Gucy1b2 protein

Overview
NameGucy1b2 protein
Smed IDSMED30016104
Uniprot Best hitGuanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1 (E=1.32232e-96)
Length (bp)2311
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Gucy1b2 protein (SMED30016104) t-SNE clustered cells

Violin plots show distribution of expression levels for Gucy1b2 protein (SMED30016104) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Gucy1b2 protein (SMED30016104) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Gucy1b2 protein (SMED30016104) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016104

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tailSMED30016104SMESG000016261.1 SmedASXL_004260SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
tailSMED30016104SMESG000016261.1 dd_Smed_v6_15981_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tailSMED30016104SMESG000016261.1 dd_Smed_v6_12650_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30016104SMESG000016261.1 dd_Smed_v4_12650_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30016104SMESG000016261.1 dd_Smed_v4_12650_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016104SMESG000016261.1 dd_Smed_v4_15981_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30016104SMESG000016261.1 dd_Smed_v4_15981_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Gucy1b2 protein vs. Ensembl Human
Match: GUCY1A1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:4685])

HSP 1 Score: 166.007 bits (419), Expect = 5.163e-44
Identity = 107/370 (28.92%), Postives = 193/370 (52.16%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P+ P++  + P   FC+ FP+HF+FD+ M + Q G  I+ ++   DF+    +  +Y +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T  + +  +E     T D   ++        L    + + +K+ N  +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:   10 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQG-KPNFEEYFEILTPKINQ-TFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 368          
BLAST of Gucy1b2 protein vs. Ensembl Human
Match: GUCY1A1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:4685])

HSP 1 Score: 166.392 bits (420), Expect = 9.734e-43
Identity = 106/368 (28.80%), Postives = 192/368 (52.17%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYR 1958
            P+ P++  + P   FC+ FP+HF+FD+ M + Q G  I+ ++   DF+    +  +Y +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T  + +  +E     T D   ++        L    + + +K+ N  +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR
Sbjct:  268 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQG-KPNFEEYFEILTPKINQ-TFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYR 624          
BLAST of Gucy1b2 protein vs. Ensembl Human
Match: GUCY1A1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:4685])

HSP 1 Score: 166.392 bits (420), Expect = 1.659e-42
Identity = 107/370 (28.92%), Postives = 193/370 (52.16%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P+ P++  + P   FC+ FP+HF+FD+ M + Q G  I+ ++   DF+    +  +Y +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T  + +  +E     T D   ++        L    + + +K+ N  +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:  268 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQG-KPNFEEYFEILTPKINQ-TFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 626          
BLAST of Gucy1b2 protein vs. Ensembl Human
Match: GUCY1A1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:4685])

HSP 1 Score: 166.392 bits (420), Expect = 1.659e-42
Identity = 107/370 (28.92%), Postives = 193/370 (52.16%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P+ P++  + P   FC+ FP+HF+FD+ M + Q G  I+ ++   DF+    +  +Y +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T  + +  +E     T D   ++        L    + + +K+ N  +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:  268 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQG-KPNFEEYFEILTPKINQ-TFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 626          
BLAST of Gucy1b2 protein vs. Ensembl Human
Match: GUCY1A1 (guanylate cyclase 1 soluble subunit alpha 1 [Source:HGNC Symbol;Acc:HGNC:4685])

HSP 1 Score: 166.392 bits (420), Expect = 1.659e-42
Identity = 107/370 (28.92%), Postives = 193/370 (52.16%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P+ P++  + P   FC+ FP+HF+FD+ M + Q G  I+ ++   DF+    +  +Y +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T  + +  +E     T D   ++        L    + + +K+ N  +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:  268 PSKPQSSLVIPTSLFCKTFPFHFMFDKDMTILQFGNGIRRLMNRRDFQG-KPNFEEYFEILTPKINQ-TFSGIMTMLNMQFVVRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEQAHQALEEEKKKTVDLLCSIFPCEVAQQLWQGQVVQAKKFSNVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHKESDTHAVQIALMALKMMELSDEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 626          
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Match: gcy-35 (Soluble guanylate cyclase gcy-35 [Source:UniProtKB/Swiss-Prot;Acc:O02298])

HSP 1 Score: 211.46 bits (537), Expect = 2.129e-58
Identity = 152/583 (26.07%), Postives = 272/583 (46.66%), Query Frame = 3
Query:  348 NGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHV--MKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDV---------ETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHI--TAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRN 2051
             G ++LLR +   L  FL ++D +H        K  +  P F+ D +A G   + LHY+S R  L P+++ ++  +++  +                                 D    +  Q RK              +E ++    E+      + +  NANS    ++         L T      I   DF   FPYH  FD  + ++  G  I+   P+  R    +   L+L+HP    F++ES++    S  V  +K + + +    ++   + L+G M+ + E + IL+MCS  V+++ ++  + + +S++  HD T+       + +   S   L R    + +    +         +T +    L  AS    L +    + +++ +C +LF DIV F+ I     P +V+ +LN+++  FDRL  +H+  K+++IGDAY+IV G+ +     +ER+ NI++ M++ SK + SP  +     K   IR+G++CG ++ G++G   P++ + GD+V  A+KMES+GI  +IH+  T  +    A+  Y   +RG  EIRGKG  +TYFL RN
Sbjct:   81 TGWDELLRAMAPDLEGFLDSLDSLHYFIDHVVYKTKLRGPSFRCDVQADGT--LLLHYYSKRSGLYPIVKGVVREVARRIY---------------------------------DTEVVMKVQERK--------------QEHLDAFVTEH--VVFVITQIENANSTQPKSISSKADSQIDLST--GIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTFPNAMRQETRVTDLLELVHP-EVPFSYESIKYYKNSLFVFRLKGLGDIVHNANDEAKTVLLKGSMVFIDEGKYILYMCSVNVTTVRELIERNLHLSDMQRHDGTR---DVIMLNQSRMSQVELNRTLEETTKKLKKMAQELEIEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLNDLYLRFDRLVGLHDAYKVETIGDAYMIVGGVPERCENHAERVLNISIGMLMESKLVLSPITH-----KPIKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPSYVFIDRGNTEIRGKGMMYTYFLERN 601          
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Match: gcy-32 (Soluble guanylate cyclase gcy-32 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF7])

HSP 1 Score: 190.66 bits (483), Expect = 3.593e-51
Identity = 155/629 (24.64%), Postives = 290/629 (46.10%), Query Frame = 3
Query:  351 GNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQ------GER--HHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTI-PKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIP-DFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV------------------------IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGL-------INNSLREGRKYKNC----YILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRE-LASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRD 2093
            G ++L+R +  +L  FL N+D +H        KAN+  P F+ +    G   + LHYF+ R  L  +++ +++ ++K  F   + + +    Q+      GER   H+++         +I+N    +++ R+++E                        + + +  + NAN                 PTI   TL I   DF +  PYHFV D++  L Q G ++   IP +  +    I +  ++  P      FE++ N   +  V++V                        +D   T    Q   + L+GQM+ L   + I+++CSP V+S+N++ + GM+++ +P HD T+       + +   SD  +   N     +N  +ET      L    T S L       I   L  G   + C     ++FCD+  F   +    P ++++MLN I  + DR+  +  V K++++ D+Y+ VSGI D+  + +E + ++AL M+  ++++  P    + F    L+RIG++ G I  G++G+ +PK+ + G++V  AS+MES G+  +I  +   Y++ + +  ++   RG I+++ +G   TYFL R+L  S   ++   RD
Sbjct:   82 GWDELVRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEETPDGT--LLLHYFTGRPGLYHIVKGVVKEVAKRVFDLDITLVVQGRTQRSVHMNNGERVEEHVVF---------LINN----LSEPRRDSEG-----------------------SEVSLLTSTNAN----------------FPTIVDDTLGISLDDFSKALPYHFVIDESCKLVQCGSELHNHIPNELLQPGTPILRIFEINRP-QIPLDFENICNFINAVFVLQVKTSPLKKKHMDAMSQEELKQEMETLDEDATNELTQGHHLKLKGQMMLLASKKHIIYLCSPYVTSINELMQYGMRLTAMPLHDATR---DLILLNQQRLSDVEV---NLQLEANNEQLETMTRELELERQKTDSILKDMLPRRIAQQLLSGEHIEACEHEATVMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIVVIRGVYKVETVSDSYMAVSGIPDYTPEHAENMCHVALGMMWEARSVIDPVS-KTPF----LLRIGIHSGTITAGVVGTVHPKYCLFGETVTLASQMESLGMAGKIQCSKWAYQKAMETGRFEFSPRGRIDVKQRGLTETYFLTRSLKKSIWEIIDHDRD 644          
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Match: gcy-34 (Soluble guanylate cyclase gcy-34 [Source:UniProtKB/Swiss-Prot;Acc:P92006])

