLVIPLTKNIYGPILERVKEEGI 917          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Match: nob1 (NIN1 (RPN12) binding protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1016105])

HSP 1 Score: 1018.07 bits (2631), Expect = 0.000e+0
Identity = 489/924 (52.92%), Postives = 655/924 (70.89%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            +R     V AIRRE IN WERRAPLAPK VK+L   G+KVLVQPSNRRA  E EY +AG I+QEDI EASLI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+ +IRLIDYEKM+D +G RVVAFGQ+AG+AGMIN+LHG+G+R LALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LK+V   GD +K+YA V+SR+ H  R++D  +DP E+DK+PELY S F+  IAPY + +INGIYW P +PRL+T  DA+ LL P K+                     +   GCP+LPH+L+AI DISAD GGSIEF+ ECTTID PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PYI EM+ SNA  P E    SPVV+NAVIAS+G LTP +KYI KLRES+  A+L T  T   K+++L+LGSG+V EP+I+YL +D N++IT     K ++  L+ ++    P  +DI  + E L  LIK H++VVS++P+  H  + K CIK   N+VTASY +P +++  +  EDAGI  + E+GLDPG+DHM+A + FD   + G  + SY SF GGLPAPEFS+NPLRYKFSWSP + L   + PA Y+++G++  I AGG L+ +   M   PG NL+G+PNRDST Y + YG+   HTL+RGTLRYKGF +AM   +Q+GL++  P P L +N P ITW++ +C  M ++     G LK  V+ KL+++      LE FGL  +  +    + +  ++ +L   L++   ERD++++ +++ ++ P   L+  ++ LVVYGD NG+ AMA TVGYPTAI  KM+LDGE++ +G+V+PL+ +IY P+L+R+K+EGI
Sbjct:   55 ARHHHKAVLAIRREDINAWERRAPLAPKHVKELTSLGYKVLVQPSNRRAIHEKEYIKAGGIIQEDIQEASLIVGVKRPPEE--KLLPKKTYAFFSHTIKAQEANMSLLDEILKMEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINMLHGLGLRFLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKEVSKTGDLRKVYATVLSRHHHLVRKTDGVYDPVEYDKNPELYTSRFNTDIAPYTTCLINGIYWDPHTPRLLTRQDAQRLLAPVKSS-------------------TVATEGCPELPHKLLAIGDISADTGGSIEFMTECTTIDMPFCMYDADQHIIHDSVEGCGILMCSIDNLPAQLPIEATEYFGDMLFPYIEEMLMSNATKPMEQQTFSPVVRNAVIASSGSLTPKYKYIQKLRESREHAQLMTQGT---KKKILVLGSGYVSEPVINYLTRDPNVEITAVSMVKDQVDHLSKRYHNTTPIAMDIFKNEEKLSALIKKHDLVVSLLPYSAHPSVAKKCIKNKVNLVTASYISPAMKELQQGAEDAGIIIVGEMGLDPGLDHMLAMECFDKAKDVGAKVESYISFCGGLPAPEFSDNPLRYKFSWSPLAVLFNTVQPATYLKDGQIVNIAAGGSLLESVTAMDCFPGLNLEGFPNRDSTKYAEPYGIQTAHTLMRGTLRYKGFCNAMSGFVQLGLINSDPCPLLGMNAPAITWRELLCHLMNVSSSTSIGLLKELVYNKLDKNDSNMETLEWFGLLSEEPVPVADSIVGALAKHLEMMLSFGPGERDMIVLRNDIGIRHPSGHLECKNISLVVYGDVNGYSAMAKTVGYPTAIAAKMVLDGEVESRGLVIPLTKNIYGPILERVKEEGI 954          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Match: nob1 (NIN1 (RPN12) binding protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1016105])

HSP 1 Score: 1017.3 bits (2629), Expect = 0.000e+0
Identity = 488/918 (53.16%), Postives = 653/918 (71.13%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
             V AIRRE IN WERRAPLAPK VK+L   G+KVLVQPSNRRA  E EY +AG I+QEDI EASLI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+ +IRLIDYEKM+D +G RVVAFGQ+AG+AGMIN+LHG+G+R LALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LK+V   GD +K+YA V+SR+ H  R++D  +DP E+DK+PELY S F+  IAPY + +INGIYW P +PRL+T  DA+ LL P K+                     +   GCP+LPH+L+AI DISAD GGSIEF+ ECTTID PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PYI EM+ SNA  P E    SPVV+NAVIAS+G LTP +KYI KLRES+  A+L T  T   K+++L+LGSG+V EP+I+YL +D N++IT     K ++  L+ ++    P  +DI  + E L  LIK H++VVS++P+  H  + K CIK   N+VTASY +P +++  +  EDAGI  + E+GLDPG+DHM+A + FD   + G  + SY SF GGLPAPEFS+NPLRYKFSWSP + L   + PA Y+++G++  I AGG L+ +   M   PG NL+G+PNRDST Y + YG+   HTL+RGTLRYKGF +AM   +Q+GL++  P P L +N P ITW++ +C  M ++     G LK  V+ KL+++      LE FGL  +  +    + +  ++ +L   L++   ERD++++ +++ ++ P   L+  ++ LVVYGD NG+ AMA TVGYPTAI  KM+LDGE++ +G+V+PL+ +IY P+L+R+K+EGI
Sbjct:   14 AVLAIRREDINAWERRAPLAPKHVKELTSLGYKVLVQPSNRRAIHEKEYIKAGGIIQEDIQEASLIVGVKRPPEE--KLLPKKTYAFFSHTIKAQEANMSLLDEILKMEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINMLHGLGLRFLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKEVSKTGDLRKVYATVLSRHHHLVRKTDGVYDPVEYDKNPELYTSRFNTDIAPYTTCLINGIYWDPHTPRLLTRQDAQRLLAPVKSS-------------------TVATEGCPELPHKLLAIGDISADTGGSIEFMTECTTIDMPFCMYDADQHIIHDSVEGCGILMCSIDNLPAQLPIEATEYFGDMLFPYIEEMLMSNATKPMEQQTFSPVVRNAVIASSGSLTPKYKYIQKLRESREHAQLMTQGT---KKKILVLGSGYVSEPVINYLTRDPNVEITAVSMVKDQVDHLSKRYHNTTPIAMDIFKNEEKLSALIKKHDLVVSLLPYSAHPSVAKKCIKNKVNLVTASYISPAMKELQQGAEDAGIIIVGEMGLDPGLDHMLAMECFDKAKDVGAKVESYISFCGGLPAPEFSDNPLRYKFSWSPLAVLFNTVQPATYLKDGQIVNIAAGGSLLESVTAMDCFPGLNLEGFPNRDSTKYAEPYGIQTAHTLMRGTLRYKGFCNAMSGFVQLGLINSDPCPLLGMNAPAITWRELLCHLMNVSSSTSIGLLKELVYNKLDKNDSNMETLEWFGLLSEEPVPVADSIVGALAKHLEMMLSFGPGERDMIVLRNDIGIRHPSGHLECKNISLVVYGDVNGYSAMAKTVGYPTAIAAKMVLDGEVESRGLVIPLTKNIYGPILERVKEEGI 907          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Match: nob1 (NIN1 (RPN12) binding protein 1 homolog [Source:Xenbase;Acc:XB-GENE-1016105])

HSP 1 Score: 988.408 bits (2554), Expect = 0.000e+0
Identity = 484/924 (52.38%), Postives = 646/924 (69.91%), Query Frame = 3
Query:  141 SRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            +R     V AIRRE IN WERRAPLAPK VK+L   G+KVLVQPSNRRA  E EY +AG I+QEDI EASLI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+ +IRLIDYEKM+D +G RVVAFGQ+AG+AGMIN+LHG+G+R LALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LK+V   GD +K+YA V+SR+ H  R++D  +DP E+DK+PELY S F+  IAPY + +INGIYW P +PRL+T  DA+ LL P K+                     +   GCP+LPH+L+AI DISAD GGSIEF+ ECTTID PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PYI EM+ SNA  P E    SPVV+NAVIAS+G LTP +KYI KLRES+  A+L T  T   K+++L+LGSG+V EP+I+YL +D N++IT     K ++  L+ ++    P  +DI  + E L  LIK H++VVS++P+  H  + K CIK   N+VTASY +P +++  +  EDAGI  + E+GLDPG+DHM+A + FD   + G  + SY SF GGLPAPEFS+NPLRYKFSWSP + L   + PA Y+++G++  I AGG L+ +   M   PG NL+G+PNRDST Y + YG+   HTL+RGTLRYKGF +AM   +Q+GL++  P P L +N P ITW           ++IF+    +  F       F F+    FGL  +  +    + +  ++ +L   L++   ERD++++ +++ ++ P   L+  ++ LVVYGD NG+ AMA TVGYPTAI  KM+LDGE++ +G+V+PL+ +IY P+L+R+K+EGI
Sbjct:   13 ARHHHKAVLAIRREDINAWERRAPLAPKHVKELTSLGYKVLVQPSNRRAIHEKEYIKAGGIIQEDIQEASLIVGVKRPPEE--KLLPKKTYAFFSHTIKAQEANMSLLDEILKMEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINMLHGLGLRFLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKEVSKTGDLRKVYATVLSRHHHLVRKTDGVYDPVEYDKNPELYTSRFNTDIAPYTTCLINGIYWDPHTPRLLTRQDAQRLLAPVKS-------------------STVATEGCPELPHKLLAIGDISADTGGSIEFMTECTTIDMPFCMYDADQHIIHDSVEGCGILMCSIDNLPAQLPIEATEYFGDMLFPYIEEMLMSNATKPMEQQTFSPVVRNAVIASSGSLTPKYKYIQKLRESREHAQLMTQGT---KKKILVLGSGYVSEPVINYLTRDPNVEITAVSMVKDQVDHLSKRYHNTTPIAMDIFKNEEKLSALIKKHDLVVSLLPYSAHPSVAKKCIKNKVNLVTASYISPAMKELQQGAEDAGIIIVGEMGLDPGLDHMLAMECFDKAKDVGAKVESYISFCGGLPAPEFSDNPLRYKFSWSPLAVLFNTVQPATYLKDGQIVNIAAGGSLLESVTAMDCFPGLNLEGFPNRDSTKYAEPYGIQTAHTLMRGTLRYKGFCNAMSGFVQLGLINSDPCPLLGMNAPAITW-----------VNIFSPLTIHLSFV-----TFVFN---RFGLLSEEPVPVADSIVGALAKHLEMMLSFGPGERDMIVLRNDIGIRHPSGHLECKNISLVVYGDVNGYSAMAKTVGYPTAIAAKMVLDGEVESRGLVIPLTKNIYGPILERVKEEGI 893          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Mouse
Match: Aass (aminoadipate-semialdehyde synthase [Source:MGI Symbol;Acc:MGI:1353573])

HSP 1 Score: 954.51 bits (2466), Expect = 0.000e+0
Identity = 462/925 (49.95%), Postives = 641/925 (69.30%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
            V A+RRE +N WERRAPLAPK +K + + G+KVL+QPSNRRA  + EY +AG I+QEDI+EA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD +L+++IRLIDYEKM+D +G R+VAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMH+G+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP E+VEP  L++V   GD +K+Y  V+SR+ H  R++D  +DP E++K+PE Y S F+  IAPY + +INGIYW  ++PRL+T  DA+ LL                       + ++ + GCP+LPH+L+AICDISAD GGSI+F+ ECTTI++PFC+YDA+Q + ++   G G+L+CS+DN+PAQLP  AT++FG +L PY+ EM+ S+A  P E    SPVV++AVI SNG LT  +KYI KLRES+   R+Q L + S K++VL+LGSG+V  P++ YL +D NI+ITLG     ++  L+ K++ +NP  + +      L+ L++S ++V+S++P+  H ++ K CI+   NMVTASY TP +++  K+V+DAGIT + E+GLDPG+DHM+A +  D   E G  + SY S+ GGLPAPE S+NPLRYKFSWSP   LM  + PA Y+ NGKV  +  G   + +   M   PG NL+GYPNRDS  Y + YG+++ HTL+RGTLRYKG++ A+   +++GL++ +  P L      +TWKQ +C  + ++       LK  VF KL  D  +    E  GL  D ++ +  + +   S +L  KL+Y   E+D+++M     ++ P   L+   + LVVYGD NGF AMA TVG PTA+  KM+LDGEI+ KG++ P + +IY P+L+R+K EGI     +TI
Sbjct:   25 VMALRREDVNAWERRAPLAPKHIKGITKLGYKVLIQPSNRRAIHDKEYVRAGGILQEDITEACLILGVKRPPEE--KLMSKKTYAFFSHTIKAQEANMNLLDEVLKQEIRLIDYEKMVDHRGSRIVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHLGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEVFNELPCEYVEPHELREVSKTGDLRKVYGTVLSRHHHLVRKTDGVYDPVEYEKYPERYTSRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLL-------------------VPVKSSVVPVEGCPELPHKLVAICDISADTGGSIDFMTECTTIERPFCMYDADQQIIHDSVEGSGILMCSIDNLPAQLPIEATEYFGDMLYPYVEEMLLSDASQPLESQNFSPVVRDAVITSNGLLTDKYKYIQKLRESRE--RIQFL-SMSTKKKVLVLGSGYVSGPVLEYLSRDNNIEITLGSDMTNQMQQLSKKYN-INPVSLTVGKQEAKLQSLVESQDLVISLLPYVLHPVVAKACIESRVNMVTASYITPAMKELEKSVDDAGITVIGELGLDPGLDHMLAMETIDTAKELGATVESYVSYCGGLPAPEHSDNPLRYKFSWSPVGVLMNIMQPASYLLNGKVVNVTGGVSFLNSVTPMDYFPGLNLEGYPNRDSIKYAEIYGISSAHTLLRGTLRYKGYSKALNGFVKLGLINREAYPALRPEANPLTWKQLLCDLVGISRSSPCEKLKEVVFTKLGGDNTQLEAAEWLGLLGDEQVPQAESIVDAFSKHLVSKLSYGPEEKDMIVMRDSFGIRHPSGHLENKTIDLVVYGDFNGFSAMAKTVGLPTAMAAKMLLDGEIEAKGLMGPFTKEIYGPILERIKAEGIVFNTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Mouse
Match: Aass (aminoadipate-semialdehyde synthase [Source:MGI Symbol;Acc:MGI:1353573])

