Methyltransf_21 domain-containing protein

Overview
NameMethyltransf_21 domain-containing protein
Smed IDSMED30016106
Length (bp)1079
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltransf_21 domain-containing protein (SMED30016106) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltransf_21 domain-containing protein (SMED30016106) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltransf_21 domain-containing protein (SMED30016106) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltransf_21 domain-containing protein (SMED30016106) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016106

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016106SMESG000071837.1 SMESG000020353.1 SmedASXL_010415SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30016106SMESG000071837.1 SMESG000020353.1 dd_Smed_v4_25359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016106SMESG000071837.1 SMESG000020353.1 dd_Smed_v4_25359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016106SMESG000071837.1 SMESG000020353.1 dd_Smed_v4_25359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016106SMESG000071837.1 SMESG000020353.1 dd_Smed_v4_25359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016106SMESG000071837.1 SMESG000020353.1 dd_Smed_v6_25359_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Match: K1QJF8 (Methyltransf_21 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027079 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 2.616e-39
Identity = 85/245 (34.69%), Postives = 136/245 (55.51%), Query Frame = 3
Query:  246 LIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYL-LNAN--------ETEST---VYGVYIDD-----IVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKS 929
            + IY     DL+S  ++  G +E E +  LSE +  +  LQ++D+G N+GVYTL+ A  G +V++++   +NL  L  SV+  G Q  V+L +NA+SN      L   K N+GG Y+ +NAN        E + T   VY + +DD     ++ +F K   + IKMDI+GFE +A+E++ + F + NV+ +L+EW++ +NHP     I F   R YNP+      +PL VA+   W  ++   K 
Sbjct:   41 IFIYQGDQDDLVSGSVLDKGTFESEKEMILSEMMKDDPDLQIIDIGANIGVYTLSCAKAGRKVLAVEALARNLQHLCASVMEGGLQDNVYLIHNAISNNNSFVSLGMHKGNMGGTYVDVNANHIKQLKEGEAQGTYGQVYSITLDDLLELPVIKHFRK---VFIKMDIEGFEDRAVERATQFFEKVNVVGILMEWVFHRNHPTAKKIIDFMTERKYNPHACKIGKVPLDVAENENWGLDVALLKE 282          
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Match: A0A210PEI7 (Methyltransf_21 domain-containing protein OS=Mizuhopecten yessoensis OX=6573 GN=KP79_PYT08695 PE=4 SV=1)

HSP 1 Score: 145.976 bits (367), Expect = 6.590e-37
Identity = 90/267 (33.71%), Postives = 144/267 (53.93%), Query Frame = 3
Query:  165 TPKLRLINYRKVYFNSTKAF-----LYTANRKLIIYVHGPHD--LISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYL---LNANETESTVYGVYIDDIVSYFLKDKG-IIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDF--KSVIPLSVAKYRKWPTEIVWRK 926
            T + R  N+ KV+  ST+       L T   +  I +  P +  +IS +I  +G WE +      + +  N  +Q +DLGCN+GV+TL+ A LG RVVS+D+  + L+ LQ S+        V L  NA+SN R+  K+  + +NIGG ++    +  + E  +Y + +DD++     D G + +KMDI+G E KA+E SK  F + NV  +L+EW+  K  P     I + ++    PYLD+  + V+PL  A +  WP  ++W K
Sbjct:   86 TSRRRRKNHCKVFRGSTEGPKHCVPLKTKYGETPICIFDPVEDRMISSYIRDYGTWEPDLVNMTIDILQANPAMQFIDLGCNLGVFTLSVAKLGRRVVSVDILSRALDNLQHSLKLGNLTENVTLILNAMSNTREKVKINLVPDNIGGSHVGQHGDMGQHEELIYSIIMDDLLEII--DSGEVFVKMDIEGHEQKALENSKEFFHKANVKFLLMEWMLHKGKPSGDKIIKYLLSNGLLPYLDYNLREVLPLGRASF--WPDNVLWAK 348          
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Match: K1Q5Y6 (Methyltransf_21 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10008025 PE=4 SV=1)