HSP 1 Score: 186.422 bits (472), Expect = 1.043e-49
Identity = 150/622 (24.12%), Postives = 283/622 (45.50%), Query Frame = 3
Query:  351 GNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIP-DFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKL-------------------------TTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGL-------INNSLREGRKYKNC----YILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMY-RELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDA 2096
            G ++L+R +  +L  FL N+D +H        KAN+  P F+ +    G   + LHYF+ R  L  +++ +++ ++K+ F   + + +    Q+        S+++ +   V ++   LI    KN E    + D T     +  +  ++GE                               I   L +  +DF    PYHFV D++  L Q G ++   IP +  +    I +  ++  P      FE++ N   +  V++V  + L                         +    Q   + L+GQM+ L   + I+++CSP V+S+N++ + GM+++ +P HD T+       + +   SD  +   N     +N  +ET  H   +    T S L       I   L  G   + C     ++FCD+  F  I+    P  ++ +LN +  + DR+  +  V K++++ D+Y+ VSGI D+ ++ +E + ++AL M+  ++++  P +         L+RIGL+ G II G++G+  P++ + G++V  AS+MES G+  +I  ++  Y + + +  ++   RG I ++G+G   TYFL R+L  S   +    RD 
Sbjct:   82 GWDELVRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEENPDGT--LMLHYFTGRPGLYHIVKGVVKEVAKLVFNLDISLVVQGRTQR--------SVHMNNGERVEEHVIFLI----KNVEEPRRDSD-TSTTSALTSVEPDFGE------------------------------IIDDNLKVSLQDFSRALPYHFVLDESCRLVQCGDELYNHIPNELLQPGTPILRIFEINRP-QIPLDFENICNFINAVFVLQVKTSPLRKKHMNAMTKEEREQEVEAMEEEVESNELTQGCHLKLKGQMMMLSTKKHIIYLCSPYVTSINELMQFGMRLTAMPLHDATR---DLILLNQQRLSDVEV---NLQLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQLLSGEHLEPCEYEATVMFCDLPAFQQIIPVCQPKNIVKLLNEVFFKLDRIVVLRGVYKVETVSDSYMTVSGIPDYTSEHAENMCHVALGMMWEARSVMDPVNKTP-----FLLRIGLHSGTIIAGVVGTKMPRYCLFGETVTLASQMESLGVAGKIQCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYFLMRSLKKSIWEITDHERDV 646          
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Match: gcy-36 (Soluble guanylate cyclase gcy-36 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF4])

HSP 1 Score: 185.267 bits (469), Expect = 2.584e-49
Identity = 152/626 (24.28%), Postives = 272/626 (43.45%), Query Frame = 3
Query:  348 NGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQ------GER--HHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIP-DFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVI--------------------------DNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNS-DVETYDHFATLAGASTMSGLINNSLREG-----RKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASS-HYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRD 2093
             G + L+R +  +L  FL N+D +H        KAN+  P F+ +    G   I LHY++ R  L P+++ +L   +K  FK  + + I    Q+      GER   H+++ +   +                            TDQ            E AL  A  +++N+         I  + M             DF   FPYH V DQ   + Q G ++   IP D   +   + +  ++  P      F+S+ N   +  V++V                           DN      +Q   + L+GQM+ +     I+++CSP V+S+ ++ + G++++ +P HD T+           D         NN   E+ + D+E             +   +   L++G     R+Y+   ++F D+  F  IV    P +++ +LN +  +FDRL  +    K++++GD+Y+ V GI D ++   E I ++AL M++ ++T+  P            IR G++ G ++ G++G+  P++ + GD+V T+S+MESH    RIH +    +   S+  ++ E RG ++I+GKG   TYFL R+   S   ++ + RD
Sbjct:   81 TGWDDLIRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEDNPDGT--ITLHYYTGRPGLYPIVKGVLREAAKRVFKLDVSMTITGRTQRSVQMATGERIEEHVIFLVKTLN----------------------------TDQS----------NEEALGTAVVQHSNN-------YKIRLTHM-------------DFISTFPYHMVVDQDCKIVQVGRELYNHIPKDLLSVGTPLMRIFEVTRP-QIPLDFDSICNFINAVFVLQVKTTPMEFQRNANKRAAQAIEASENLYEDNNGALALSQSQHLKLKGQMMLMSSGGHIMYLCSPYVTSIPELLQYGLRLTAMPIHDPTRDLILLNQQRLSDVEMNLQLEANNEQLENMAKDLEVEKGKTDALLREMLPPSVAQQLKQGLSVEAREYEEATVMFTDVPTFQQIVPLCTPKDIVHLLNELFTKFDRLIGIQKAYKVETVGDSYMSVGGIPDLVDDHCEVICHLALGMVMEARTVCDPIT-----NTPLHIRAGIHSGPVVAGVVGAKMPRYCLFGDTVNTSSRMESHSPIGRIHCSENAKKCAESTGRFEFEPRGRVQIKGKGEMNTYFLLRSFKRSIWEIIDRRRD 640          
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Match: gcy-37 (Soluble guanylate cyclase gcy-37 [Source:UniProtKB/Swiss-Prot;Acc:Q6DNF3])

HSP 1 Score: 171.785 bits (434), Expect = 1.139e-44
Identity = 138/611 (22.59%), Postives = 279/611 (45.66%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVD----FIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVEN------LFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQT--IGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH----YDMEERGCIEIRGKGRQFTYFLNRN 2051
            LG+  +   ++ GE  ++     G  ++L  +  +L EFL N++    FI  +A     K   P F+   E  G + ++LHYFS R+ L P+++ L+   ++  F+  +K+ +LE +Q+  +  ++                          EH I   +  D   K + +  ++          RN  +   A             T+  T+ +G +DF  +FPYH  F++ M+++  GI +        +  + +   +QL+ P+  Q T+++V +      +F   H  K  + +  ++      + L+G+M+ + +   I+F+CSP V+++ DI    + +S++P HD T+         I + + + K L        +   ++E             +  +I  +LR  +     ++ +C ++F DI  F TI  +  P E++ ++ ++ + FDR+   H   K+ S+ D+YLIV G+ +      E   N+AL ++  +K +  P        +   +RIG++CG ++ GI+    P+F V+G++V     + SH  P ++ ++ A+ R + + H    +     G +E++  G+  T+FL +N
Sbjct:   59 LGLSVDDMWEMYGEFLITHACETGWQKMLFCMANNLQEFLDNLNSMHYFIDQIAFKSEMKG--PTFQC--EPFGESGLKLHYFSFRQGLFPIVKGLVRKTARTLFEMDVKVCMLERNQERRKSGMV--------------------------EHVIFSVEPDDNHRKGKRLFHKF----------RNTKTTENAPSF----------TLSSTILVGLRDFKNIFPYHVCFNKQMIIEHIGIYLLREYGLENKKTLKVSDLMQLVQPSDIQLTYKNVLSYLNTLFIFQLKHHSKRNEVQEGSSEAFQQPLVLKGEMMPINDGNSIIFICSPHVTTVRDILNLKLYISDMPMHDATRDLVMLNQSRICQMELNKK-LEETMKKMKKMTEELEVKKSQTDRLLFEFVPPVIAEALRAAKTVPAQEFSDCSVIFTDIPDFFTISVNCSPTEIITVVTDLFHRFDRIIEKHKGYKVLSLMDSYLIVGGVPNANQYHCEDSLNLALGLLFEAKQVVVP-----KLERSVRLRIGVHCGPVVAGIVSQQKPRFCVLGNTVNVTKSICSHSSPGKVLVSNAV-RTMVTKHLKSIFVFNANGYLELQS-GKVLTHFLEKN 611          
BLAST of Gucy1b2 protein vs. Ensembl Fly
Match: Gycbeta100B (gene:FBgn0013973 transcript:FBtr0085753)