HSP 1 Score: 134.035 bits (336), Expect = 4.822e-35
Identity = 68/168 (40.48%), Postives = 112/168 (66.67%), Query Frame = 3
Query: 1521 PLHKYIDKLRESKR---SARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFD 2015
            P+H  + K R S +   + R+Q L + S K++VL+LGSG+V  P++ YL +D NI+ITLG     ++  L+ K++ +NP  + +      L+ L++S ++V+S++P+  H ++ K CI+   NMVTASY TP +++  K+V+DAGIT + E+GLDPG+DHM+A +  D
Sbjct:   42 PMHHNLWKARTSPQWCETERIQFL-SMSTKKKVLVLGSGYVSGPVLEYLSRDNNIEITLGSDMTNQMQQLSKKYN-INPVSLTVGKQEAKLQSLVESQDLVISLLPYVLHPVVAKACIESRVNMVTASYITPAMKELEKSVDDAGITVIGELGLDPGLDHMLAMETID 207          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|A8E657|AASS_BOVIN (Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Bos taurus OX=9913 GN=AASS PE=2 SV=1)

HSP 1 Score: 980.319 bits (2533), Expect = 0.000e+0
Identity = 477/926 (51.51%), Postives = 647/926 (69.87%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
             V A+RRE +N WERRAPLAP+ VK +   G+KVL+QPSNRRA  + EY +AG I+QEDISEA LI+GVK+ P +   L+P KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AG+INILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP E+VEP  LK+V  +GD +K+Y  V+SR+ H  R++D  +DP E+DK+PE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P K+P                   +  + GCP LPH+L+AICDISAD GGSIEF+ ECTTI++PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  +T++FG +L PY+ EMI S+A  P E    SPVV++AVIASNG L+  +KYI KLRE++  A+  ++ T   K++VL+LGSG+V EP++ YL +D +I+IT+G   K ++  L  K++ +NP  + +    E L  L+ + ++V+S++P+  H L+ K CI    NM+TASY TP L++  K+VEDAGIT + E+GLDPG+DHM+A +  D   E G  I SY S+ GGLPAPE S+NPLRYKFSWSP   LM  + PA Y+ NGKV     G   + +   M   PG NL+GYPNRDST Y + YG+ + HTL+RGTLRYKG+  A+   +++GL++    P L  +   +TWK+ +C  + ++       LK AVF+KL  D  +   LE  GL  D ++ +  + +  +S +L+ KL+Y   E+D+++M     ++ P   L+   + LVVYGD NGF AMA TVG PTA+  KM+LDGEIQ KG++ P S +IY P+L+R+K EGI     +TI
Sbjct:   24 AVMALRREDVNAWERRAPLAPRHVKGITNLGYKVLIQPSNRRAIHDKEYVKAGGILQEDISEACLILGVKRPPEE--KLMPKKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGIRVVAFGQWAGVAGIINILHGMGLRLLALGHHTPFMHIGMAHNYRNSGQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEYVEPHELKEVSQNGDLRKVYGTVLSRHHHLVRKTDGVYDPVEYDKYPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAPGKSP-------------------VAGVEGCPALPHKLVAICDISADTGGSIEFMTECTTIERPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIESTEYFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVIASNGMLSNKYKYIQKLRENREHAQSLSMGT---KKKVLVLGSGYVSEPVLEYLLRDDSIEITVGSDMKNQIEQLGKKYN-INPVSLHVGKQEEKLSSLVATQDLVISLLPYVLHPLVAKACIASKVNMITASYITPALKELEKSVEDAGITVIGELGLDPGLDHMLAMETIDKAKEVGATIESYVSYCGGLPAPECSDNPLRYKFSWSPVGVLMNIMQPATYLLNGKVVNAVGGVSFLDSVTPMDYFPGLNLEGYPNRDSTKYAEIYGIPSAHTLLRGTLRYKGYAKALSGFVKLGLINRDAFPALQPDANPLTWKELLCDLVGISSSSKCDVLKEAVFKKLGGDTTQLEALEWLGLLGDEQVPQAESLVDALSKHLAVKLSYGPGEKDMIVMRDSFGIRHPSGHLENKTIDLVVYGDVNGFSAMAKTVGLPTAMAAKMLLDGEIQAKGLMGPFSKEIYGPILERIKAEGIMYTTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9UDR5|AASS_HUMAN (Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens OX=9606 GN=AASS PE=1 SV=1)

HSP 1 Score: 966.452 bits (2497), Expect = 0.000e+0
Identity = 476/926 (51.40%), Postives = 633/926 (68.36%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
             V A+RRE +N WERRAPLAPK +K +   G+KVL+QPSNRRA  + +Y +AG I+QEDISEA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD IL+++IRLIDYEKM+D +G RVVAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMHIG+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQ +F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E+DKHPE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL P                   KF+P   + GCP LPH+L+AICDISAD GGSIEF+ ECTTI+ PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT+ FG +L PY+ EMI S+A  P E    SPVV++AVI SNG L   +KYI  LRES+  A+  ++ T   +R+VL+LGSG++ EP++ YL +D NI+IT+G   K ++  L  K++ +NP  +DI    E L  L+   ++V+S++P+  H L+ K CI    NMVTASY TP L++  K+VEDAGIT + E+GLDPG+DHM+A +  D   E G  I SY S+ GGLPAPE S NPLRYKFSWSP   LM  +  A Y+ +GKV  +  G   + A   M   PG NL+GYPNRDST Y + YG+++ HTL+RGTLRYKG+  A+   +++GL++ +  P        +TWKQ +C  + ++       LK AV +KL  D  +    E  GL  D ++ +  + L  +S +L  KL+Y   E+D+++M     ++ P   L+   + LV YGD NGF AMA TVG PTA+  KM+LDGEI  KG++ P S +IY P+L+R+K EGI     +TI
Sbjct:   24 AVLAVRREDVNAWERRAPLAPKHIKGITNLGYKVLIQPSNRRAIHDKDYVKAGGILQEDISEACLILGVKRPPEE--KLMSRKTYAFFSHTIKAQEANMGLLDEILKQEIRLIDYEKMVDHRGVRVVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHIGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQAIFNELPCEYVEPHELKEVSQTGDLRKVYGTVLSRHHHLVRKTDAVYDPAEYDKHPERYISRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLLAP------------------GKFSPA-GVEGCPALPHKLVAICDISADTGGSIEFMTECTTIEHPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATECFGDMLYPYVEEMILSDATQPLESQNFSPVVRDAVITSNGTLPDKYKYIQTLRESRERAQSLSMGT---RRKVLVLGSGYISEPVLEYLSRDGNIEITVGSDMKNQIEQLGKKYN-INPVSMDICKQEEKLGFLVAKQDLVISLLPYVLHPLVAKACITNKVNMVTASYITPALKELEKSVEDAGITIIGELGLDPGLDHMLAMETIDKAKEVGATIESYISYCGGLPAPEHSNNPLRYKFSWSPVGVLMNVMQSATYLLDGKVVNVAGGISFLDAVTSMDFFPGLNLEGYPNRDSTKYAEIYGISSAHTLLRGTLRYKGYMKALNGFVKLGLINREALPAFRPEANPLTWKQLLCDLVGISPSSEHDVLKEAVLKKLGGDNTQLEAAEWLGLLGDEQVPQAESILDALSKHLVMKLSYGPEEKDMIVMRDSFGIRHPSGHLEHKTIDLVAYGDINGFSAMAKTVGLPTAMAAKMLLDGEIGAKGLMGPFSKEIYGPILERIKAEGIIYTTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q99K67|AASS_MOUSE (Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Mus musculus OX=10090 GN=Aass PE=1 SV=1)

HSP 1 Score: 954.51 bits (2466), Expect = 0.000e+0
Identity = 462/925 (49.95%), Postives = 641/925 (69.30%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
            V A+RRE +N WERRAPLAPK +K + + G+KVL+QPSNRRA  + EY +AG I+QEDI+EA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD +L+++IRLIDYEKM+D +G R+VAFGQ+AG+AGMINILHG+G+RLLALGHHTPFMH+G+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP E+VEP  L++V   GD +K+Y  V+SR+ H  R++D  +DP E++K+PE Y S F+  IAPY + +INGIYW  ++PRL+T  DA+ LL                       + ++ + GCP+LPH+L+AICDISAD GGSI+F+ ECTTI++PFC+YDA+Q + ++   G G+L+CS+DN+PAQLP  AT++FG +L PY+ EM+ S+A  P E    SPVV++AVI SNG LT  +KYI KLRES+   R+Q L + S K++VL+LGSG+V  P++ YL +D NI+ITLG     ++  L+ K++ +NP  + +      L+ L++S ++V+S++P+  H ++ K CI+   NMVTASY TP +++  K+V+DAGIT + E+GLDPG+DHM+A +  D   E G  + SY S+ GGLPAPE S+NPLRYKFSWSP   LM  + PA Y+ NGKV  +  G   + +   M   PG NL+GYPNRDS  Y + YG+++ HTL+RGTLRYKG++ A+   +++GL++ +  P L      +TWKQ +C  + ++       LK  VF KL  D  +    E  GL  D ++ +  + +   S +L  KL+Y   E+D+++M     ++ P   L+   + LVVYGD NGF AMA TVG PTA+  KM+LDGEI+ KG++ P + +IY P+L+R+K EGI     +TI
Sbjct:   25 VMALRREDVNAWERRAPLAPKHIKGITKLGYKVLIQPSNRRAIHDKEYVRAGGILQEDITEACLILGVKRPPEE--KLMSKKTYAFFSHTIKAQEANMNLLDEVLKQEIRLIDYEKMVDHRGSRIVAFGQWAGVAGMINILHGMGLRLLALGHHTPFMHLGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEVFNELPCEYVEPHELREVSKTGDLRKVYGTVLSRHHHLVRKTDGVYDPVEYEKYPERYTSRFNTDIAPYTTCLINGIYWEQNTPRLLTRQDAQSLL-------------------VPVKSSVVPVEGCPELPHKLVAICDISADTGGSIDFMTECTTIERPFCMYDADQQIIHDSVEGSGILMCSIDNLPAQLPIEATEYFGDMLYPYVEEMLLSDASQPLESQNFSPVVRDAVITSNGLLTDKYKYIQKLRESRE--RIQFL-SMSTKKKVLVLGSGYVSGPVLEYLSRDNNIEITLGSDMTNQMQQLSKKYN-INPVSLTVGKQEAKLQSLVESQDLVISLLPYVLHPVVAKACIESRVNMVTASYITPAMKELEKSVDDAGITVIGELGLDPGLDHMLAMETIDTAKELGATVESYVSYCGGLPAPEHSDNPLRYKFSWSPVGVLMNIMQPASYLLNGKVVNVTGGVSFLNSVTPMDYFPGLNLEGYPNRDSIKYAEIYGISSAHTLLRGTLRYKGYSKALNGFVKLGLINREAYPALRPEANPLTWKQLLCDLVGISRSSPCEKLKEVVFTKLGGDNTQLEAAEWLGLLGDEQVPQAESIVDAFSKHLVSKLSYGPEEKDMIVMRDSFGIRHPSGHLENKTIDLVVYGDFNGFSAMAKTVGLPTAMAAKMLLDGEIEAKGLMGPFTKEIYGPILERIKAEGIVFNTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|A2VCW9|AASS_RAT (Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Aass PE=2 SV=1)