HSP 1 Score: 137.502 bits (345), Expect = 1.034e-33
Identity = 72/231 (31.17%), Postives = 124/231 (53.68%), Query Frame = 3
Query:  252 IYVHGPHD--LISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETE----STVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRK 926
            I  H P    +IS  + +   WE+ +     + +     +  +DLGCN+G YTL AA+LG RVVS+D +  NL LL +S+  +  +  V L +NA+S+  +   L+    N+GG Y+ +  + E    + V  + +DD++   +K + + +KMDI+G E++A++ +K+     NV  +L+EW+  KN+P     I       + P+ D + ++PL V  Y  WP  + W K
Sbjct:  107 ICTHDPKQDKMISAFVHSFATWEQNFLNATGDVLTRYPDMTFVDLGCNIGAYTLFAASLGNRVVSVDAFDGNLALLAESLKLDSLESNVTLVHNAISDKHENVTLELNTHNVGGSYVKSLRDIEPPPQNVVGSIVMDDLIP-LIKSRDVFVKMDIEGTELRALQAAKQFLQVLNVKFILMEWVLHKNNPSALEIIKIMTNNGFLPFWDHQQLLPLRVNSYVYWPENVFWIK 336          
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Match: K1QRE5 (Methyltransf_21 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10023278 PE=4 SV=1)

HSP 1 Score: 134.806 bits (338), Expect = 3.234e-32
Identity = 85/252 (33.73%), Postives = 131/252 (51.98%), Query Frame = 3
Query:  216 KAFLYTANRKLIIYVHGPHDLI--SHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLL---NANETE-STVYGVYIDDIVSYFLKD---------KGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRK 926
            +A L T+   L I++H P D I  S+ I  HG WE  +   +  F+  +  LQ LDLG N+GVY++  A  G +VVS+D    N+  +  +V +N F   + L YNA+S+VR+   L   K NIGG ++    N N+   S V G Y  D+ +  L D         K +IIKMD++G+E +     ++ F   +V AVL+EW+W+K  P     I F     + P     +  PL + +   WP +++WR+
Sbjct:  152 QAVLRTSAGSLPIFIHNPKDDIHVSNSIHKHGSWEGGYIELVLTFLRQDLDLQFLDLGANLGVYSMAVAKFGRKVVSVDALSINIQRMCATVQTNRFN-NMQLVYNALSDVREVVSLGVDKGNIGGTFVAKDKNPNKVRGSRVSGSY-GDVQTATLDDLLELPGFDLKKVIIKMDVEGYENRVFRGGQKFFKNVDVRAVLMEWMWLKTGPAGQEIIDFLSRHGFTPTRPVLARQPLPLNQRLSWPNDVLWRR 401          
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Match: K1QT95 (Methyltransf_21 domain-containing protein OS=Crassostrea gigas OX=29159 GN=CGI_10027080 PE=4 SV=1)

HSP 1 Score: 122.094 bits (305), Expect = 3.433e-29
Identity = 65/210 (30.95%), Postives = 116/210 (55.24%), Query Frame = 3
Query:  333 LSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQY------------LLNANETESTVYGVYIDDIVSY-FLKD-KGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVW 920
            +S+ +  +  L ++D+G N+GVYTL+ A  G +V++++   +N+  +  SV+  G Q  V+L +NA+SN      L   K N+GG +            L  A  T   VY + +DD++    +K+ + + IKMD++GFE +A+EK+ + F + NV+  ++EW + +N P     I F   R Y P++      PL++A+  KW  +++W
Sbjct:    3 ISKMMKDHPDLNIIDIGANIGVYTLSTAKAGRKVLAVEALDRNMQHICASVMEGGLQDNVYLIHNAISNGHSVVNLGVDKSNMGGTFVDVDSGHIKELKLGRAQGTYGQVYTITMDDLLELPIMKEFQKVFIKMDVEGFEARAVEKATKFFEKINVVGFVMEWEFHRNQPTAKKIIDFMTARKYKPHVCNVGKAPLNIAESGKWGYDVLW 212          
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Match: SMESG000071837.1 (SMESG000071837.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 286/288 (99.31%), Postives = 286/288 (99.31%), Query Frame = 3
Query:   72 MILYQFKXXXXXXXXXXXXXXXXXTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN 935
            MIL QFKLCFIISILFSSLFLICLTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQ QLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN
Sbjct:    1 MILSQFKLCFIISILFSSLFLICLTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQPQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN 288          
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Match: SMESG000020353.1 (SMESG000020353.1)

HSP 1 Score: 543.888 bits (1400), Expect = 0.000e+0
Identity = 284/288 (98.61%), Postives = 285/288 (98.96%), Query Frame = 3
Query:   72 MILYQFKXXXXXXXXXXXXXXXXXTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN 935
            MILYQFKLCFIISI FSSLFLICLTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHG WEKEWQTQLSEFIVTNNQ QLLDLGCNVGVYTLTAAALGCRVVSIDV+MKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN
Sbjct:    1 MILYQFKLCFIISISFSSLFLICLTYFVTKLTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGTWEKEWQTQLSEFIVTNNQPQLLDLGCNVGVYTLTAAALGCRVVSIDVHMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN 288          
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Match: SMESG000043455.1 (SMESG000043455.1)