HSP 1 Score: 174.096 bits (440), Expect = 5.245e-45
Identity = 113/398 (28.39%), Postives = 207/398 (52.01%), Query Frame = 3
Query:  912 IGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTIVTSS----GPNEVLDMLNNIHNEFDRLT---RVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASS-----HYDMEERGCIEIRGKGRQF-TYFLNR 2048
            I P  FC++FP+H +FD+ M + Q+G  +  +IP     N  + + ++ I P H Q  FE++ +   + +V++     +++   Q   + L+GQM+ + E   ILF C P V +L+D+ +KG+ +S++P HD  +         + ++   K L    +   +   D+E+          S +   + N LR  R     +Y +  ++F  IV F     ++    G  +++ MLN ++  FD LT   R  NV K++++GD Y+ VSG+ DH    ++ +A +AL M+ ++K +K     GSN      I IG++ GE++ G+IG+  P++ + G++V   S+ E+ G+P RI+++   YR L  +      + +E RG + ++GK      +FL R
Sbjct:  328 ISPATFCKVFPFHLMFDRQMKIVQAGKAVSRVIPRVAEENCSLIEVVEAIRP-HLQLNFENILSHINTIYVLQTRQGAMSSRHEQR-FLRLKGQMMYIPETDRILFQCYPSVMNLDDLTKKGLYISDVPLHDAARDLVLLSEKFEAEYKLTKNLEMLTDKLQQTFRDLESEKQKTDRLLYSVLPKSVANELRHQRPVPPKRYDSVTLMFSGIVGFGQYCAANTDPDGAMKIVKMLNELYTVFDALTDSKRNLNVYKVETVGDKYMAVSGLPDHCEDHAKCMARVALDMMDMAKNVK----MGSN---PVQITIGIHSGEVVTGVIGNRVPRYCLFGNTVNLTSRTETTGVPGRINVSEETYRLLCMAINQDDSFHLEYRGPVIMKGKPTPMDCWFLTR 716          

HSP 2 Score: 58.5362 bits (140), Expect = 1.880e-8
Identity = 41/152 (26.97%), Postives = 75/152 (49.34%), Query Frame = 3
Query:  240 EAIVKNIMPIKIFHLGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVI 683
            + I  N++   +  L I  +  L+L G+ +    Q +G +++L+VLG +  +FLQN+D +H      YP    P F+  TE  G   + LHY+S R  L  ++  +++A++       ++I I+    E   + E+   +   N Q L D +
Sbjct:   45 DEITYNLIGAAVEILNIPADDILELFGKTFFEFCQDSGYDKILQVLGATPRDFLQNLDALHDHLGTLYPGMRAPSFRC-TEKDGE--LLLHYYSERPGLEHIVIGIVKAVASKLHGVEVEIDIVKRKGEPIDEAEKERAIARENQQLLEDAV 193          
BLAST of Gucy1b2 protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0110961)

HSP 1 Score: 166.777 bits (421), Expect = 2.746e-42
Identity = 145/612 (23.69%), Postives = 273/612 (44.61%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEA-QGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVEN-------LFCSPHVMKVIDNKLTTTANQDD------EIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQT---------IGKGDWSDKFLGRDNNTSGED--NSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFL 2042
            LG+ E  F+  +G  ++  +   G +++L VLG+ + +FL  +D +H      YP+   P F  + E  QG   + LHY S R+         +  +++ F+ K + I+++ E+   +  H+ + L   + A  + +    +A TR+                          E  LP++               ++++  + P            FC       VF   M+++  G  +  I+P+   +   I  +  L+ P    F F+++ N       L     V +  D +       +D       + L+GQM+ +   + I+F+ +P++  L  +   G+ ++++  HD ++      T         + +     K L        E+   +D   Y             G   N +     + +  ILF DIV F+ I +   P EV+ MLN +++ FD+LT  ++V K+++IGDAY++V+G  D     +ER+ ++AL M+     +K P     + G+   IR+G++ G ++ GI+G   P++ + GD+V TAS+MES  I  ++HI+ +  + L   +Y + ERG I+++GKG   TY+L
Sbjct:   58 LGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQG---LTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLAS----LAMTRE--------------------------EKHLPIS--------------AHVLF-EIFP------------FC------MVFGADMVVRSIGNSLMVILPEL--LGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRG--ENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDP-----STGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWL 592          
BLAST of Gucy1b2 protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0306245)

HSP 1 Score: 166.777 bits (421), Expect = 2.746e-42
Identity = 145/612 (23.69%), Postives = 273/612 (44.61%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEA-QGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVEN-------LFCSPHVMKVIDNKLTTTANQDD------EIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQT---------IGKGDWSDKFLGRDNNTSGED--NSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFL 2042
            LG+ E  F+  +G  ++  +   G +++L VLG+ + +FL  +D +H      YP+   P F  + E  QG   + LHY S R+         +  +++ F+ K + I+++ E+   +  H+ + L   + A  + +    +A TR+                          E  LP++               ++++  + P            FC       VF   M+++  G  +  I+P+   +   I  +  L+ P    F F+++ N       L     V +  D +       +D       + L+GQM+ +   + I+F+ +P++  L  +   G+ ++++  HD ++      T         + +     K L        E+   +D   Y             G   N +     + +  ILF DIV F+ I +   P EV+ MLN +++ FD+LT  ++V K+++IGDAY++V+G  D     +ER+ ++AL M+     +K P     + G+   IR+G++ G ++ GI+G   P++ + GD+V TAS+MES  I  ++HI+ +  + L   +Y + ERG I+++GKG   TY+L
Sbjct:   58 LGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQG---LTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLAS----LAMTRE--------------------------EKHLPIS--------------AHVLF-EIFP------------FC------MVFGADMVVRSIGNSLMVILPEL--LGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRG--ENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDP-----STGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWL 592          
BLAST of Gucy1b2 protein vs. Ensembl Fly
Match: Gyc88E (gene:FBgn0038295 transcript:FBtr0334926)