HSP 1 Score: 954.125 bits (2465), Expect = 0.000e+0
Identity = 464/925 (50.16%), Postives = 641/925 (69.30%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTI 2936
            V A+RRE +N WERRAPLAPK +K + + G+KVL+QPSNRRA  + EY +AG I+QEDI+EA LI+GVK+ P +   L+  KT+AFFSHTIKAQE NM LLD +L+++IRLIDYEKM+D +G R+VAFG +AG+AGMINILHG+G+RLLALGHHTPFMH+G+AHNYR    A QA+RD GY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP E+VEP  LK+V   GD +K+Y  V+SR+ H  R++D  +DP E++K+PE YIS F+  IAPY + +INGIYW  ++PRL+T  DA+ LL                       + ++ + GCP+LPH+L+AICDISAD GGSI+F+ ECTTI++PFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG +L PY+ EM+ S+A  P E    SPVV++AVI SNG LT  +KYI KLRES+   R+Q L + S K++VL+LGSG+V  P++ YL +  NI+ITLG     ++  L+ K+D +N   + +    + L+ L++S ++V+S++P+  H ++ K CI    NMVTASY TP +++  K+V+DAGIT + E+GLDPG+DHM+A +  D   + G  I SY S+ GGLPAPE S+NPLRYKFSWSP   LM  + PA Y+ NGKV  +  G   + +   M   PG NL+GYPNRDST Y + YG+++ HTL+RGTLRYKG++ A+   +++GL++ +  P L      +TWKQ +C  + ++       LK  VF KL  D  +    E  GL  D ++ +  + +   S +L  KL+Y   E+D+++M     ++ P   L+   + LVVYGD NGF AMA TVG PTA+  KM+LDGEI+ KG++ P S +IY P+L+R+K EGI     +TI
Sbjct:   25 VMALRREDVNAWERRAPLAPKHIKGITKLGYKVLIQPSNRRAIHDKEYVRAGGILQEDITEACLILGVKRPPEE--KLMSKKTYAFFSHTIKAQEANMSLLDEVLKQEIRLIDYEKMVDHRGSRIVAFGHWAGVAGMINILHGMGLRLLALGHHTPFMHLGMAHNYRNSSQAVQAVRDAGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEVFNELPCEYVEPHELKEVSKTGDLRKVYGTVLSRHHHLVRKTDGVYDPVEYEKYPERYISRFNADIAPYTTCLINGIYWEQNTPRLLTRQDAQSLL-------------------VPVKSSVVPVEGCPELPHKLVAICDISADTGGSIDFMTECTTIERPFCMYDADQHIIHDSVEGSGILMCSIDNLPAQLPIEATEYFGDMLYPYVEEMLLSDASQPLESQNFSPVVRDAVITSNGLLTDKYKYIQKLRESRE--RIQFL-SMSTKKKVLVLGSGYVSGPVLEYLSRGNNIEITLGSDMTNQMQQLSKKYD-INTVNVTVGKQEDKLQSLVESQDLVISLLPYVLHPVVAKACIDSKVNMVTASYITPAMKELEKSVDDAGITVIGELGLDPGLDHMLAMETIDKAKDLGATIESYVSYCGGLPAPEHSDNPLRYKFSWSPVGVLMNIMQPASYLLNGKVVNVTGGVSFLNSVTPMDYFPGLNLEGYPNRDSTKYAEIYGISSAHTLLRGTLRYKGYSKALNGFVKLGLINRETYPALRPEANPLTWKQLLCDLVGISRSSSCEKLKEVVFTKLGGDSTQLEAAEWLGLLGDEQVPQAESIVDAFSKHLVSKLSYGPEEKDMIVMRDSFGIRHPSGHLENKTIDLVVYGDFNGFSAMAKTVGLPTAMAAKMLLDGEIETKGLMGPFSKEIYGPILERIKAEGIVFNTQSTI 924          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Match: sp|Q9SMZ4|AASS_ARATH (Alpha-aminoadipic semialdehyde synthase OS=Arabidopsis thaliana OX=3702 GN=LKR/SDH PE=1 SV=1)

HSP 1 Score: 314.694 bits (805), Expect = 8.718e-90
Identity = 196/574 (34.15%), Postives = 301/574 (52.44%), Query Frame = 3
Query:  156 SGVFAIRRESINLWERRAPLAPKQVKQLVQDG------FKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHL-------KDVCIHGDTKK----IYACVVSRNDHYRRRS-DNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTL--KTTSGKR--QVLILGSGHVVEPLISYLGKDQNIQITLGGA---EKAELLSLADKFDYVNPELIDIVTDNELLEKLIKS 1802
            +GV  I  E++N WERR PL P    +L+  G       +++VQPS +R + +  Y+  G  + +D+S+  LI+G+K+  L+ I  +P + +AFFSHT KAQ++NM LLD IL  ++ L DYE ++ D G+R++AFG+YAG AG+++ LHG+G R L LG+ TPF+ +G ++ Y ++  AK A+   G  IA   +P  I PL FVFTGTGNVS GAQE+F  LP+ FVEP  L       K +  +G + K    +Y C+++  D    +     FD  ++  HPE Y   F + I+PY SV++N +YW    P L++    + L +                             G P     L+ ICDI+ D GGSIEFV   T ID PF  ++   N   +   G GVL  +VD +P +  + A+  FG +L  ++  +    + T   D      +K A I+  GELT L++YI ++R+S        +     S +R   +L+  SGH+ +  +  + +  ++    GG+    K EL   AD   Y   EL     D  +L+++I S
Sbjct:   14 NGVVGILAETVNKWERRTPLTPSHCARLLHGGKDRTGISRIVVQPSAKRIHHDALYEDVGCEISDDLSDCGLILGIKQPELEMI--LPERAYAFFSHTHKAQKENMPLLDKILSERVTLCDYELIVGDHGKRLLAFGKYAGRAGLVDFLHGLGQRKLILGYSTPFLSLGASYMYSSLAAAKAAVISVGEEIASQGLPLGICPLVFVFTGTGNVSLGAQEIFKLLPHTFVEPSKLPELFVKDKGISQNGISTKRVYQVYGCIITSQDMVEHKDPSKSFDKADYYAHPEHYNPVFHEKISPYTSVLVNCMYWEKRFPCLLSTKQLQDLTK----------------------------KGLP-----LVGICDITCDIGGSIEFVNRATLIDSPFFRFNPSNNSYYDDMDGDGVLCMAVDILPTEFAKEASQHFGDILSGFVGSLA---SMTEISDLPAH--LKRACISYRGELTSLYEYIPRMRKSNPEEAQDNIIANGVSSQRTFNILVSLSGHLFDKFL--INEALDMIEAAGGSFHLAKCELGQSADAESY--SELEVGADDKRVLDQIIDS 543          

HSP 2 Score: 233.032 bits (593), Expect = 8.433e-62
Identity = 159/480 (33.12%), Postives = 258/480 (53.75%), Query Frame = 3
Query: 1599 KRQVLILGSGHVVEPLISYLGKDQNIQI-----TLGGAEKAE---------LLSLADKFDYV----NPELIDI-VTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSI--LPGFNLQGYPNRDSTAYVKKYGL-TNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLED-----------FGLFKDNEIEKKGTPLATISHYL-SQKLAYEKNERDVVIMAHEVLVKWPENK-LKKLDVRLVVYGD-PNG--FMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIME 2924
            K  VLILG+G V  P   +L   + I       T  GA+  E          L L D  + V    + E + + V+D+E L K +   ++V+S++P   H ++ K CI+  +++VTASY   +     +  + AGIT L E+GLDPGIDHM+A  + +D       + S+ S+ GGLP+P  + NPL YKFSW+P  A+    NPAKY  NG +  +  G +L  ++ +  +  LP F L+ +PNRDS  Y + YG+ +   T+ RGTLRY+GF+  M +L ++G    + +  L   G +IT+   +   +  + D  +  L  A  E++++   K    ++            G  ++ E+      +   + YL  +KLAY  NE+D+V++ HEV V++ E+K ++K    L+ +GD  NG    AMA TVG P AIG  ++++ +I+ +G++ PL  ++Y P L  L+  GI++ME
Sbjct:  586 KSGVLILGAGRVCRPAADFLASVRTISSQQWYKTYFGADSEEKTDVHVIVASLYLKDAKETVEGISDVEAVRLDVSDSESLLKYVSQVDVVLSLLPASCHAVVAKTCIELKKHLVTASYVDDETSMLHEKAKSAGITILGEMGLDPGIDHMMAMKMINDAHIKKGKVKSFTSYCGGLPSPAAANNPLAYKFSWNPAGAIRAGQNPAKYKSNGDIIHVD-GKNLYDSAARFRVPNLPAFALECFPNRDSLVYGEHYGIESEATTIFRGTLRYEGFSMIMATLSKLGFFDSEANQVLS-TGKRITFGALLSNILNKDADNESEPL--AGEEEISKRIIKLGHSKETAAKAAKTIVFLGFNEEREVPSLCKSVFDATCYLMEEKLAYSGNEQDMVLLHHEVEVEFLESKRIEKHTATLLEFGDIKNGQTTTAMAKTVGIPAAIGALLLIEDKIKTRGVLRPLEAEVYLPALDILQAYGIKLME 1061          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Match: A0A267E7W7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig011681g1 PE=4 SV=1)

HSP 1 Score: 1148.27 bits (2969), Expect = 0.000e+0
Identity = 540/941 (57.39%), Postives = 704/941 (74.81%), Query Frame = 3
Query:  123 FIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLL-QPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
             +  +    G + V A+RRE+INLWERRAPL+P  V++LV+DG KV+VQPSNRRA+T  EY QAGAI+QED+SEA +IIGVK VPLD  +L+P+KT+AFFSHTIKAQE+NM LLDT+LER IRL+DYEKM+D  G+R VAFG+YAGI GMINIL+G+GIRLLALGHHTPFMHIG AHNYR++EMAKQA+RD GY I+LGNMPKS+GP+ FVFTG+GNVSQG+Q++F DLP+E VE +HL ++  HG T K+Y CV SR DH R R    FDPE++ +HPE YIS FSK +APYASVIINGIYW PSSPRLI+IPDAK LL + + +PW  +                   PGCP LPHR++AICDIS DPGGSIEF+KE TTIDKPFCLYDAEQNMS ++F GPGV++C+VDNMPAQ+PR +T+FFGSLL+PYIY+++ SNA+  F D+  SPVVKNAVI SNG LTP  +YI  LR++KR  + +T      K +VL+LG+GHV  P+I YL +D  ++ITL    +A++ S+A KF+  +P   D+ T  + +EKLIK H + +S++P+  H  +L  C++  R++VTASY TP+L +     ++ G+   ME GLDPGIDHM+A +  + + E G  + S+ S+ GGLPAPE S+NPLRYKFSWSPE AL++ LN A+Y++ GK+ EI  GG LMLA++ +   PGFNL+GYPNRDS  Y   YG+ +   ++RGTLRY G++++ W LIQ+GLLS  P P LH +GP++TW+Q +C  +    DIF GTLK+AVF +L +D+ KF C++  GLF+D+ ++K+ TPLATIS  LS+K  Y+ +E DVVIM  ++  ++P N  +   + +V YGDPNG+ AMA TVGYPTAI  KMIL+ EIQ KG+VLPLS++IYRP+LKRLK EGI  +  TT  D
Sbjct:   15 LLSSFVDNHGTNQVLAMRRETINLWERRAPLSPNHVRKLVKDGVKVIVQPSNRRAFTHNEYLQAGAIIQEDLSEAPVIIGVKPVPLDFQSLMPDKTYAFFSHTIKAQEENMPLLDTLLERNIRLLDYEKMVDGHGKRTVAFGKYAGIVGMINILNGVGIRLLALGHHTPFMHIGPAHNYRSVEMAKQAVRDTGYEISLGNMPKSLGPMVFVFTGSGNVSQGSQDIFRDLPFEMVEVDHLPEIVKHGSTSKVYGCVCSRVDHLRHRETGKFDPEDYGQHPERYISLFSKKVAPYASVIINGIYWGPSSPRLISIPDAKVLLREQDHSPWLETA------------------PGCPTLPHRMLAICDISCDPGGSIEFMKEITTIDKPFCLYDAEQNMSYDQFSGPGVIICAVDNMPAQMPRESTEFFGSLLMPYIYDIMSSNAKQSFNDWNASPVVKNAVITSNGSLTPNFEYITGLRQAKRQKQQRTSSKEPAKNRVLVLGAGHVSAPMIEYLTRDGGVEITLASNVRADVESIATKFN-CHPVFADLHTQPDEVEKLIKDHTLTISLLPYANHARVLSMCLRAKRHLVTASYVTPELRELCNEAKELGLIVSMENGLDPGIDHMLAMEAIESIKEHGGTVDSFLSYCGGLPAPEHSDNPLRYKFSWSPEGALLSTLNAARYLKAGKIVEIPKGGHLMLAAQDIEFFPGFNLEGYPNRDSLHYKDLYGIQSAKNILRGTLRYAGYSNSAWGLIQLGLLSDAPHPSLHPDGPEVTWRQLLCFLVGKPQDIFVGTLKDAVFNRLGKDREKFECVDALGLFEDDVVKKRTTPLATISTLLSEKFKYKPHETDVVIMVLDISSRFPNNTAENHKISMVKYGDPNGYSAMALTVGYPTAIVTKMILEEEIQDKGLVLPLSMNIYRPVLKRLKAEGISAVVKTTEYD 936          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Match: A0A267GKZ9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019791g1 PE=4 SV=1)