HSP 1 Score: 190.274 bits (482), Expect = 2.162e-58
Identity = 97/255 (38.04%), Postives = 151/255 (59.22%), Query Frame = 3
Query:  162 LTPKLRLINYRKVYFNSTKAFLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRK 926
            +T ++ +I   K   +  +  L   N+ + IY+H  +D IS  II + +WE     +L +F+    + Q +D+GCN+GVY+L+ A++G +V +ID    N + L QSVI+NGF  +  +  NAVSNVRK + +   + NIGGQ+L N   T   V  + +DD++S   ++K  I KMDIQG EI   +++   F++ N+L +L+EW WIK   + +I I F M+R + P+    S   L V+ YR WP +IVWRK
Sbjct:    1 MTDRINIIKLIKTNHDFLRGRLKVLNKNISIYLHYKNDYISQKIINNSVWEWGIVGELLKFMKNYPKAQFIDVGCNLGVYSLSVASMGHQVNAIDANSNNTDRLAQSVITNGFANKFTIILNAVSNVRKSFSMNVDQSNIGGQFLTNQ-TTSYVVKSILMDDLLSITGENKEFIFKMDIQGSEINLFKETSNFFAKNNILIILIEWEWIKLDKECYILIYFLMSRGFRPFATISSTTELDVSNYRAWPYDIVWRK 254          
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Match: SMESG000040830.1 (SMESG000040830.1)

HSP 1 Score: 182.185 bits (461), Expect = 6.224e-55
Identity = 92/237 (38.82%), Postives = 139/237 (58.65%), Query Frame = 3
Query:  225 LYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN 935
            LY  ++ L IYVH   DLIS  II  G WE  W  +L  +I TNN +  +D+GCN+GVYTL AA+LG +V++ID    N   L QS+I N  +  V L  NA S+ RK + +  + +NIG Q ++N+      V  + +DD+V +  K +   +K+DI+  EI A  K+  LF   N+  VL+EW++IK++P++   + FF  R+Y PY +  +   L+V +++ W   IVW K  N
Sbjct:   46 LYYDDKILSIYVHNRDDLISREIINTGTWEGGWTKELINYIKTNNGITFIDVGCNIGVYTLIAASLGAKVIAIDANENNTIRLNQSLIKNNLRPLVTLLNNAASDERKEFSMTSVYDNIGHQEIVNSTNNSYKVRSILLDDLVRFIDKSQSAFMKIDIENHEILAFRKASLLFDNVNIKLVLIEWMFIKDNPNVNSLLNFFQKRNYRPYSNMFATTLLNVDQHKSWGQNIVWIKKEN 282          
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Match: SMESG000035647.1 (SMESG000035647.1)