HSP 1 Score: 166.777 bits (421), Expect = 2.823e-42
Identity = 145/612 (23.69%), Postives = 273/612 (44.61%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEA-QGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVEN-------LFCSPHVMKVIDNKLTTTANQDD------EIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQT---------IGKGDWSDKFLGRDNNTSGED--NSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFL 2042
            LG+ E  F+  +G  ++  +   G +++L VLG+ + +FL  +D +H      YP+   P F  + E  QG   + LHY S R+         +  +++ F+ K + I+++ E+   +  H+ + L   + A  + +    +A TR+                          E  LP++               ++++  + P            FC       VF   M+++  G  +  I+P+   +   I  +  L+ P    F F+++ N       L     V +  D +       +D       + L+GQM+ +   + I+F+ +P++  L  +   G+ ++++  HD ++      T         + +     K L        E+   +D   Y             G   N +     + +  ILF DIV F+ I +   P EV+ MLN +++ FD+LT  ++V K+++IGDAY++V+G  D     +ER+ ++AL M+     +K P     + G+   IR+G++ G ++ GI+G   P++ + GD+V TAS+MES  I  ++HI+ +  + L   +Y + ERG I+++GKG   TY+L
Sbjct:   58 LGVSERDFMDQMGVYFVGFVGQYGYDRVLSVLGRHMRDFLNGLDNLHEYLKFSYPRMRAPSFICENETKQG---LTLHYRSKRRGFVYYTMGQIREVARYFYHKEMHIELVREEILFDTVHVTFQLTFDNRAFTLAS----LAMTRE--------------------------EKHLPIS--------------AHVLF-EIFP------------FC------MVFGADMVVRSIGNSLMVILPEL--LGKKITAWFDLVRPL-IAFKFQTILNRTNNIFELVTVDPVTERFDVQNEDLLQHEDGSEPEKSLRLKGQMVYMENWRMIMFLGTPVMPDLTSLITTGLYINDLSMHDFSRDLMLAGTQQSVELKLALDQEQQKSKKLEESMRLLDEEMRRTDELLYQMIPKQVADRLRRG--ENPIDTCEMFDSVSILFSDIVTFTEICSRITPMEVVSMLNAMYSIFDKLTERNSVYKVETIGDAYMVVAGAPDKDANHAERVCDMALDMVDAITDLKDP-----STGQHLRIRVGVHSGAVVAGIVGLKMPRYCLFGDTVNTASRMESTSIAMKVHISEST-KVLIGPNYKIIERGEIDVKGKGTMGTYWL 592          
BLAST of Gucy1b2 protein vs. Ensembl Fly
Match: Gycalpha99B (gene:FBgn0013972 transcript:FBtr0085453)

HSP 1 Score: 128.257 bits (321), Expect = 2.472e-30
Identity = 129/554 (23.29%), Postives = 239/554 (43.14%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAII-PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDV-----ETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMI-LISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHIT 1943
            L LLGE  ++        +  R LG  L EFL ++D ++ +   K  + ++     DT         L + S R  ++ ++   L+A++++ +K  + I+I   +    R+  L+SL       V DN  T++     +    I E                       V R+ ++N+   + L+MN                    FC++FP+HF+ ++ + L Q G     +  P           Y     P      F  +     +P ++  ++N           + ++GQM+   E+  +LF+ SP +  L+ +   G+ +S+IP HD T+         +  D   + + +  N+  E NS V     +       +  A     L   S  + + Y +  ILF DIV F++I + + P  V+ ML  ++ +FD      +V K+++IGDAY + SG+       + ++A +AL MI   SK I       ++ G++  +RIGL+ G ++ G++G   P++ + G SV  A+K ES     +I+++
Sbjct:  114 LVLLGEELITCCCTGIIERAFRCLGTDLQEFLGSLDGVYDVL--KLQEEDV----TDTGFVCAGEGELIFTSERPVIAWLLLGSLKALTRMLYKVDVNIKIEPVEGDARRYRYLFSL-------VKDNSQTMLMGRPTSVSKTIPET----------------------VQRSNSSNA---SDLQMN-----------------SSSFCKMFPWHFIMNEQLELVQLGRGFSKLYKPYMADFGCQATTYFDFKRPKGLTMKFRDIVRRTYTPFLIG-LNNPPGAVDFPAIGLEIKGQMVHCPESNSLLFIGSPFLDGLDGLTCNGLFISDIPLHDATREVILVGEQARAQDGLRRRMDKIKNSIEEANSAVTKERKKNVSLLHLIFPAEIAEKLWLGSSIDAKTYPDVTILFSDIVGFTSICSRATPFMVISMLEGLYKDFDEFCDFFDVYKVETIGDAYCVASGLHRASIYDAHKVAWMALKMIDACSKHI-------THDGEQIKMRIGLHTGTVLAGVVGRKMPRYCLFGHSVTIANKFESGSEALKINVS 604          
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 338.191 bits (866), Expect = 2.532e-104
Identity = 194/614 (31.60%), Postives = 339/614 (55.21%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKN-AEHQIEEKDVTDQKEKIEMIRKEYGEAAL-PVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH-YDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLG 2081
            L +  E  LKL GE + S  + +G + +LR LG +L+EF++N+D +H+     Y   N P F+V+    G   I LHY+S RK L  ++  ++EA++K FF   + + IL    E+++ G++ H+++ + +Q      +      AQTR+N +E +I E    D++E +  ++  Y    L P  R+     R    L    +     P+ PKTL I  + FC  FP+H VFD  +++K +G+ IQ  +P  +   + + +Y  ++HP    F  +S++    S  V+K     L         + LRGQM+ +    C++++CSP + SL ++E +G+ +++I  HD T+     + Q + + + S++ L R        + ++E     +     + +   + N L+EG++     +K C ILF D+V F+ I  +  P ++++MLN +++ FDRLT +HNV K+++IGDAY++V G+    N  +ER+AN AL M + ++ + +P       G+   IR+GL+ G ++ G++G   P++ + GD+V TAS+MESHG+PD IH++   +  +     ++M ERG IE++GKG   TYFL +NL  SD  ++G
Sbjct:   57 LDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEAMNAPSFRVERMDDG--RILLHYYSDRKGLYHIVPGIIEAVAKDFFDSEVTMTILNQSEEDERTGKKEHVVFHM-VQK-----EKVTKRKAQTRQNNSEEEILEVK-KDKEETMRRMKARYANLQLCPRKRSPWELVRSIVMLGQGNLRQSFTPSYPKTLWIEEQAFCNAFPFHIVFDSDLVVKHTGVNIQKFVPGLQTAGIRLDEYFTIVHP-EVIFNIQSIKKFINSQFVLKTRREMLPEVQQNQPTLKLRGQMMWMESLNCMIYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQ-LERKKEELRILSRNLEIEKQKSEKLLYAMLPTHVANQLKEGKRVEAGEFKVCTILFSDVVTFTNICAACEPIQIVNMLNAMYSRFDRLTSIHNVYKVETIGDAYMVVGGVPVPTNTHAERVANFALGMRIAAREVTNPIT-----GQPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHVSPFTFSVIKDKGIFEMAERGEIEVKGKGLMRTYFLLKNLQKSDEQIMG 654          
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 165.236 bits (417), Expect = 1.264e-42
Identity = 115/411 (27.98%), Postives = 204/411 (49.64%), Query Frame = 3
Query:  912 IGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTT-TANQDDEIY--------LRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYR-----ELASSHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            I P  FC+ FP+H +FD+ ++L Q G  I  ++P  +    ++     L+ P H  F+F  + +   +  V++  +  L   TA  +DE+         L+GQMI L E + ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+       ++ G  +++++LN+I+  FD LT       V K++++GD Y+ VSG+ +     ++ I ++AL M+ I+  +K   D          I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR     E A   + +E RG + ++GK      +FL+R
Sbjct:  202 ISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRP-HIDFSFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDED-------PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFLSR 600          