HSP 1 Score: 1118.99 bits (2893), Expect = 0.000e+0
Identity = 522/936 (55.77%), Postives = 698/936 (74.57%), Query Frame = 3
Query:  135 YGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLL--QPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSG-KRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTT 2933
            +  R     V AIRRE+INLWERRAPL+P  V++LV++G KV+VQPSNRRA+T  EY QAGA++QED+SEA +IIGVK VPLD+ +L+PNKT+AFFSHTIKAQE+NM LLDT+LER +RL+DYEKM++  G+R+VAFG+YAGI GMINIL+G+GIRLLALGHHTPFMHIG AHNYR++EMAKQA+RD GY I+LGN+PKSIG +  VFTG+GNVSQGAQ++F +LP+E V+ +HL D+  HG + KIY CV SR+DH R R    FDPE++ ++P+ YIS F+K +APYASVI+NGIYW P  PRLI++PDAK LL  Q + +PW  S                    GCP+LPHR++AICDIS DPGGSIEF+KE TTIDKPFCLYDAEQNMS + F GPGV++C+VDNMPAQ+PR +T+FFGSLL+PY+Y+++ S+A+ PF+ ++  P+VKNAVI SNG LTP  +YI +LR++KR       ++    K ++L+LGSGHV  PL+ YL +D ++QIT+    +A++ S+A K++   P   D+ +  +++E LI  H +VVS++P+++H  +LK C++  RN+VTASY T ++ + SK  ++ GIT  ME GLDPGIDH++A +  + + E G  I  + S+ GGLPAP+ S NPLRYKFSWSPE AL++ LN ++Y+++GK+ EI  GG LMLA++ +   PGFNL+GYPNRDS  Y   YG+ +  TL+RGTLRY+G+++A W LIQ+GLLS  P   LH  GP ITWKQ +C+ +    DIF GTLK+AVF K+  D+ KF C+E+ GLF+D  IEK+ TPL++IS  L++KL Y   E DV+IM  ++  ++P    +   + LV YGDP  + AM+ TVGY TAI  KM+LD EIQ +G+VLPLS++IYRP+LKRLK EGI  +  TT
Sbjct:   21 FAGRGNAKKVLAIRRETINLWERRAPLSPNHVRKLVKEGLKVIVQPSNRRAFTHNEYLQAGAVIQEDLSEAPVIIGVKSVPLDYQSLMPNKTYAFFSHTIKAQEENMPLLDTLLERNVRLLDYEKMVNPGGKRIVAFGKYAGIVGMINILNGLGIRLLALGHHTPFMHIGPAHNYRSVEMAKQAVRDTGYEISLGNLPKSIGNMVVVFTGSGNVSQGAQDIFRELPFEMVQVDHLPDIVKHGSSSKIYGCVCSRSDHIRHRQTGKFDPEDYAQNPQNYISLFAKKVAPYASVIVNGIYWDPKLPRLISVPDAKLLLREQQDHSPWLESSA------------------GCPQLPHRMLAICDISCDPGGSIEFMKEITTIDKPFCLYDAEQNMSYDHFSGPGVIICAVDNMPAQMPRESTEFFGSLLMPYVYDIMSSDAKQPFDKWEADPIVKNAVITSNGSLTPNFEYIAELRDAKRKQSAGRARSRQAVKHRLLVLGSGHVAGPLVEYLQRDASLQITIASNIRADVESMASKYN-CQPVFADVSSQPDVIEGLIADHSLVVSLLPYRFHPRVLKMCLRARRNLVTASYATDEMRELSKEAKEVGITVSMENGLDPGIDHLLAMEAIESIKEHGGIIDKFISYCGGLPAPQHSTNPLRYKFSWSPEGALLSTLNASRYLKSGKIVEIPRGGHLMLAAQDIEYFPGFNLEGYPNRDSLHYRDLYGIESAQTLLRGTLRYRGYSNAAWGLIQLGLLSDTPHASLHPEGPDITWKQLLCQLLGKPRDIFVGTLKDAVFAKVGRDREKFQCIEELGLFEDKLIEKRHTPLSSISCMLAEKLKYNPGETDVIIMVLDLSCRFPNGTRENHVISLVKYGDPKAYSAMSLTVGYQTAIAAKMLLDEEIQDRGLVLPLSMNIYRPILKRLKAEGISAVAKTT 937          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Match: A0A3S0ZSG2 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_007513 PE=4 SV=1)

HSP 1 Score: 1106.66 bits (2861), Expect = 0.000e+0
Identity = 510/926 (55.08%), Postives = 692/926 (74.73%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIM 2939
            V AIRRE++N+WERRAPL+P QV+ LV+ G KV+VQPS+RRAY+  EY   GA++ ED+SEASLI+GVK+VP+D   L+ +KT+AFFSHTIKAQ DNM LLD ILE+ IRLIDYEKM+D+ G RVVAFG+YAG+AGMINILHG+G+RLLALGHHTPFMHIG +HNYR  EMA+QA+RD GY I+LG MPKS+GP+TF+FTG+GNVSQGAQE+F +LP+E++EPEHL  V + G   K+YACVVSR+DHY R+    FDPEEF+++PE Y STFS  IAPYAS IINGIYWA  +PRLITIP+AK LL+P   PW PS                   PGCP LPHRL+AICDISADPGGSIEF+KECTTIDKPF LYDAEQN+  E F G GVL+CS+DNMPAQ+PR AT++FGSLL PYI + + S+A++ FED++ S +VKNAVIASNG+LTP ++YI +LR+ K        K   G  +VL+LG+G+V  P + YL +  +  +TL    + +L  L  +F  V+P L+D+ TD E L++L+  H++V+S++P+  H  + + CIK  +NMVTASY +P +++  K  +DAGIT + EVG+DPGIDHM+A   FD++  +G  I SY S+ GGLPAPE ++ PL YKF+W P+  L+  L+PAKY+++G V EI +GG L+ A + +  +PGFN++GYPNRDST Y ++YG+ + +TLIRGT+RYKG+ +A+ SL+ MGL    PD  LH +GP+ITWKQ+MC + + + DI   +LK+ ++E+L++D+ K  C+ + GL  ++ I+KK +P+ T+S+YL++KLAY  +ERD+++M H+V ++W + K +   +  V YGDP    AMA TVG PT I  +MIL+GEIQ KG+  P+ ++IY+P+L+RL+KEG+  +E   ++
Sbjct:   63 VIAIRRETVNVWERRAPLSPNQVRSLVKSGVKVIVQPSDRRAYSMKEYSDIGAVILEDMSEASLIMGVKQVPVD--CLMRDKTYAFFSHTIKAQADNMPLLDAILEKNIRLIDYEKMVDENGARVVAFGKYAGVAGMINILHGMGLRLLALGHHTPFMHIGPSHNYRNTEMARQAVRDAGYEISLGRMPKSVGPMTFIFTGSGNVSQGAQEVFQELPHEYIEPEHLPKVAVQGSINKLYACVVSRDDHYTRKKGGKFDPEEFEQYPERYASTFSHNIAPYASCIINGIYWAVGAPRLITIPEAKTLLRPTDAPWLPSS------------------PGCPNLPHRLLAICDISADPGGSIEFMKECTTIDKPFSLYDAEQNVDKESFAGDGVLICSIDNMPAQIPREATEYFGSLLFPYINDFLASDAKSSFEDYQCSSIVKNAVIASNGKLTPSYEYITELRQ-KNITSSHKAKLVPGGERVLVLGAGYVSAPAVEYLTRTSSTSVTLASQYQQDLDVLTKQFPDVSPVLMDLATDMEELDRLVGDHDLVISLLPYMLHPEVARLCIKHKKNMVTASYISPAMKELHKQAKDAGITIMNEVGVDPGIDHMLAMQCFDEVQRAGGKITSYVSYCGGLPAPEHTDTPLLYKFNWFPKGVLLNVLSPAKYLKDGTVVEIPSGGALLDAVEDLDFMPGFNIEGYPNRDSTIYAQEYGIDSANTLIRGTIRYKGYMEAVRSLVNMGLFESDPDASLHPDGPEITWKQYMCTKFDKSGDILADSLKDLIYERLDKDETKLKCIVNLGLISEDVIDKKSSPIDTLSNYLAKKLAYGAHERDMILMRHDVGIEWGDRKKEHRSINFVSYGDPGKTSAMAKTVGVPTGIAARMILNGEIQTKGVCGPMKIEIYQPILQRLEKEGLRAVEEIKLL 967          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Match: A0A1S3JRD0 (alpha-aminoadipic semialdehyde synthase, mitochondrial isoform X1 OS=Lingula unguis OX=7574 GN=LOC106175203 PE=4 SV=1)

HSP 1 Score: 1105.12 bits (2857), Expect = 0.000e+0
Identity = 526/937 (56.14%), Postives = 680/937 (72.57%), Query Frame = 3
Query:  132 KYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            K  S    S   AIRRE +NLWERRAPLAP  V+QL ++G KVL+QPSNRRAY   EY+ AGAI QEDISEA LI+GVK+VP+D   LIPNKT+ FFSHTIKAQEDNM LLD +LE+ IRLIDYEKML+  G R+VAFG+YAG+AGM+NILHG+G RLLALGHHTPFMHI   H+YR    A+QAIRD GY IALG MPKSIGPLTFVFTG+GNVSQGAQE+F +LP+E+V PE L  V  HG T K+Y C V+  DH  R+    FD EEF KHPE Y S F+K IAPYAS+I+NGIYW  + PRLITIPDAK LL+P   PW P+V                   GCP+LPH L+AICDISAD  GSIEFV ECTTID+PF LYDA+QN   E F GPGVLVCS+DNMPAQ+P  +TDFFGSLL PYI++M+ SNA TPFE++KV+PVV++AVI SNG+LTP  +YI KLRE  RSA   +     G ++VL LG+G+V  P++ YL +D  +++T+    ++E+ +LA KF   +P L D++   E LEKL+ SH++V+S++P+ YH  + K CI   +NMVTASY + ++    ++  DAGIT + EVG+DPGIDHM+A + FD+++E G  + S+ S+ GGLPAPE S NPLRY+FSWSP   L+  ++ AKY+ NGK  EI+ GG+L+ A+  +S LPGFNL+G+PNRDS AY   YGL ++ T++RGT+RY GF++A   L+Q+GL+   P P LH  GP+ITW+  MC+      DI   +L + + +K    + +   +++ GL +D  I+KK TPL T+SHYL+Q+L +E+ ERDV+IM H+V ++WP+   +   + LVVYGDP G+ AMA TVG PT I  +MILDGEIQ+KG++ PL+V +YRPMLKRL++EGI   ET+ ++D
Sbjct:   21 KISSVRSASSCLAIRREDVNLWERRAPLAPSHVRQLTKEGVKVLLQPSNRRAYPTKEYENAGAISQEDISEADLILGVKQVPID--KLIPNKTYVFFSHTIKAQEDNMPLLDALLEKNIRLIDYEKMLNKDGLRLVAFGKYAGVAGMLNILHGLGFRLLALGHHTPFMHISPPHHYRNSGSARQAIRDAGYEIALGLMPKSIGPLTFVFTGSGNVSQGAQEVFRELPHEYVSPEALPKVAKHGATNKVYGCEVNMWDHLVRKEGGKFDMEEFLKHPERYGSNFAKKIAPYASIIVNGIYWDNTQPRLITIPDAKTLLKPTSLPWLPNVV------------------GCPQLPHHLLAICDISADRDGSIEFVSECTTIDRPFVLYDADQNTERESFHGPGVLVCSIDNMPAQIPNESTDFFGSLLFPYIHDMLSSNATTPFEEYKVTPVVRDAVITSNGKLTPKFEYIAKLREVSRSAHKVSSAKKMGNKKVLCLGAGYVSAPVVDYLTRDPKVEVTVVSHLRSEVDALASKFKNSHPVLCDVMNHKEELEKLVSSHDLVISLLPYVYHPEVAKVCIMNKKNMVTASYMSKEMTDLEQSAVDAGITVVNEVGVDPGIDHMLAMECFDNVTEKGGKVASFVSWCGGLPAPELSANPLRYRFSWSPRGVLLNTISEAKYLLNGKTVEIQPGGELLQAAMPLSFLPGFNLEGFPNRDSIAYKGIYGLDSLRTILRGTVRYTGFSNAAAGLVQIGLIDTTPHPSLHPLGPEITWRHLMCELCGKPHDILLDSLHSLILQKTGGSEARLQAIQELGLLEDEVIDKKNTPLDTLSHYLAQRLKFERGERDVIIMRHDVGIEWPDLTKEVKQIDLVVYGDPEGYTAMAKTVGLPTGIAARMILDGEIQQKGMLRPLNVSMYRPMLKRLQQEGIVARETSKVVD 937          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Match: A0A1S3JQA6 (alpha-aminoadipic semialdehyde synthase, mitochondrial isoform X2 OS=Lingula unguis OX=7574 GN=LOC106175203 PE=4 SV=1)