HSP 1 Score: 169.474 bits (428), Expect = 1.037e-49
Identity = 86/225 (38.22%), Postives = 134/225 (59.56%), Query Frame = 3
Query:  252 IYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQLLDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLFYNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKDKGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIAFFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRK 926
            I++H   D IS  I++   +E+ W  QL  F+  + Q  L+D GCN+G YTL  A  G +V++ID    N   L QS+ISN    +V +  NAVSN+RK Y +    +NIGGQ+L+++      V  + I+D+++   + + +IIK+DIQG EI ++  +   F +RN+ A+L+EW  IK   D  + I F + R+Y P+L+F S   L V+ ++ WP  +VWRK
Sbjct:   76 IFLHSKQDWISKEILSKSNYERFWLYQLMGFLKNHPQAVLIDFGCNIGAYTLAFAYSGHKVIAIDANRNNTERLIQSIISNNLCNKVVVILNAVSNIRKQYSMISYPKNIGGQFLVDSKNDSYAVNSILINDLLTITSETEELIIKIDIQGSEIDSLLAASVFFKDRNISAILIEWEIIKIDIDCPLLIDFLLLRNYRPFLNFFSDTILPVSSFKLWPNNLVWRK 300          
The following BLAST results are available for this feature:
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QJF82.616e-3934.69Methyltransf_21 domain-containing protein OS=Crass... [more]
A0A210PEI76.590e-3733.71Methyltransf_21 domain-containing protein OS=Mizuh... [more]
K1Q5Y61.034e-3331.17Methyltransf_21 domain-containing protein OS=Crass... [more]
K1QRE53.234e-3233.73Methyltransf_21 domain-containing protein OS=Crass... [more]
K1QT953.433e-2930.95Methyltransf_21 domain-containing protein OS=Crass... [more]
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransf_21 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071837.10.000e+099.31SMESG000071837.1[more]
SMESG000020353.10.000e+098.61SMESG000020353.1[more]
SMESG000043455.12.162e-5838.04SMESG000043455.1[more]
SMESG000040830.16.224e-5538.82SMESG000040830.1[more]
SMESG000035647.11.037e-4938.22SMESG000035647.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016106 ID=SMED30016106|Name=Methyltransf_21 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1079bp
TAAAAATTGTTTAAATTGATATTATATGTAATGTTCCCATTTAATTTATC
GAAACTGATTAGCGTATAAATATGATTTTGTATCAATTTAAACTCTGTTT
CATAATTTCAATCTTGTTTTCTAGCTTGTTTTTGATATGTCTCACTTACT
TCGTTACGAAATTAACGCCGAAATTGAGACTCATTAACTATAGGAAGGTC
TATTTCAATTCCACAAAAGCCTTCCTATATACAGCTAACCGGAAGCTAAT
AATATACGTTCATGGACCGCACGATTTGATATCCCACCACATTATCACTC
ATGGGATATGGGAAAAAGAATGGCAAACACAATTAAGCGAGTTCATTGTC
ACTAATAATCAGCTTCAATTATTGGATCTTGGATGTAATGTAGGAGTTTA
TACTTTGACCGCAGCTGCTTTGGGATGTCGAGTGGTTTCCATTGATGTCT
ATATGAAGAATCTGAATTTATTACAACAATCAGTAATATCAAACGGATTT
CAAGGCAGAGTTTGGTTGTTTTACAACGCGGTAAGTAACGTGAGAAAGGG
TTACAAGTTACAGGAAATTAAAGAAAACATCGGTGGGCAATACCTGTTGA
ATGCAAATGAAACCGAATCGACAGTTTACGGGGTCTACATTGATGATATC
GTTTCCTATTTTTTGAAGGATAAAGGCATCATCATCAAAATGGACATTCA
AGGATTCGAGATCAAAGCGATTGAAAAATCTAAACGACTGTTTAGTGAAA
GAAATGTTTTAGCGGTTTTAGTGGAATGGATTTGGATAAAAAACCATCCA
GATATTTTTATTTTCATTGCGTTTTTTATGACAAGATCTTATAATCCCTA
TTTAGATTTCAAATCTGTAATTCCTTTGAGTGTAGCAAAATACCGGAAAT
GGCCCACCGAAATTGTTTGGAGAAAATCTATCAATTAATATTTCAGAATT
TTTTCTATGAATGAAAGTTGCCATGGTAATGTTAGGATATGCCTTGCAGA
ATTTTAATCATCTGAGATTTTATTTACCAATTCGCTGCGATTAAGTAAAT
ATTGAATAACAATTTTTTTTTCATTTGAG
back to top

protein sequence of SMED30016106-orf-1

>SMED30016106-orf-1 ID=SMED30016106-orf-1|Name=SMED30016106-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=289bp
MILYQFKLCFIISILFSSLFLICLTYFVTKLTPKLRLINYRKVYFNSTKA
FLYTANRKLIIYVHGPHDLISHHIITHGIWEKEWQTQLSEFIVTNNQLQL
LDLGCNVGVYTLTAAALGCRVVSIDVYMKNLNLLQQSVISNGFQGRVWLF
YNAVSNVRKGYKLQEIKENIGGQYLLNANETESTVYGVYIDDIVSYFLKD
KGIIIKMDIQGFEIKAIEKSKRLFSERNVLAVLVEWIWIKNHPDIFIFIA
FFMTRSYNPYLDFKSVIPLSVAKYRKWPTEIVWRKSIN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR006342FkbM_mtfrase
IPR029063SAM-dependent_MTases
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006342Methyltransferase FkbMTIGRFAMTIGR01444TIGR01444coord: 100..227
e-value: 2.2E-14
score: 52.1
IPR006342Methyltransferase FkbMPFAMPF05050Methyltransf_21coord: 114..240
e-value: 4.3E-4
score: 20.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.150coord: 85..266
e-value: 4.0E-15
score: 57.7
NoneNo IPR availablePANTHERPTHR34203:SF3EXPRESSED PROTEINcoord: 64..283
NoneNo IPR availablePANTHERPTHR34203FAMILY NOT NAMEDcoord: 64..283
NoneNo IPR availableTMHMMTMhelixcoord: 7..29
IPR029063S-adenosyl-L-methionine-dependent methyltransferaseSUPERFAMILYSSF53335S-adenosyl-L-methionine-dependent methyltransferasescoord: 44..261