HSP 2 Score: 61.6178 bits (148), Expect = 2.713e-9
Identity = 33/121 (27.27%), Postives = 69/121 (57.02%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQD 668
            L++ G+ +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+  T+A+  N + LHY+S R+ L  ++  +++ +++      +++++++   + E  HI + +  +D
Sbjct:   61 LQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRC-TDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSE-ECDHIKFLIEEKD 179          
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 165.236 bits (417), Expect = 1.374e-42
Identity = 115/411 (27.98%), Postives = 204/411 (49.64%), Query Frame = 3
Query:  912 IGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTT-TANQDDEIY--------LRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYR-----ELASSHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            I P  FC+ FP+H +FD+ ++L Q G  I  ++P  +    ++     L+ P H  F+F  + +   +  V++  +  L   TA  +DE+         L+GQMI L E + ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+       ++ G  +++++LN+I+  FD LT       V K++++GD Y+ VSG+ +     ++ I ++AL M+ I+  +K   D          I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR     E A   + +E RG + ++GK      +FL+R
Sbjct:  208 ISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRP-HIDFSFHGILSHINTVFVLRSKEGLLNVETAENEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVDED-------PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFHLEYRGPVTMKGKKEPMKVWFLSR 606          

HSP 2 Score: 61.6178 bits (148), Expect = 2.616e-9
Identity = 33/121 (27.27%), Postives = 69/121 (57.02%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQD 668
            L++ G+ +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+  T+A+  N + LHY+S R+ L  ++  +++ +++      +++++++   + E  HI + +  +D
Sbjct:   67 LQMFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRC-TDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQPKSE-ECDHIKFLIEEKD 185          
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Match: GUCY1A2 (guanylate cyclase 1, soluble, alpha 2 [Source:NCBI gene;Acc:100330875])

HSP 1 Score: 143.665 bits (361), Expect = 2.719e-35
Identity = 98/364 (26.92%), Postives = 179/364 (49.18%), Query Frame = 3
Query:  897 PKTLSIGPKDFCELFPYHFVFDQAMLLKQ--SGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P  L IG   FC  FP+H V    M + Q   G++ QA     R +        +L+ P     +F+++     +P  ++   +  ++   ++  + L+GQM+ L E+  I+F+ SP V  L ++  +G+ +S+IP HD T+         K  D   K + +   T  + +  +E     T D   ++        L      + +K+ +  +LF DIV F+ +     P +V+ MLN ++  FD    + +V KI++IGDAY +  G+   I+  ++ IA +AL M+ +S+ + +P       GK   +RIG++ G ++ G++G   P++ + G++V  ASK ES   P  I+++   Y+ L
Sbjct:  211 PLDLRIGLSTFCRAFPFHLVLGSNMEVLQVGEGLRKQAKTDPHRTLTFS--NSFELVSP-RIPCSFQNILLRLSTPFTIRTRPDG-SSLDCREKVMELKGQMLHLPESNSIMFLGSPRVDRLEELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLEKTHQALEEEKRRTVDLLYSIFPGDVAQRLWQGLPVQAKKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHRKIDSHAKPIALMALKMMELSEEVLTPD------GKPIKLRIGIHSGSVLAGVVGVMMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLL 564          
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Match: si:ch211-215j19.12 (si:ch211-215j19.12 [Source:ZFIN;Acc:ZDB-GENE-141212-103])

HSP 1 Score: 125.946 bits (315), Expect = 8.739e-33
Identity = 64/179 (35.75%), Postives = 112/179 (62.57%), Query Frame = 3
Query: 1512 ILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQR-SERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH-YDMEERGCIEIRGKGRQFTYFL 2042
            I F DIV F+ I  S  P +V++MLNN++  FD     ++V K+++IGDAY++VSG+ +    R ++ IA ++L ++   + +  P+       KR  +R G++ G  + G++G   P++ + GD+V TAS+MES  +P +IH ++A Y  L   + Y+++ RG +E++GKG+  TY+L
Sbjct:    3 IFFSDIVGFTAISASCTPLQVVEMLNNLYMCFDTRIDSYDVYKVETIGDAYMVVSGLPERNGDRHADEIAKMSLDLVAAVRQVPIPH----MPTKRLQLRAGIHTGPCVAGVVGYKMPRYCLFGDTVNTASRMESTSLPQKIHASSATYLALMKDNAYELQLRGEVEVKGKGKMDTYWL 177          
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Match: ank1 (ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516])

HSP 1 Score: 330.102 bits (845), Expect = 1.014e-102
Identity = 191/593 (32.21%), Postives = 328/593 (55.31%), Query Frame = 3
Query:  348 NGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNP--PTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKT 2087
            +G + +LR LG  L EF+ N+D +H+     Y + N P F+V  E  G   + LHY+S R+ L  ++  ++ A++  FFK  + ++I+    EE++ G++ HI++ L  Q  A     P  P L+++  KN   +       D+K ++         +  PV +   A  R    L    M     P  PK L +  + FC+  P+H VFD+ + +KQ+G+ IQ I+P  +   + + +Y   +HP     T  +V     S  V +     +  +      + LRGQMI + + +C+L++CSP++ +L+++E + M +S+I  HDVT+     + Q + + + S++ L R        +  +E       L   + +   + N L+EG++     +K C ILF D+V F+ I     P +++ MLN+++  FDRLT VH+V K+++IGDAY++V G+   ++  +ER+AN AL MIL++K +K+P +     G    IR+GL+ G ++ G++G   P++ + GD+V TAS+MESHG+P++IHI+  +YR L   +++M ERG I+++GKGR  TYFL RN    +N +LG+ 
Sbjct:    2 SGYDHMLRTLGGDLYEFIANLDALHSYLSLSYQEMNAPSFRV--EMNGDGSMHLHYYSDRRGLCHIVPGIMGAVAMDFFKTEISMEIISQSDEEERTGKKEHIVF-LVTQKPAFPPKCPTKPPLVSRGIKNKSFENPYNKYRDRKNQV---------SVCPVKKNHWAMIRGIVQLGKGRMLRGFRPVYPKDLCVDVETFCKGLPFHIVFDEELRIKQAGVSIQKIVPGLQTTGIRLDQYFSTVHP-EVTLTISNVRKFINSQFVFRTKREMMPESWRDRPMLELRGQMIWMEKLECMLYLCSPLLRTLHELEERQMHISDIAPHDVTRDLILLNQQRLAEMELSNQ-LERKKEELRILSKHLEEEKKKTELLLYAMLPKHVANQLKEGKRVEAGEFKECTILFSDVVTFTNICAQCEPIQIVFMLNSMYLRFDRLTTVHDVYKVETIGDAYMVVGGVPVPVSSHAERVANFALGMILMAKQVKNPVN-----GNPIQIRVGLHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPNKIHISPTVYRYLKGKNFEMTERGEIDVKGKGRMRTYFLIRNSSAKENEILGQA 575          
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 186.808 bits (473), Expect = 6.943e-50
Identity = 153/620 (24.68%), Postives = 279/620 (45.00%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDE---------IYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-----SHYDMEERGCIEIRGKGRQF-TYFLNRNLDVSDN 2069
            L++ G  +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+     +G   I LHY+S R+ L  ++  +++ +++      + +++                 IQ   +  D+   LI       E    E+D  + +++ E    E G             SR                       I P  FC+ FP+H +FD+ + + Q G  I  ++P  +  N ++     L+ P H   +F  + +   +  V++  +  L    ++ ++         + L+GQMI L E   ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+T      +  G  +++++LN+I+  FD LT   N   V K++++GD Y+ VSGI +     +  I ++AL M+ I+  ++         G+   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L S       + ++ RG + ++GK      +FL+R    ++N
Sbjct:   67 LQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLI-LHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKV-----------------IQQRNEECDHTQFLIE------EKDTREEDFYEDQDRFE----ENG----------TQESR-----------------------ISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRP-HIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVD-------GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFLSRKAAETEN 613          
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 186.037 bits (471), Expect = 1.146e-49
Identity = 152/613 (24.80%), Postives = 276/613 (45.02%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDE---------IYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-----SHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            L++ G  +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+     +G   I LHY+S R+ L  ++  +++ +++      + +++                 IQ   +  D+   LI       E    E+D  + +++ E    E G             SR                       I P  FC+ FP+H +FD+ + + Q G  I  ++P  +  N ++     L+ P H   +F  + +   +  V++  +  L    ++ ++         + L+GQMI L E   ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+T      +  G  +++++LN+I+  FD LT   N   V K++++GD Y+ VSGI +     +  I ++AL M+ I+  ++         G+   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L S       + ++ RG + ++GK      +FL+R
Sbjct:   67 LQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLI-LHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKV-----------------IQQRNEECDHTQFLIE------EKDTREEDFYEDQDRFE----ENG----------TQESR-----------------------ISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRP-HIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVD-------GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFLSR 606          
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 186.037 bits (471), Expect = 1.233e-49
Identity = 152/613 (24.80%), Postives = 276/613 (45.02%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDE---------IYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-----SHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            L++ G  +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+     +G   I LHY+S R+ L  ++  +++ +++      + +++                 IQ   +  D+   LI       E    E+D  + +++ E    E G             SR                       I P  FC+ FP+H +FD+ + + Q G  I  ++P  +  N ++     L+ P H   +F  + +   +  V++  +  L    ++ ++         + L+GQMI L E   ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+T      +  G  +++++LN+I+  FD LT   N   V K++++GD Y+ VSGI +     +  I ++AL M+ I+  ++         G+   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L S       + ++ RG + ++GK      +FL+R
Sbjct:   67 LQMFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLI-LHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKV-----------------IQQRNEECDHTQFLIE------EKDTREEDFYEDQDRFE----ENG----------TQESR-----------------------ISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRP-HIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVD-------GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFLSR 606          
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Match: GUCY1B1 (guanylate cyclase 1 soluble subunit beta 1 [Source:NCBI gene;Acc:100379900])