HSP 1 Score: 1103.58 bits (2853), Expect = 0.000e+0
Identity = 524/929 (56.40%), Postives = 678/929 (72.98%), Query Frame = 3
Query:  156 SGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            S   AIRRE +NLWERRAPLAP  V+QL ++G KVL+QPSNRRAY   EY+ AGAI QEDISEA LI+GVK+VP+D   LIPNKT+ FFSHTIKAQEDNM LLD +LE+ IRLIDYEKML+  G R+VAFG+YAG+AGM+NILHG+G RLLALGHHTPFMHI   H+YR    A+QAIRD GY IALG MPKSIGPLTFVFTG+GNVSQGAQE+F +LP+E+V PE L  V  HG T K+Y C V+  DH  R+    FD EEF KHPE Y S F+K IAPYAS+I+NGIYW  + PRLITIPDAK LL+P   PW P+V                   GCP+LPH L+AICDISAD  GSIEFV ECTTID+PF LYDA+QN   E F GPGVLVCS+DNMPAQ+P  +TDFFGSLL PYI++M+ SNA TPFE++KV+PVV++AVI SNG+LTP  +YI KLRE  RSA   +     G ++VL LG+G+V  P++ YL +D  +++T+    ++E+ +LA KF   +P L D++   E LEKL+ SH++V+S++P+ YH  + K CI   +NMVTASY + ++    ++  DAGIT + EVG+DPGIDHM+A + FD+++E G  + S+ S+ GGLPAPE S NPLRY+FSWSP   L+  ++ AKY+ NGK  EI+ GG+L+ A+  +S LPGFNL+G+PNRDS AY   YGL ++ T++RGT+RY GF++A   L+Q+GL+   P P LH  GP+ITW+  MC+      DI   +L + + +K    + +   +++ GL +D  I+KK TPL T+SHYL+Q+L +E+ ERDV+IM H+V ++WP+   +   + LVVYGDP G+ AMA TVG PT I  +MILDGEIQ+KG++ PL+V +YRPMLKRL++EGI   ET+ ++D
Sbjct:    4 SSCLAIRREDVNLWERRAPLAPSHVRQLTKEGVKVLLQPSNRRAYPTKEYENAGAISQEDISEADLILGVKQVPID--KLIPNKTYVFFSHTIKAQEDNMPLLDALLEKNIRLIDYEKMLNKDGLRLVAFGKYAGVAGMLNILHGLGFRLLALGHHTPFMHISPPHHYRNSGSARQAIRDAGYEIALGLMPKSIGPLTFVFTGSGNVSQGAQEVFRELPHEYVSPEALPKVAKHGATNKVYGCEVNMWDHLVRKEGGKFDMEEFLKHPERYGSNFAKKIAPYASIIVNGIYWDNTQPRLITIPDAKTLLKPTSLPWLPNVV------------------GCPQLPHHLLAICDISADRDGSIEFVSECTTIDRPFVLYDADQNTERESFHGPGVLVCSIDNMPAQIPNESTDFFGSLLFPYIHDMLSSNATTPFEEYKVTPVVRDAVITSNGKLTPKFEYIAKLREVSRSAHKVSSAKKMGNKKVLCLGAGYVSAPVVDYLTRDPKVEVTVVSHLRSEVDALASKFKNSHPVLCDVMNHKEELEKLVSSHDLVISLLPYVYHPEVAKVCIMNKKNMVTASYMSKEMTDLEQSAVDAGITVVNEVGVDPGIDHMLAMECFDNVTEKGGKVASFVSWCGGLPAPELSANPLRYRFSWSPRGVLLNTISEAKYLLNGKTVEIQPGGELLQAAMPLSFLPGFNLEGFPNRDSIAYKGIYGLDSLRTILRGTVRYTGFSNAAAGLVQIGLIDTTPHPSLHPLGPEITWRHLMCELCGKPHDILLDSLHSLILQKTGGSEARLQAIQELGLLEDEVIDKKNTPLDTLSHYLAQRLKFERGERDVIIMRHDVGIEWPDLTKEVKQIDLVVYGDPEGYTAMAKTVGLPTGIAARMILDGEIQQKGMLRPLNVSMYRPMLKRLQQEGIVARETSKVVD 912          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Cavefish
Match: aass (aminoadipate-semialdehyde synthase [Source:NCBI gene;Acc:103040216])

HSP 1 Score: 1009.98 bits (2610), Expect = 0.000e+0
Identity = 473/928 (50.97%), Postives = 665/928 (71.66%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            GV  IRRE +N+WERRAPLAP+ VK++  +G+KVLVQPSNRRA  +  Y++AGAI+QEDISEASLI+GVK+ P + +  IP+KT+AFFSHTIKAQE NM LLD IL++ +RLIDYEKM+D+ G R+VAFG++AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  + QA+RDCGY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LKDVC  GD  K+Y  V+SR  H  R+SD  +DP E++ HPE Y S F   IAPY + +INGIYW P +PRL+   DA+ L++P K   +                    I GCP+LPH+ +AICDISAD GGSIEF+ ECTTI+KPFC+YD ++++ ++   G G+L+CS+DN+PAQLP  AT++FG  LLPY++EM+ S+A  P +D   +P VK+AVI SNG+L P  +YI+KLRE + S   Q LK   G ++VL+LGSG+V  P+I YL +D   Q+T+     ++   LA  +    P ++D+ +    LE L+K H++V+SM+P+ YH L+ KHCI +  N+VTASY +P++++  ++ E+AGIT + E+GLDPGIDHM+A +  D     G  + S+ S+ GGLPAPE SENPLRYKFSWSP   L+  ++PA Y++N +V  I AGG L+ ++  M  LPGFNL+G+PNRDST Y + YG+ +  +L+RGTLR+KGF+ AM   +++G+++  P P L+     I+WK+ +C+ +++   + + +++  VF  +  D+F+   L   G+  D  + + GT LA+++ +L  KLAYEKNERD++IM ++V ++ P  +L+   + LVVYGDP GF AMA TVGYP AI  +M+L+GE+  KG+V+P++ +IY P+LK L++EG++ +  +T+ +
Sbjct:   27 GVMGIRREDVNVWERRAPLAPRHVKEITAEGYKVLVQPSNRRAIHDRYYEKAGAILQEDISEASLIVGVKRPPEEKV--IPHKTYAFFSHTIKAQEPNMGLLDDILKKNVRLIDYEKMVDENGFRIVAFGKWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQSVQAVRDCGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKDVCESGDRTKVYGTVISRRHHLIRKSDGLYDPFEYEHHPERYTSHFRSTIAPYTTCLINGIYWDPHTPRLLRRLDAQKLMKPSKLSSY-------------------SIEGCPELPHKFLAICDISADTGGSIEFMTECTTIEKPFCMYDPKKHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLLPYVWEMLPSDATRPLDDEGFTPQVKDAVITSNGKLAPKFEYIEKLRERRESE--QILKK-GGMKRVLLLGSGYVSGPVIEYLTRDVATQVTVASVLLSQAEELAALYPNTIPVMLDVSSQEGHLESLVKDHDLVISMLPYSYHPLVAKHCINKKVNLVTASYLSPEMKELQRSAEEAGITIVNEMGLDPGIDHMLAMECIDQAKADGCTVESFSSYCGGLPAPECSENPLRYKFSWSPYGVLLNTISPAVYLKNNQVVSIPAGGSLLESTVSMDFLPGFNLEGFPNRDSTKYAEAYGIESAQSLVRGTLRFKGFSHAMSGFVKLGMINTDPSPLLNPAASPISWKELLCRLLDLPSSVSSDSVEEVVFNHIGRDEFRMQTLRWLGMLSDEAVPQCGTILASLAKHLETKLAYEKNERDMIIMRNDVGIRHPTGELETKHISLVVYGDPKGFSAMAKTVGYPAAIVARMLLNGELNTKGLVVPMTKNIYAPILKTLQEEGLQFITKSTVTE 930          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Cavefish
Match: aass (aminoadipate-semialdehyde synthase [Source:NCBI gene;Acc:103040216])

HSP 1 Score: 975.311 bits (2520), Expect = 0.000e+0
Identity = 468/928 (50.43%), Postives = 653/928 (70.37%), Query Frame = 3
Query:  159 GVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            GV  IRRE +N+WERRAPLAP+ VK++  +G+KVLVQPSNRRA  +  Y++AGAI+QEDISEASLI+GVK+ P + +  IP+KT+AFFSHTIKAQE NM LLD IL++ +RLIDYEKM+D+ G R+VAFG++AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  + QA+RDCGY I+LG MPKSIGPLTFVFTGTGNVS+GAQE+F +LP EFVEP  LKDVC  GD  K+Y  V+SR  H  R+SD  +DP E++ HPE Y S F   IAPY + +INGIYW P +PRL+   DA+ L++P K   +                    I GCP+LPH+ +AICDISAD GGSIEF+ ECTTI+KPFC+YD ++++ ++   G G+L+CS+DN+PAQLP  AT++FG  LLPY++EM                 V  AVI SNG+L P  +YI+KLRE + S   Q LK   G ++VL+LGSG+V  P+I YL +D   Q+T+G   +AE   LA  +    P ++D+ +    LE L+K H++V+SM+P+ YH L+ KHCI +  N+VTASY +P++++  ++ E+AGIT + E+GLDPGIDHM+A +  D     G  + S+ S+ GGLPAPE SENPLRYKFSWSP   L+  ++PA Y++N +V  I AGG L+ ++  M  LPGFNL+G+PNRDST Y + YG+ +  +L+RGTLR+KGF+ AM   +++G+++  P P L+     I+WK+ +C+ +++   + + +++  VF  +  D        + G+  D  + + GT LA+++ +L  KLAYEKNERD++IM ++V ++ P  +L+   + LVVYGDP GF AMA TVGYP AI  +M+L+GE+  KG+V+P++ +IY P+LK L++EG++ +  +T+ +
Sbjct:   27 GVMGIRREDVNVWERRAPLAPRHVKEITAEGYKVLVQPSNRRAIHDRYYEKAGAILQEDISEASLIVGVKRPPEEKV--IPHKTYAFFSHTIKAQEPNMGLLDDILKKNVRLIDYEKMVDENGFRIVAFGKWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQSVQAVRDCGYEISLGLMPKSIGPLTFVFTGTGNVSKGAQEIFNELPCEFVEPHELKDVCESGDRTKVYGTVISRRHHLIRKSDGLYDPFEYEHHPERYTSHFRSTIAPYTTCLINGIYWDPHTPRLLRRLDAQKLMKPSKLSSY-------------------SIEGCPELPHKFLAICDISADTGGSIEFMTECTTIEKPFCMYDPKKHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLLPYVWEM-----------------VSFAVITSNGKLAPKFEYIEKLRERRESE--QILK-KGGMKRVLLLGSGYVSGPVIEYLTRDVATQVTVG--NQAE--ELAALYPNTIPVMLDVSSQEGHLESLVKDHDLVISMLPYSYHPLVAKHCINKKVNLVTASYLSPEMKELQRSAEEAGITIVNEMGLDPGIDHMLAMECIDQAKADGCTVESFSSYCGGLPAPECSENPLRYKFSWSPYGVLLNTISPAVYLKNNQVVSIPAGGSLLESTVSMDFLPGFNLEGFPNRDSTKYAEAYGIESAQSLVRGTLRFKGFSHAMSGFVKLGMINTDPSPLLNPAASPISWKELLCRLLDLPSSVSSDSVEEVVFNHIGRD--------ELGMLSDEAVPQCGTILASLAKHLETKLAYEKNERDMIIMRNDVGIRHPTGELETKHISLVVYGDPKGFSAMAKTVGYPAAIVARMLLNGELNTKGLVVPMTKNIYAPILKTLQEEGLQFITKSTVTE 901          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Sea Lamprey
Match: AASS (aminoadipate-semialdehyde synthase [Source:HGNC Symbol;Acc:HGNC:17366])