HSP 1 Score: 181.03 bits (458), Expect = 3.802e-48
Identity = 151/638 (23.67%), Postives = 283/638 (44.36%), Query Frame = 3
Query:  312 LLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDE---------IYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDW---------SDKF------LGRDNNTSGEDNSDVE-------TYDHFAT----------LAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-----SHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            + G  +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+     +G   I LHY+S R+ L  ++  +++ +++      + +++                 IQ   +  D+   LI       E    E+D  + +++ E                 N     +                     I P  FC+ FP+H +FD+ + + Q G  I  ++P  +  N ++     L+ P H   +F  + +   +  V++  +  L    ++ ++         + L+GQMI L E   ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++         +D+       L  +   +  +N +V+       ++ +F+T          +   S +   + N LR  R     +Y N  ILF  IV F+T      +  G  +++++LN+I+  FD LT   N   V K++++GD Y+ VSGI +     +  I ++AL M+ I+  ++         G+   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L S       + ++ RG + ++GK      +FL+R
Sbjct:    1 MFGNMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRCTDAEKGKGLI-LHYYSEREGLQDIVIGIVKTVAQQIHGTEIDMKV-----------------IQQRNEECDHTQFLIE------EKDTREEDFYEDQDRFE----------------ENGTQESR---------------------ISPYTFCKAFPFHIMFDRDLFVTQCGNAIYRVLPQLQPGNCNLLSVFSLVRP-HIDISFHGILSHINTVFVLRSKEGLLDVEKSESEDELTGTEISCLRLKGQMIYLPEADNILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDTENINVKFDQKPLYSFPNFSTEFFFCIHPAQVLLYSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASGEGAMKIVNLLNDIYTRFDILTDSRNNPYVYKVETVGDKYMTVSGIPEPCVHHARSICHLALDMMEIAGQVQVD-------GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPQFHLQYRGPVSMKGKTDPMQVWFLSR 569          
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 322.013 bits (824), Expect = 1.382e-97
Identity = 184/615 (29.92%), Postives = 331/615 (53.82%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANS---RWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK 2084
            L +  E  LKL GE +    + +G +++LR LG +L EF++N+D +H+     Y + N P F+V+  A G   +RLHY+S R+ L  ++  ++EA++K FF   + + IL    E ++ G++ H+++         V+      I   + N     E      +  +  ++RK+    ++PV     ++S   R    L    +     P  P+ L I  + FC  FP+H VFD+A+ +KQ+G+ IQ  +P        + +Y  ++HP    F   S+     S  ++K     +         + LRGQMI +   +C++FMCSP + SL ++E   M +S+I  HD T+     + Q + + + S +   +        N          TL  A  +   + N L+EG+K     ++ C ILF D+V F+ I  +  P ++++MLN+++++FDRLT +H+V K+++IGDAY++V G+   +   ++R+AN AL M + +K + +P       G+   IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+++H++   +R L +  +++  RG IE++GKG+  TYFL RNL+ ++  ++G+
Sbjct:  138 LDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGA--MRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEVERTGKKEHVVFL--------VVQKARRQIRGAKVNRPRDSENIQAKQESLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHP-QVTFNISSICKFINSQFILKTRREMMPEAWKSQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYA-MLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVT-----GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFLIRNLNATEVEIMGR 735          
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Match: Gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:MGI Symbol;Acc:MGI:2660873])

HSP 1 Score: 317.775 bits (813), Expect = 3.640e-96
Identity = 185/615 (30.08%), Postives = 331/615 (53.82%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANS---RWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK 2084
            L +  E  LKL GE +    + +G +++LR LG +L EF++N+D +H+     Y + N P F+V+  A G   +RLHY+S R+ L  ++  ++EA++K FF   + + IL    E ++ G++ H+++                L+ Q    A  QI       +  +  ++RK+    ++PV     ++S   R    L    +     P  P+ L I  + FC  FP+H VFD+A+ +KQ+G+ IQ  +P        + +Y  ++HP    F   S+     S  ++K     +         + LRGQMI +   +C++FMCSP + SL ++E   M +S+I  HD T+     + Q + + + S +   +        N          TL  A  +   + N L+EG+K     ++ C ILF D+V F+ I  +  P ++++MLN+++++FDRLT +H+V K+++IGDAY++V G+   +   ++R+AN AL M + +K + +P       G+   IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+++H++   +R L +  +++  RG IE++GKG+  TYFL RNL+ ++  ++G+
Sbjct:  138 LDVSMEAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEGGADGA--MRLHYYSDRRGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEVERTGKKEHVVF----------------LVVQ---KARRQIRGA----KSLQGTLLRKKERYLSIPVCPGEKSHSAVVRASVLLGKGPLGDTFQPVFPERLWIEEEVFCNAFPFHVVFDEALRVKQAGVNIQKYVPGILTQKFGLDEYFSIVHP-QVTFNISSICKFINSQFILKTRREMMPEAWKSQPTLKLRGQMIWMESLKCMVFMCSPKLRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYA-MLPEHVANQLKEGKKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTNIHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVT-----GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAHRALENKGFEIVTRGEIEVKGKGKMTTYFLIRNLNATEVEIMGR 720          
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Match: Gucy1b1 (guanylate cyclase 1, soluble, beta 1 [Source:MGI Symbol;Acc:MGI:1860604])

HSP 1 Score: 160.614 bits (405), Expect = 4.984e-41
Identity = 148/630 (23.49%), Postives = 275/630 (43.65%), Query Frame = 3
Query:  270 KIFHLGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTT---------TANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDW---------SDKF-LGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH-----YDMEERGCIEIRGKGRQF-TYFLNR 2048
            K+ +L   E   L++ G+ +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+     +G   I LHY+S R+ L  ++  +++ +++      + +++                 IQ   +  D+   LI       E + +E+D  +  ++ E    E G        +R +   +  A   +I++ R L                            ++ Q G  I  ++P  +  N  +     L+ P H   +F  + +   +  V++  +  L           T  +   + L+GQMI L E   ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++         +D+  L        +  +D   Y         S +   + N LR  R     +Y N  ILF  IV F+       +  G  +++++LN+++  FD LT       V K++++GD Y+ VSG+ +     +  I ++AL M+ I+  ++         G+   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L S       + +E RG + ++GK      +FL+R
Sbjct:   57 KVLNLNAGE--ILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQNLDALHDHLATIYPGMRAPSFRCTDAEKGKGLI-LHYYSEREGLQDIVIGIIKTVAQQIHGTEIDMKV-----------------IQQRNEECDHTQFLI------EEKESKEEDFYEDLDRFE----ENG-----TQESRISPYTFCKAFPFHIIFDRNL----------------------------VVTQCGNAIYRVLPQLQPGNCSLLSVFSLVRP-HIDISFHGILSHINTVFVLRSKEGLLDVEKLECEDELTGAEISCLRLKGQMIYLPEADSILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQLTLRALEDEKKKTDTLLY---------SVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASGEGAMKIVNLLNDLYTRFDTLTDSRKNPFVYKVETVGDKYMTVSGLPEPCIHHARSICHLALDMMEIAGQVQVD-------GESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLMSPENSDPLFHLEHRGPVSMKGKKEPMQVWFLSR 606          
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Match: Gucy1a1 (guanylate cyclase 1, soluble, alpha 1 [Source:MGI Symbol;Acc:MGI:1926562])

HSP 1 Score: 157.918 bits (398), Expect = 8.850e-40
Identity = 103/370 (27.84%), Postives = 190/370 (51.35%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P  P++  + P   FC+ FP+HF+ D+ + + Q G  I+ ++   DF+    +  ++ +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T    +  +E     T D   ++  +     L    + + +K+    +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:  268 PGKPQSSLVIPASLFCKTFPFHFMLDRDLAILQLGNGIRRLVNKRDFQG-KPNFEEFFEILTPKINQ-TFSGIMTMLNMQFVIRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEEEKKRTVDLLCSIFPSEVAQQLWQGQIVQAKKFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHRESDTHAVQIALMALKMMELSNEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 626          
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Match: Gucy1a1 (guanylate cyclase 1, soluble, alpha 1 [Source:MGI Symbol;Acc:MGI:1926562])

HSP 1 Score: 157.918 bits (398), Expect = 8.850e-40
Identity = 103/370 (27.84%), Postives = 190/370 (51.35%), Query Frame = 3
Query:  888 PTIPKTLSIGPKD-FCELFPYHFVFDQAMLLKQSGIQIQAII--PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV--IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P  P++  + P   FC+ FP+HF+ D+ + + Q G  I+ ++   DF+    +  ++ +++ P   Q TF  +  +     V++V   DN +  ++   D   L+GQMI ++E+  ILF+ SP V  L D   +G+ +S+IP H+  +         +  D   K LG+   T    +  +E     T D   ++  +     L    + + +K+    +LF DIV F+ I +   P +V+ MLN ++  FD+     +V K+++IGDAY +  G+    +  + +IA +AL M+ +S  + SP+      G+   +RIGL+ G +  G++G   P++ + G++V  A+K ES  +P +I+++   YR L
Sbjct:  268 PGKPQSSLVIPASLFCKTFPFHFMLDRDLAILQLGNGIRRLVNKRDFQG-KPNFEEFFEILTPKINQ-TFSGIMTMLNMQFVIRVRRWDNSVKKSSRVMD---LKGQMIYIVESSAILFLGSPCVDRLEDFTGRGLYLSDIPIHNALRDVVLIGEQARAQDGLKKRLGKLKATLEHAHQALEEEKKRTVDLLCSIFPSEVAQQLWQGQIVQAKKFSEVTMLFSDIVGFTAICSQCSPLQVITMLNALYTRFDQQCGELDVYKVETIGDAYCVAGGLHRESDTHAVQIALMALKMMELSNEVMSPH------GEPIKMRIGLHSGSVFAGVVGVKMPRYCLFGNNVTLANKFESCSVPRKINVSPTTYRLL 626          
BLAST of Gucy1b2 protein vs. UniProt
Match: sp|P22717|GCYB2_RAT (Guanylate cyclase soluble subunit beta-2 OS=Rattus norvegicus OX=10116 GN=Gucy1b2 PE=2 SV=1)

HSP 1 Score: 318.161 bits (814), Expect = 1.322e-96
Identity = 187/614 (30.46%), Postives = 336/614 (54.72%), Query Frame = 3
Query:  297 EPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKE-KIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSR------MLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK 2084
            E  LKL GE +    + +G +++LR LG +L EF++N+D +H+     Y + N P F+V+  A G   + LHY+S R  L  ++  ++EA++K FF   + + IL    E ++ G++ H+++ L +Q     I        +  K +  Q  E    DQ+  +  ++R +     +PV     ++S    A++ ++++ +        P  P+ L +  + FC+ FP+H VFD+A+ +KQ+G+ IQ  +P        + +Y  +IHP    F   S+     S  V+K     +         + LRGQMI +   +C++FMCSP V SL ++E   M +S+I  HD T+     + Q + + + S +   +        N          TL  A  +   + N L+EGRK     ++ C ILF D+V F+ I  +  P ++++MLN+++++FDRLT VH+V K+++IGDAY++V G+   +   ++R+AN AL M + +K + +P       G+   IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P ++H++   +R L +  +++  RG IE++GKG+  TYFL +NL+ +++ ++G+
Sbjct:    2 EAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVEEGADGA--MLLHYYSDRHGLCHIVPGIIEAVAKDFFDTDVAMSILDMNEEVERTGKKEHVVF-LVVQKAHRQI--------RGAKASRPQGSEDSQADQEALQGTLLRMKERYLNIPVCPGEKSHS---TAVRASVLFGKGPLRDTFQPVYPERLWVEEEVFCDAFPFHIVFDEALRVKQAGVNIQKYVPGILTQKFALDEYFSIIHP-QVTFNISSICKFINSQFVLKTRKEMMPKARKSQPMLKLRGQMIWMESLRCMIFMCSPNVRSLQELEESKMHLSDIAPHDTTRDLILLNQQRLAEMELSCQLEKKKEELRVLSNHLAIEKKKTETLLYA-MLPEHVANQLKEGRKVAAGEFETCTILFSDVVTFTNICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGVPVPVESHAQRVANFALGMRISAKEVMNPVT-----GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPSKVHLSPTAHRALKNKGFEIVRRGEIEVKGKGKMTTYFLIQNLNATEDEIMGR 594          
BLAST of Gucy1b2 protein vs. UniProt
Match: sp|O75343|GCYB2_HUMAN (Guanylate cyclase soluble subunit beta-2 OS=Homo sapiens OX=9606 GN=GUCY1B2 PE=5 SV=2)