HSP 1 Score: 532.332 bits (1370), Expect = 5.455e-180
Identity = 267/475 (56.21%), Postives = 353/475 (74.32%), Query Frame = 3
Query:  138 GSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFE-DFKVSPVVKNAVIASNGELTPLHKYIDKLRESK 1559
            G ++    V AIRRE +N+WERRAPLAP  V+ L   G+ VLVQPSNRRA    +Y +AGAI+QEDIS+A+LI+GVK+ P     LIP+KT+AFFSHTIKAQE NM LL+ ++ + IRLIDYEKM+D +G RVVAFG++AG  GMINILHG+G+RLLALGHHTPF+HIG+AHNYR    A QA+RD GY IALG MPKSIGP+TFVFTGTGNVS+GAQE+F +LP+E+VEP  LK V + GD++K+Y  V+SR+ H  R++D+ +D +E+D +P+ Y S F++ IAPY + ++NGIYW P +PRL++  DA+ L+ P           ++    ++ F     + GCP LPHR + ICDISADPGGSIEF+ ECTTID PFC+YDA QN  +      G+L+CS+D +PAQ+P  AT++FG  L PYI++M+ S+A  P E   + SP V++AVIASN +LTP  +YI+KLR+S+
Sbjct:   17 GRKTRHQPVLAIRREDVNVWERRAPLAPSHVELLTAAGYTVLVQPSNRRAIHANDYVKAGAILQEDISDATLILGVKRPPDG--KLIPHKTYAFFSHTIKAQEANMGLLEEVVAKGIRLIDYEKMVDTKGVRVVAFGKWAGFTGMINILHGLGLRLLALGHHTPFIHIGMAHNYRNSNQAIQAVRDAGYEIALGLMPKSIGPITFVFTGTGNVSRGAQEIFNELPFEYVEPYDLKHVSLKGDSRKVYGTVLSRHHHLVRKTDDIYDAQEYDIYPKRYTSRFNQQIAPYTTCLVNGIYWDPDTPRLLSKEDAQRLMTPMH---------LAEGSEADTF-----VKGCPYLPHRFLGICDISADPGGSIEFMTECTTIDAPFCMYDANQNFHHNSVNEDGILICSIDQLPAQMPVEATEYFGDRLYPYIFQMLASDANKPLEKQTEFSPAVRDAVIASNNKLTPKFEYIEKLRDSR 475          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008909.1 (pep scaffold:Pmarinus_7.0:GL476968:470701:483289:-1 gene:ENSPMAG00000008061.1 transcript:ENSPMAT00000008909.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.278 bits (752), Expect = 2.374e-91
Identity = 143/330 (43.33%), Postives = 210/330 (63.64%), Query Frame = 3
Query: 1923 SKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            S + ++AGIT + EVGLDPGIDHM+A   FD   E    + SY SF GGL APEFS+NPLRYKFSWSP   L+T++NPA++  +G+V EI AGG ++ A + +  +PGF+L+G PNRDS +YVK YG+    T  RGTLRYKG     ++ I+M L+       +  +     W+Q MC    + +D     L+ AV  +L+ ++     L+  GL     + +  + +  ++ +L ++L++  +ERD+VI+ +EV+V+ P    +K  V LV YGD  G+ AMA TVGYP AI  KM+L+GEI +KG+V+PL   IY+P+L+R++ EGI
Sbjct:    5 SLSAQNAGITVVNEVGLDPGIDHMLAMKCFDQAREMDGQVESYVSFCGGLSAPEFSDNPLRYKFSWSPRGVLLTSINPARFQRHGQVVEIPAGGSVLDAVEPIDFMPGFSLEGVPNRDSLSYVKDYGVHGTTTFFRGTLRYKGVKTTPFNYIRMALIQNDSLEDVSSSCHSCCWRQLMCSM--LGVDEGGAALEEAVLARLSGNEQSLRALQQLGLLGAQLVREAPSLVDALAAHLEERLSFGPDERDLVILRNEVVVRLPTGVREKTVVNLVSYGDRGGYSAMAKTVGYPCAIAAKMVLNGEIWEKGMVIPLKPHIYQPLLERIRAEGI 332          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008906.1 (pep scaffold:Pmarinus_7.0:GL476968:470701:483289:-1 gene:ENSPMAG00000008061.1 transcript:ENSPMAT00000008906.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 288.5 bits (737), Expect = 4.338e-89
Identity = 147/334 (44.01%), Postives = 213/334 (63.77%), Query Frame = 3
Query: 1923 SKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDP---HLHLNGPKITWK-QFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
            S + ++AGIT + EVGLDPGIDHM+A   FD   E    + SY SF GGL APEFS+NPLRYKFSWSP   L+T++NPA++  +G+V EI AGG ++ A + +  +PGF+L+G PNRDS +YVK YG+    T  RGTLRYK   DA+ + I+M L+    D     L  +  + T K Q MC    + +D     L+ AV  +L+ ++     L+  GL     + +  + +  ++ +L ++L++  +ERD+VI+ +EV+V+ P    +K  V LV YGD  G+ AMA TVGYP AI  KM+L+GEI +KG+V+PL   IY+P+L+R++ EGI
Sbjct:    5 SLSAQNAGITVVNEVGLDPGIDHMLAMKCFDQAREMDGQVESYVSFCGGLSAPEFSDNPLRYKFSWSPRGVLLTSINPARFQRHGQVVEIPAGGSVLDAVEPIDFMPGFSLEGVPNRDSLSYVKDYGVHGTTTFFRGTLRYKKRADALLNYIRMALIPFSIDSIPFRLKASETQSTLKRQLMCSM--LGVDEGGAALEEAVLARLSGNEQSLRALQQLGLLGAQLVREAPSLVDALAAHLEERLSFGPDERDLVILRNEVVVRLPTGVREKTVVNLVSYGDRGGYSAMAKTVGYPCAIAAKMVLNGEIWEKGMVIPLKPHIYQPLLERIRAEGI 336          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Yeast
Match: LYS9 (Saccharopine dehydrogenase (NADP+, L-glutamate-forming); catalyzes the formation of saccharopine from alpha-aminoadipate 6-semialdehyde, the seventh step in lysine biosynthesis pathway; exhibits genetic and physical interactions with TRM112 [Source:SGD;Acc:S000005333])

HSP 1 Score: 292.352 bits (747), Expect = 2.903e-89
Identity = 167/450 (37.11%), Postives = 260/450 (57.78%), Query Frame = 3
Query: 1602 RQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDI-VTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITW----KQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFK-FSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLK-KEGIEIMETT 2930
            + VL+LGSG V +P+I  L  + +I +T+     A   +LA        + I + VTD+  L+K++  +++V+S++P+ +H  ++K  I+   ++VT+SY +P L +    +  AGIT + E+GLDPGIDH+ A    D++  +G  + S+ S+ GGLPAPE S+NPL YKFSWS    L+   N AKY ++GK++ + +  DLM  +K   I PG+    YPNRDST +   Y +    T+IRGTLRY+GF + + +L+ MG+L  K D +   + P I W    KQ++  +     D+       A + K +ED+ +  S     GLF D +I  +G  L T+   L + + YE NERD+V++ H+  ++W +   +     LV YG   G+ +MA TVGYP AI  K +LDG I+  G++ P S +I  P++K LK K GI + E T
Sbjct:    3 KNVLLLGSGFVAQPVIDTLAANDDINVTVACRTLANAQALAKP---SGSKAISLDVTDDSALDKVLADNDVVISLIPYTFHPNVVKSAIRTKTDVVTSSYISPALRELEPEIVKAGITVMNEIGLDPGIDHLYAVKTIDEVHRAGGKLKSFLSYCGGLPAPEDSDNPLGYKFSWSSRGVLLALRNSAKYWKDGKIETVSS-EDLMATAKPYFIYPGYAFVCYPNRDSTLFKDLYHIPEAETVIRGTLRYQGFPEFVKALVDMGML--KDDANEIFSKP-IAWNEALKQYLGAKSTSKEDLIASIDSKATW-KDDEDRERILSGFAWLGLFSDAKITPRGNALDTLCARLEELMQYEDNERDMVVLQHKFGIEWADGTTETRTSTLVDYGKVGGYSSMAATVGYPVAIATKFVLDGTIKGPGLLAPYSPEINDPIMKELKDKYGIYLKEKT 444          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Yeast
Match: LYS1 (Saccharopine dehydrogenase (NAD+, L-lysine-forming); catalyzes the conversion of saccharopine to L-lysine, which is the final step in the lysine biosynthesis pathway; also has mRNA binding activity [Source:SGD;Acc:S000001473])

HSP 1 Score: 71.633 bits (174), Expect = 1.582e-13
Identity = 54/150 (36.00%), Postives = 79/150 (52.67%), Query Frame = 3
Query:  171 IRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEAS-----LIIGVKKVP-LDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIR 602
            +R E+  L E RA L P  VK+L+  GFK+ V+ S +  +   EY+QAGAI+    S  +     +IIG+K++P  D   L+       F+H  K Q     +L   ++    L D E + +DQG+RV AFG YAG AG       +G+R
Sbjct:    8 LRAETKPL-EARAALTPTTVKKLIAKGFKIYVEDSPQSTFNINEYRQAGAIIVPAGSWKTAPRDRIIIGLKEMPETDTFPLV--HEHIQFAHCYKDQAGWQNVLMRFIKGHGTLYDLEFLENDQGRRVAAFGFYAGFAGA-----ALGVR 149          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Nematostella
Match: EDO38256 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDG1])

HSP 1 Score: 824.313 bits (2128), Expect = 0.000e+0
Identity = 434/920 (47.17%), Postives = 596/920 (64.78%), Query Frame = 3
Query:  165 FAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFED-FKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLK---TTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGI 2912
             AIRRE IN+WERRAP+ P  V +LV  G KVLVQPS RRAYT  EY++AGA++ ED+S ASLIIGVK VP+D   L+PNKT+AFFSHTIKAQE NM LLD +L++ IR++DYEKM+D +GQRV AFG++AG+ GMINILHG+G+RLLALGHHTPFM++G  HNY++   AK AI + G  I  G +P+  GPL+F+FTG+GNVSQGAQE+F +LP+ +V P  LK     GD +K+   VVSR D+   ++   FD +E++ HPE Y STF++++AP+ SV++NG YWAP  PR++T  DAK+LL+P                 ++ ++      GCP LPHRL+AICDISADP GS+EF+KECTTI+ PF LYD +   S     G GVL+CS+DN+PAQLPR ATD+FG LLLP++ EMI S+A  PFE    +SP V++AVI SN ELTP  KYI KLR+    A+ + L     T  +++VL+LGSG  V P I YL +D+++ +T+  +  +E   LA  F    P L+D+    + L+KLIK H+IV+S +P+  H  I   CI+  +NM+T+SY     ++  KA  DAG+   ME+GLDPGIDH++A + FDD+ + G  I S+ S+ GGLPAPE ++NPLRYKFSWSP + LMT ++ AKY+  GK  EI  G  L+   K     PG+ L+ YPNRDST Y  +Y +    T+IRGTLRY+GF+ A+  L ++G  S +P P   L   ++ W  ++         +F G+                      GL  +  +  + TPL T++ YL  KL Y+  ERD                L+   + ++ YGDP G  AMA TVG P AI  KM+L+G+++  G+  P++ +IY+P++K+L++EGI
Sbjct:    1 MAIRREDINVWERRAPIGPAHVSELVNRGIKVLVQPSTRRAYTMDEYERAGAVITEDLSPASLIIGVKAVPVDL--LLPNKTYAFFSHTIKAQEANMSLLDAMLDKNIRIVDYEKMVDKKGQRVCAFGKFAGVGGMINILHGLGLRLLALGHHTPFMYMGGTHNYKSSRAAKLAIYELGEDIKAGKLPEHFGPLSFIFTGSGNVSQGAQEVFQELPHLYVHPHELKKAVEKGDHRKVIGTVVSREDYLVPKAGGKFDAQEYEAHPERYRSTFAEIVAPHMSVLVNGTYWAPGLPRVLTYDDAKNLLKP--------------MARTSAYD------GCPNLPHRLLAICDISADPDGSLEFMKECTTIEYPFHLYDIKTGTSQIGMAGDGVLICSIDNVPAQLPREATDYFGKLLLPWLPEMIDSDATEPFESQTHLSPTVRDAVITSNRELTPNFKYIAKLRKRMEEAKARALGPNVATPMRKRVLVLGSGLTVAPTIEYLVRDKSVGVTVASSVMSEAEQLAGSFRNTRPVLLDVEYHTDKLQKLIKDHDIVISCLPYDLHGAIAGKCIEHKKNMITSSYAHVLSDEIHKAAMDAGVCIGMELGLDPGIDHVLAMECFDDVKDEGGTIKSFLSYCGGLPAPEHADNPLRYKFSWSPRAGLMTIMHGAKYLWYGKTVEIAPGEPLLQEIKPTGQFPGYKLEAYPNRDSTLYRDRYNIQTADTVIRGTLRYEGFSTAVTGLFKLGFYSIRPHPDFEL-AQQLPWILYLY--------VFLGS----------------------GLMSEEPVVPQKTPLDTLASYLKTKLDYKDGERD----------------LETRSISMICYGDPAGNSAMAQTVGTPVAITAKMLLEGDLKTSGVFTPVAREIYKPLVKKLREEGI 851          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Nematostella
Match: EDO27922 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7X4])

HSP 1 Score: 177.178 bits (448), Expect = 7.786e-52
Identity = 85/127 (66.93%), Postives = 103/127 (81.10%), Query Frame = 3
Query:  162 VFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVA 542
            V AIRRE IN+WERRAP+ P  V +LV  G KVLVQPS RRAYT  EY++AGA++ ED+S ASLIIGVK VP+D   L+PNKT+AFFSHTIKAQE NM LLD +L++ IR++DYEKM+D +GQRV A
Sbjct:    1 VMAIRREDINVWERRAPIGPAHVSELVNRGIKVLVQPSTRRAYTMDEYERAGAVITEDLSPASLIIGVKAVPVDL--LLPNKTYAFFSHTIKAQEANMSLLDAMLDKNIRIVDYEKMVDKKGQRVCA 125          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Nematostella
Match: EDO41960 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2W5])

HSP 1 Score: 70.8626 bits (172), Expect = 7.290e-13
Identity = 63/248 (25.40%), Postives = 113/248 (45.56%), Query Frame = 3
Query:  198 ERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQ--------AGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGI-GIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMF--LDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHY 908
            ERRA L P++ K+LV  GFKV V+ S++R +   EY           G   ++   + ++I+G+K +P D  + I ++   FF+H  K Q    E++         ++D E ML+++G+R VA  +++ IAG + +  GI G     LG   P +       Y +  +  Q ++     +A       + P   V    G   +G+ +M   + +P   +    L++    G  K+I    +  ND +
Sbjct:   15 ERRAHLTPEKCKELVDAGFKVTVESSDQRIFKNEEYASIAGVEVLAPGITWEKAAPKDAIILGLKNLPYDDTSPI-SQHHVFFAHAYKDQPGAKEVIGRFTRGGGAILDIEYMLNEEGKREVA--EFSPIAGQVGMALGIAGWCHQQLGERMPSV-----SPYDSEALLVQHVQSLLKRLAKKKGVAEVYPTIIVLGALGRCGKGSLDMAKKIGIPKSHIAEWDLEETKAGGPFKEILNYDIFVNDIF 254          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Medaka
Match: aass (aminoadipate-semialdehyde synthase [Source:NCBI gene;Acc:101155996])

HSP 1 Score: 1005.36 bits (2598), Expect = 0.000e+0
Identity = 482/956 (50.42%), Postives = 667/956 (69.77%), Query Frame = 3
Query:   75 KMLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            ++++  +   K   LV  ++Y      + V AIRRE ++ WERRAPLAP+ VK+L   G KVLVQPSNRRA  E  Y +AGA++QEDIS+ASLIIGVK+ P + +  IP KT+AFFSHTIKAQE NM LL+ +L++++RLIDYEKM+D  G R+VAFGQ+AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  A QA+RDCGY I++G MPKSIGPLTF FTGTGNVS+GAQ++  +LP E+VEP  LK+V   GD  K+YA V+SR+ H  R+SD  +DP E++ HPELY S F   +APY + +INGIYW  +SPRL+   DA+ L++P    + PS        ++N+        G P LPHR +AICDISAD GGSIEF+ ECTTIDKPFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG  L PYI+EM+ S+A  P E+   SP V++AVI SNG LTP  +YI+KLRE  R  + Q +K T G ++VL+LGSG+V  P++ YL +D+  Q+T+      +   L+ K+    P ++D  ++   LE L+K H++V+S++P+ +H LI K CIK   NMVTASY +P +++   + E+AGI  + E+GLDPGIDHM+A +  D     G  I SY SF GGLPAPE S+NPLRYKFSWSP   L+  ++PA ++++ +V  I +GG LM +S  M  LPGFNL+G+PNRDST Y   YG+   HTLIRGTLR+KGF+ AM   +++GL++ +P P L      I+WK  +C+Q+ ++  I     + AVF  + +D FK   L  FG+  D+ +    + LA ++ +L  KL+Y+K ERD+V+M ++V ++    +L+   + LVVYGDPNGF AMA TVGYP AI  +M+LDGEI  +G+V+PL+ +IY+P L RL++EG+ I+  +T+ +
Sbjct:    3 RIIKNYQAKPKFGRLVGQRRY---EHHTAVMAIRREDVSPWERRAPLAPRHVKELTNAGVKVLVQPSNRRAIHEKYYIKAGAVVQEDISQASLIIGVKRPPEEKV--IPRKTYAFFSHTIKAQEANMGLLEELLKKEVRLIDYEKMVDANGFRIVAFGQWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQAIQAVRDCGYEISMGLMPKSIGPLTFCFTGTGNVSKGAQDIINELPVEYVEPHELKEVSEMGDMTKVYATVLSRHHHLMRKSDGVYDPIEYENHPELYTSNFRTSVAPYTTCLINGIYWDSNSPRLLRRLDAQRLMRP----YRPS--------AANR-------EGSPALPHRFLAICDISADTGGSIEFMNECTTIDKPFCMYDADQHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLFPYIWEMLPSDASRPLEEEDFSPQVRDAVITSNGTLTPKFEYIEKLRE--RREKSQIMKKT-GMKRVLLLGSGYVSGPVVEYLTRDETTQVTVASVLLKQAEELSTKYPNTIPVMLDASSNERHLESLVKDHDLVISLLPYSFHPLIAKQCIKSKVNMVTASYLSPAMKELQSSAEEAGIVIVNEMGLDPGIDHMLAMECIDQAKADGCTIESYSSFCGGLPAPEHSDNPLRYKFSWSPYGVLLNTISPAIFLKDNQVVSIPSGGSLMDSSSLMDFLPGFNLEGFPNRDSTKYAVPYGIQTAHTLIRGTLRFKGFSQAMSGFLKLGLINTEPCPFLQSASSPISWKDLLCRQLGLSPSIPQEAFEEAVFSHIGQDHFKMETLRWFGMLGDDSVPYAESILAAVAKHLEAKLSYDKAERDMVVMRNDVGIRHSTGELETRHISLVVYGDPNGFSAMAKTVGYPAAIASRMVLDGEITTRGLVVPLTKEIYKPALARLREEGLHIIAKSTLQE 931          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Medaka
Match: aass (aminoadipate-semialdehyde synthase [Source:NCBI gene;Acc:101155996])

HSP 1 Score: 980.704 bits (2534), Expect = 0.000e+0
Identity = 475/956 (49.69%), Postives = 658/956 (68.83%), Query Frame = 3
Query:   75 KMLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMD 2942
            ++++  +   K   LV  ++Y      + V AIRRE ++ WERRAPLAP+ VK+L   G KVLVQPSNRRA  E  Y +AGA++QEDIS+ASLIIGVK+ P + +  IP KT+AFFSHTIKAQE NM LL+ +L++++RLIDYEKM+D  G R+VAFGQ+AG+AGMINILHG+G+R LALGHHTPFMHIG+AHNYR +  A QA+RDCGY I++G MPKSIGPLTF FTGTGNVS+GAQ++  +LP E+VEP  LK+V   GD  K+YA V+SR+ H  R+SD  +DP E++ HPELY S F   +APY + +INGIYW  +SPRL+   DA+ L++P    + PS        ++N+        G P LPHR +AICDISAD GGSIEF+ ECTTIDKPFC+YDA+Q++ ++   G G+L+CS+DN+PAQLP  AT++FG  L PYI+EM++               +  AVI SNG LTP  +YI+KLRE  R  + Q +K T G ++VL+LGSG+V  P++ YL +D+  Q+T+      +   L+ K+    P ++D  ++   LE L+K H++V+S++P+ +H LI K CIK   NMVTASY +P +++   + E+AGI  + E+GLDPGIDHM+A +  D     G  I SY SF GGLPAPE S+NPLRYKFSWSP   L+  ++PA ++++ +V  I +GG LM +S  M  LPGFNL+G+PNRDST Y   YG+   HTLIRGTLR+KGF+ AM   +++GL++ +P P L      I+WK  +C+Q+ ++  I     + AVF  + +D FK   L  FG+  D+ +    + LA ++ +L  KL+Y+K ERD+V+M ++V ++    +L+   + LVVYGDPNGF AMA TVGYP AI  +M+LDGEI  +G+V+PL+ +IY+P L RL++EG+ I+  +T+ +
Sbjct:    3 RIIKNYQAKPKFGRLVGQRRY---EHHTAVMAIRREDVSPWERRAPLAPRHVKELTNAGVKVLVQPSNRRAIHEKYYIKAGAVVQEDISQASLIIGVKRPPEEKV--IPRKTYAFFSHTIKAQEANMGLLEELLKKEVRLIDYEKMVDANGFRIVAFGQWAGVAGMINILHGLGLRFLALGHHTPFMHIGMAHNYRNVSQAIQAVRDCGYEISMGLMPKSIGPLTFCFTGTGNVSKGAQDIINELPVEYVEPHELKEVSEMGDMTKVYATVLSRHHHLMRKSDGVYDPIEYENHPELYTSNFRTSVAPYTTCLINGIYWDSNSPRLLRRLDAQRLMRP----YRPS--------AANR-------EGSPALPHRFLAICDISADTGGSIEFMNECTTIDKPFCMYDADQHIDHDSVEGNGILMCSIDNLPAQLPIEATEYFGDRLFPYIWEMVRH--------------LNFAVITSNGTLTPKFEYIEKLRE--RREKSQIMKKT-GMKRVLLLGSGYVSGPVVEYLTRDETTQVTVASVLLKQAEELSTKYPNTIPVMLDASSNERHLESLVKDHDLVISLLPYSFHPLIAKQCIKSKVNMVTASYLSPAMKELQSSAEEAGIVIVNEMGLDPGIDHMLAMECIDQAKADGCTIESYSSFCGGLPAPEHSDNPLRYKFSWSPYGVLLNTISPAIFLKDNQVVSIPSGGSLMDSSSLMDFLPGFNLEGFPNRDSTKYAVPYGIQTAHTLIRGTLRFKGFSQAMSGFLKLGLINTEPCPFLQSASSPISWKDLLCRQLGLSPSIPQEAFEEAVFSHIGQDHFKMETLRWFGMLGDDSVPYAESILAAVAKHLEAKLSYDKAERDMVVMRNDVGIRHSTGELETRHISLVVYGDPNGFSAMAKTVGYPAAIASRMVLDGEITTRGLVVPLTKEIYKPALARLREEGLHIIAKSTLQE 917          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Planmine SMEST
Match: SMESG000042307.1 (SMESG000042307.1)

HSP 1 Score: 1984.15 bits (5139), Expect = 0.000e+0
Identity = 957/957 (100.00%), Postives = 957/957 (100.00%), Query Frame = 3
Query:   78 MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF 2948
            MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF
Sbjct:    1 MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF 957          
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Planmine SMEST
Match: SMESG000042307.1 (SMESG000042307.1)

HSP 1 Score: 1935.23 bits (5012), Expect = 0.000e+0
Identity = 939/957 (98.12%), Postives = 939/957 (98.12%), Query Frame = 3
Query:   78 MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVSYQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF 2948
            MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVE                  GCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF
Sbjct:    1 MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQVKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVPLDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQGQRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMAKQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVEPEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYISTFSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVE------------------GCPKLPHRLIAICDISADPGGSIEFVKECTTIDKPFCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYEMIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQTLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLADKFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHRNMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSESGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENGKVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLIRGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMNIDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHYLSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMATTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMETTTIMDEF 939          
The following BLAST results are available for this feature:
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
AASS0.000e+051.40aminoadipate-semialdehyde synthase [Source:HGNC Sy... [more]
AASS0.000e+051.40aminoadipate-semialdehyde synthase [Source:HGNC Sy... [more]
AASS0.000e+055.46aminoadipate-semialdehyde synthase [Source:HGNC Sy... [more]
AASS0.000e+058.35aminoadipate-semialdehyde synthase [Source:HGNC Sy... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aass-10.000e+049.36AminoAdipate-Semialdehyde Synthase homolog [Sourc... [more]
aass-10.000e+049.14AminoAdipate-Semialdehyde Synthase homolog [Sourc... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
LKRSDH0.000e+052.08gene:FBgn0286198 transcript:FBtr0343404[more]
LKRSDH0.000e+052.08gene:FBgn0286198 transcript:FBtr0079495[more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
aass0.000e+051.14aminoadipate-semialdehyde synthase [Source:ZFIN;Ac... [more]
aass0.000e+051.14aminoadipate-semialdehyde synthase [Source:ZFIN;Ac... [more]
aass8.103e-8665.66aminoadipate-semialdehyde synthase [Source:ZFIN;Ac... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nob10.000e+052.61NIN1 (RPN12) binding protein 1 homolog [Source:Xen... [more]
nob10.000e+052.92NIN1 (RPN12) binding protein 1 homolog [Source:Xen... [more]
nob10.000e+052.92NIN1 (RPN12) binding protein 1 homolog [Source:Xen... [more]
nob10.000e+053.16NIN1 (RPN12) binding protein 1 homolog [Source:Xen... [more]
nob10.000e+052.38NIN1 (RPN12) binding protein 1 homolog [Source:Xen... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Aass0.000e+049.95aminoadipate-semialdehyde synthase [Source:MGI Sym... [more]
Aass4.822e-3540.48aminoadipate-semialdehyde synthase [Source:MGI Sym... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A8E657|AASS_BOVIN0.000e+051.51Alpha-aminoadipic semialdehyde synthase, mitochond... [more]
sp|Q9UDR5|AASS_HUMAN0.000e+051.40Alpha-aminoadipic semialdehyde synthase, mitochond... [more]
sp|Q99K67|AASS_MOUSE0.000e+049.95Alpha-aminoadipic semialdehyde synthase, mitochond... [more]
sp|A2VCW9|AASS_RAT0.000e+050.16Alpha-aminoadipic semialdehyde synthase, mitochond... [more]
sp|Q9SMZ4|AASS_ARATH8.718e-9034.15Alpha-aminoadipic semialdehyde synthase OS=Arabido... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267E7W70.000e+057.39Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GKZ90.000e+055.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A3S0ZSG20.000e+055.08Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
A0A1S3JRD00.000e+056.14alpha-aminoadipic semialdehyde synthase, mitochond... [more]
A0A1S3JQA60.000e+056.40alpha-aminoadipic semialdehyde synthase, mitochond... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aass0.000e+050.97aminoadipate-semialdehyde synthase [Source:NCBI ge... [more]
aass0.000e+050.43aminoadipate-semialdehyde synthase [Source:NCBI ge... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
AASS5.455e-18056.21aminoadipate-semialdehyde synthase [Source:HGNC Sy... [more]
ENSPMAT00000008909.12.374e-9143.33pep scaffold:Pmarinus_7.0:GL476968:470701:483289:-... [more]
ENSPMAT00000008906.14.338e-8944.01pep scaffold:Pmarinus_7.0:GL476968:470701:483289:-... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
LYS92.903e-8937.11Saccharopine dehydrogenase (NADP+, L-glutamate-for... [more]
LYS11.582e-1336.00Saccharopine dehydrogenase (NAD+, L-lysine-forming... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO382560.000e+047.17Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO279227.786e-5266.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419607.290e-1325.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
aass0.000e+050.42aminoadipate-semialdehyde synthase [Source:NCBI ge... [more]
aass0.000e+049.69aminoadipate-semialdehyde synthase [Source:NCBI ge... [more]
back to top
BLAST of Alpha-aminoadipic semialdehyde synthase, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000042307.10.000e+0100.00SMESG000042307.1[more]
SMESG000042307.10.000e+098.12SMESG000042307.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016114 ID=SMED30016114|Name=Alpha-aminoadipic semialdehyde synthase, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=3193bp
TTTTTGACCTATTTTCTATTTCAATATGGATGCTTAAATTGAATTAAATT
ACAATTAAATTGAACTAAATTGACAAAATGCTTCGTGCTTTAAAAGTTGC
AAAAAAGCCTAATAATCTTGTTTTTATCAAGAAGTATGGAAGCAGAAGTG
GTGAAAGCGGAGTTTTTGCTATTAGAAGAGAATCTATTAATTTATGGGAA
CGACGAGCTCCTTTAGCTCCCAAACAAGTGAAACAATTGGTTCAAGATGG
TTTTAAAGTTTTAGTACAACCATCAAATCGTCGGGCATACACCGAAATGG
AATATAAACAAGCAGGAGCGATTATGCAGGAAGATATTTCTGAAGCTTCA
CTAATTATTGGAGTTAAAAAAGTTCCACTAGATCATATTAATTTAATTCC
AAATAAAACATTTGCCTTTTTTTCTCACACAATAAAAGCCCAAGAAGATA
ACATGGAATTGTTAGATACAATCCTTGAAAGGAAAATTCGGTTGATTGAT
TATGAGAAAATGTTGGATGATCAAGGCCAAAGAGTTGTGGCTTTCGGCCA
GTATGCAGGTATAGCTGGAATGATAAATATTCTTCATGGCATCGGAATAA
GGCTCTTAGCTTTAGGTCACCATACCCCATTTATGCACATTGGTTTGGCA
CATAATTATCGTACAATTGAAATGGCGAAACAAGCAATTCGAGATTGCGG
CTATGGAATTGCGCTAGGTAATATGCCAAAATCTATTGGGCCATTAACTT
TTGTGTTCACTGGAACTGGAAATGTTAGTCAAGGAGCTCAGGAGATGTTT
TTAGATTTACCATATGAATTCGTTGAACCTGAACATCTTAAAGATGTATG
CATTCATGGAGATACAAAGAAAATTTACGCTTGTGTTGTGAGCAGAAATG
ATCATTATCGGCGAAGATCTGATAATGGATTTGATCCTGAAGAATTCGAC
AAACATCCTGAGTTGTATATTTCAACTTTTAGTAAAATGATAGCACCTTA
TGCTTCCGTAATTATCAATGGTATCTATTGGGCACCAAGTTCACCACGCT
TGATTACTATTCCGGATGCCAAACATTTGTTGCAACCAGAAAAAACCCCA
TGGTTTCCTTCAGTGGAAGATGTCTCATATCAAAAATCGTCAAATAAATT
TAATCCAATTTTGGAAATACCAGGTTGTCCTAAATTACCCCATCGTCTTA
TCGCTATATGTGATATTTCTGCTGATCCAGGAGGATCGATTGAATTTGTT
AAAGAGTGCACTACAATAGATAAACCCTTTTGTCTTTACGATGCTGAACA
AAATATGAGTAATGAAAAATTTTTTGGTCCCGGAGTACTTGTTTGTTCTG
TTGACAATATGCCTGCACAACTACCTAGAGCAGCCACTGATTTCTTCGGT
TCATTGCTCTTACCATATATTTATGAAATGATTAAATCAAACGCTGAAAC
ACCTTTTGAAGATTTCAAGGTTTCTCCTGTAGTAAAAAATGCTGTTATAG
CTAGCAATGGAGAACTAACTCCATTACATAAATACATTGACAAGTTGAGA
GAATCTAAACGATCAGCACGATTGCAAACTTTAAAAACTACTTCTGGTAA
GAGACAAGTGTTGATTTTGGGTTCAGGTCATGTTGTTGAACCATTGATCT
CATATCTTGGTAAAGATCAAAATATTCAGATCACTTTGGGTGGTGCAGAA
AAGGCTGAACTATTAAGTCTAGCGGATAAATTTGATTATGTTAATCCTGA
ATTAATCGACATTGTTACTGATAATGAACTGTTAGAAAAGTTGATAAAAT
CTCATGAGATCGTTGTTAGCATGGTTCCCTGGAAGTATCATGAACTTATT
TTGAAACATTGTATCAAGCAACACCGAAACATGGTCACTGCCAGTTATTG
TACACCGGATTTAGAGAAATATTCTAAAGCGGTTGAAGATGCAGGAATTA
CTGCTTTGATGGAAGTCGGATTGGATCCTGGAATAGACCATATGATTGCA
AAGGATATTTTTGATGATATGTCAGAGAGTGGATTGAATATCGTTTCTTA
CAAATCTTTCACAGGTGGCTTACCGGCTCCGGAGTTTTCTGAAAATCCAT
TACGTTATAAATTTAGTTGGAGTCCTGAATCGGCTTTGATGACGGCTTTG
AATCCTGCTAAATATATAGAAAACGGAAAGGTTAAAGAAATCAAAGCTGG
TGGAGATTTAATGTTAGCTTCCAAAAAGATGTCGATTTTACCTGGTTTCA
ATTTACAAGGATATCCTAATCGAGATTCCACAGCCTATGTGAAAAAATAC
GGTCTAACTAATGTTCATACTCTAATAAGGGGAACTCTTAGATACAAAGG
TTTTACTGATGCCATGTGGTCATTAATTCAGATGGGTCTTCTTTCACCTA
AGCCGGATCCTCATTTACATCTTAATGGGCCAAAAATAACTTGGAAACAA
TTTATGTGTAAACAAATGGAAATGAACATAGATATTTTTACGGGAACATT
AAAAAATGCAGTTTTTGAAAAATTAAACGAAGACAAATTTAAATTCTCTT
GCCTTGAAGATTTTGGTTTATTCAAAGATAATGAAATTGAAAAGAAAGGT
ACTCCTCTTGCCACTATCTCTCATTATCTTTCCCAGAAATTGGCATATGA
AAAAAATGAAAGAGATGTCGTGATTATGGCTCATGAAGTTCTTGTTAAAT
GGCCAGAAAACAAATTAAAGAAACTTGATGTTCGACTGGTTGTTTATGGA
GATCCTAATGGTTTCATGGCCATGGCTACAACTGTTGGTTACCCTACTGC
GATTGGGGTAAAAATGATTCTTGACGGAGAAATCCAGAAAAAGGGGATAG
TTTTACCATTATCCGTTGATATCTATCGGCCAATGTTAAAGCGACTGAAG
AAGGAAGGGATAGAGATAATGGAAACCACTACAATTATGGATGAATTCTA
ACTGCTAGAATATTTAGGCATTATTTAATATAATTAATTTTCCTAAGTAC
CGATTTTTTTTGTTAATTATCGGTAACTGATTTAACTTATAATTTAATAT
TTGTAAAACTCTTTTAAATTCAAAATATGTTCTTTACCTTTGTTTTCTAT
TTATTTTTAAGGACTCAGCTGTGTAAATTTGCAAATCGTATTGAGAATAT
GTTATCATTTTATAAATAAAATATTTTGTTATTTGTAAAAAAA
back to top

protein sequence of SMED30016114-orf-1

>SMED30016114-orf-1 ID=SMED30016114-orf-1|Name=SMED30016114-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=958bp
MLRALKVAKKPNNLVFIKKYGSRSGESGVFAIRRESINLWERRAPLAPKQ
VKQLVQDGFKVLVQPSNRRAYTEMEYKQAGAIMQEDISEASLIIGVKKVP
LDHINLIPNKTFAFFSHTIKAQEDNMELLDTILERKIRLIDYEKMLDDQG
QRVVAFGQYAGIAGMINILHGIGIRLLALGHHTPFMHIGLAHNYRTIEMA
KQAIRDCGYGIALGNMPKSIGPLTFVFTGTGNVSQGAQEMFLDLPYEFVE
PEHLKDVCIHGDTKKIYACVVSRNDHYRRRSDNGFDPEEFDKHPELYIST
FSKMIAPYASVIINGIYWAPSSPRLITIPDAKHLLQPEKTPWFPSVEDVS
YQKSSNKFNPILEIPGCPKLPHRLIAICDISADPGGSIEFVKECTTIDKP
FCLYDAEQNMSNEKFFGPGVLVCSVDNMPAQLPRAATDFFGSLLLPYIYE
MIKSNAETPFEDFKVSPVVKNAVIASNGELTPLHKYIDKLRESKRSARLQ
TLKTTSGKRQVLILGSGHVVEPLISYLGKDQNIQITLGGAEKAELLSLAD
KFDYVNPELIDIVTDNELLEKLIKSHEIVVSMVPWKYHELILKHCIKQHR
NMVTASYCTPDLEKYSKAVEDAGITALMEVGLDPGIDHMIAKDIFDDMSE
SGLNIVSYKSFTGGLPAPEFSENPLRYKFSWSPESALMTALNPAKYIENG
KVKEIKAGGDLMLASKKMSILPGFNLQGYPNRDSTAYVKKYGLTNVHTLI
RGTLRYKGFTDAMWSLIQMGLLSPKPDPHLHLNGPKITWKQFMCKQMEMN
IDIFTGTLKNAVFEKLNEDKFKFSCLEDFGLFKDNEIEKKGTPLATISHY
LSQKLAYEKNERDVVIMAHEVLVKWPENKLKKLDVRLVVYGDPNGFMAMA
TTVGYPTAIGVKMILDGEIQKKGIVLPLSVDIYRPMLKRLKKEGIEIMET
TTIMDEF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036291NAD(P)-bd_dom_sf
IPR007698AlaDH/PNT_NAD(H)-bd
IPR007886AlaDH/PNT_N
IPR005097Sacchrp_dh_NADP
IPR016040NAD(P)-bd_dom
IPR032095Sacchrp_dh_C
Vocabulary: molecular function
TermDefinition
GO:0016491oxidoreductase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR007886Alanine dehydrogenase/pyridine nucleotide transhydrogenase, N-terminalSMARTSM01003AlaDh_PNT_N_2coord: 31..163
e-value: 1.9E-21
score: 87.3
IPR007886Alanine dehydrogenase/pyridine nucleotide transhydrogenase, N-terminalPFAMPF05222AlaDh_PNT_Ncoord: 32..163
e-value: 1.9E-28
score: 99.4
IPR007698Alanine dehydrogenase/pyridine nucleotide transhydrogenase, NAD(H)-binding domainSMARTSM01002AlaDh_PNT_C_2coord: 203..424
e-value: 2.5E-15
score: 66.9
IPR007698Alanine dehydrogenase/pyridine nucleotide transhydrogenase, NAD(H)-binding domainPFAMPF01262AlaDh_PNT_Ccoord: 377..481
e-value: 7.8E-6
score: 25.3
NoneNo IPR availableGENE3DG3DSA:3.30.360.10coord: 632..900
e-value: 3.8E-145
score: 486.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 510..941
e-value: 3.8E-145
score: 486.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.720coord: 28..171
e-value: 3.3E-39
score: 136.3
NoneNo IPR availableGENE3DG3DSA:1.10.1870.10coord: 758..856
e-value: 3.8E-145
score: 486.2
NoneNo IPR availablePANTHERPTHR11133SACCHAROPINE DEHYDROGENASEcoord: 28..951
NoneNo IPR availablePANTHERPTHR11133:SF18ALPHA-AMINOADIPIC SEMIALDEHYDE SYNTHASE, MITOCHONDRIALcoord: 28..951
NoneNo IPR availableCDDcd12189LKR_SDH_likecoord: 29..491
e-value: 0.0
score: 713.949
NoneNo IPR availableSUPERFAMILYSSF52283Formate/glycerate dehydrogenase catalytic domain-likecoord: 29..237
NoneNo IPR availableSUPERFAMILYSSF55347Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domaincoord: 632..896
IPR005097Saccharopine dehydrogenase, NADP binding domainPFAMPF03435Sacchrp_dh_NADPcoord: 511..627
e-value: 1.4E-13
score: 51.3
IPR032095Saccharopine dehydrogenase, C-terminalPFAMPF16653Sacchrp_dh_Ccoord: 631..945
e-value: 6.4E-78
score: 262.5
IPR036291NAD(P)-binding domain superfamilySUPERFAMILYSSF51735NAD(P)-binding Rossmann-fold domainscoord: 509..685