HSP 1 Score: 314.694 bits (805), Expect = 4.209e-96
Identity = 179/597 (29.98%), Postives = 325/597 (54.44%), Query Frame = 3
Query:  348 NGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFE--SVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAV 2099
            +G +++LR LG +L+EF++N+D +H+     Y + N P F+V+  A G  +  LHY+S R  L  ++  ++EA++K FF   + + IL    E ++ G++ H+++ +  +    +    P      R      +E      Q   ++M  K    +A PV ++     R         + +   P  P+ L I  K FC  FP+H VFD+++ +KQ+ + IQ  +P  +  N+ + +Y  +IHP   Q TF   S+     S  V+K     +         + L+GQMI +    C++++CSP + SL ++E   M +S+I  +D T+     + Q + + + S++   +                   TL  A  +   + N LREG+K     +K+C ILF D+V F+ I T+  P +++++LN+++++FDRLT VH V K+++IGDAY++V G+   I   ++R+AN AL M + +K + +P       G+   +R+G++ G ++  ++G   P++ + GD+V TAS+MESHG+P+++H++   YR L +  + + ERG IE++GKGR  TYFL +NL+ +++ ++G+++  V
Sbjct:    2 SGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERGADGKMF--LHYYSDRSGLCHIVPGIIEAVAKDFFDIDVIMDILDMNEEVERTGKKEHVVFLIVQKAHRKMRKTKPK-----RLQDSQGMERDQEALQAAFLKMKEKYLNVSACPVKKSHWDVVRSIVMFGKGHLMNTFEPIYPERLWIEEKTFCNAFPFHIVFDESLQVKQARVNIQKYVPGLQTQNIQLDEYFSIIHP---QVTFNIFSIRRFINSQFVLKTRREMMPVAWQSRTTLKLQGQMIWMESMWCMVYLCSPKLRSLQELEELNMHLSDIAPNDTTRDLILLNQQRLAEIELSNQLERKKEELQVLSKHLAIEKKKTETLLYA-MLPKHVANQLREGKKVAAGEFKSCTILFSDVVTFTNICTACEPIQIVNVLNSMYSKFDRLTSVHAVYKVETIGDAYMVVGGVPVPIGNHAQRVANFALGMRISAKEVTNPVT-----GEPIQLRVGIHTGPVLADVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALKNQGFKIIERGEIEVKGKGRMTTYFLIQNLNATEDEIMGRSKTPV 582          
BLAST of Gucy1b2 protein vs. UniProt
Match: sp|O02298|GCY35_CAEEL (Soluble guanylate cyclase gcy-35 OS=Caenorhabditis elegans OX=6239 GN=gcy-35 PE=1 SV=3)

HSP 1 Score: 211.46 bits (537), Expect = 2.708e-57
Identity = 152/583 (26.07%), Postives = 272/583 (46.66%), Query Frame = 3
Query:  348 NGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHV--MKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDV---------ETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHI--TAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRN 2051
             G ++LLR +   L  FL ++D +H        K  +  P F+ D +A G   + LHY+S R  L P+++ ++  +++  +                                 D    +  Q RK              +E ++    E+      + +  NANS    ++         L T      I   DF   FPYH  FD  + ++  G  I+   P+  R    +   L+L+HP    F++ES++    S  V  +K + + +    ++   + L+G M+ + E + IL+MCS  V+++ ++  + + +S++  HD T+       + +   S   L R    + +    +         +T +    L  AS    L +    + +++ +C +LF DIV F+ I     P +V+ +LN+++  FDRL  +H+  K+++IGDAY+IV G+ +     +ER+ NI++ M++ SK + SP  +     K   IR+G++CG ++ G++G   P++ + GD+V  A+KMES+GI  +IH+  T  +    A+  Y   +RG  EIRGKG  +TYFL RN
Sbjct:   81 TGWDELLRAMAPDLEGFLDSLDSLHYFIDHVVYKTKLRGPSFRCDVQADGT--LLLHYYSKRSGLYPIVKGVVREVARRIY---------------------------------DTEVVMKVQERK--------------QEHLDAFVTEH--VVFVITQIENANSTQPKSISSKADSQIDLST--GIYEISSSDFSLAFPYHICFDPDLFVEHFGNFIKKTFPNAMRQETRVTDLLELVHP-EVPFSYESIKYYKNSLFVFRLKGLGDIVHNANDEAKTVLLKGSMVFIDEGKYILYMCSVNVTTVRELIERNLHLSDMQRHDGTR---DVIMLNQSRMSQVELNRTLEETTKKLKKMAQELEIEKQKTDELLCELMPASVADSLRSGKAMDAKEFADCTLLFTDIVTFTNICAMCTPYDVVTLLNDLYLRFDRLVGLHDAYKVETIGDAYMIVGGVPERCENHAERVLNISIGMLMESKLVLSPITH-----KPIKIRLGVHCGPVVAGVVGIKMPRYCLFGDTVNVANKMESNGIQCKIHVSETGKLNGLKANPSYVFIDRGNTEIRGKGMMYTYFLERN 601          
BLAST of Gucy1b2 protein vs. UniProt
Match: sp|Q6DNF7|GCY32_CAEEL (Soluble guanylate cyclase gcy-32 OS=Caenorhabditis elegans OX=6239 GN=gcy-32 PE=2 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 4.571e-50
Identity = 155/629 (24.64%), Postives = 290/629 (46.10%), Query Frame = 3
Query:  351 GNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQ------GER--HHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTI-PKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIP-DFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKV------------------------IDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGL-------INNSLREGRKYKNC----YILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRE-LASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRD 2093
            G ++L+R +  +L  FL N+D +H        KAN+  P F+ +    G   + LHYF+ R  L  +++ +++ ++K  F   + + +    Q+      GER   H+++         +I+N    +++ R+++E                        + + +  + NAN                 PTI   TL I   DF +  PYHFV D++  L Q G ++   IP +  +    I +  ++  P      FE++ N   +  V++V                        +D   T    Q   + L+GQM+ L   + I+++CSP V+S+N++ + GM+++ +P HD T+       + +   SD  +   N     +N  +ET      L    T S L       I   L  G   + C     ++FCD+  F   +    P ++++MLN I  + DR+  +  V K++++ D+Y+ VSGI D+  + +E + ++AL M+  ++++  P    + F    L+RIG++ G I  G++G+ +PK+ + G++V  AS+MES G+  +I  +   Y++ + +  ++   RG I+++ +G   TYFL R+L  S   ++   RD
Sbjct:   82 GWDELVRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEETPDGT--LLLHYFTGRPGLYHIVKGVVKEVAKRVFDLDITLVVQGRTQRSVHMNNGERVEEHVVF---------LINN----LSEPRRDSEG-----------------------SEVSLLTSTNAN----------------FPTIVDDTLGISLDDFSKALPYHFVIDESCKLVQCGSELHNHIPNELLQPGTPILRIFEINRP-QIPLDFENICNFINAVFVLQVKTSPLKKKHMDAMSQEELKQEMETLDEDATNELTQGHHLKLKGQMMLLASKKHIIYLCSPYVTSINELMQYGMRLTAMPLHDATR---DLILLNQQRLSDVEV---NLQLEANNEQLETMTRELELERQKTDSILKDMLPRRIAQQLLSGEHIEACEHEATVMFCDLPAFQQAIPQCSPKDIVNMLNEIFRKLDRIVVIRGVYKVETVSDSYMAVSGIPDYTPEHAENMCHVALGMMWEARSVIDPVS-KTPF----LLRIGIHSGTITAGVVGTVHPKYCLFGETVTLASQMESLGMAGKIQCSKWAYQKAMETGRFEFSPRGRIDVKQRGLTETYFLTRSLKKSIWEIIDHDRD 644          
BLAST of Gucy1b2 protein vs. UniProt
Match: sp|P92006|GCY34_CAEEL (Soluble guanylate cyclase gcy-34 OS=Caenorhabditis elegans OX=6239 GN=gcy-34 PE=2 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 1.326e-48
Identity = 150/622 (24.12%), Postives = 283/622 (45.50%), Query Frame = 3
Query:  351 GNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANI--PFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIP-DFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKL-------------------------TTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGL-------INNSLREGRKYKNC----YILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMY-RELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDA 2096
            G ++L+R +  +L  FL N+D +H        KAN+  P F+ +    G   + LHYF+ R  L  +++ +++ ++K+ F   + + +    Q+        S+++ +   V ++   LI    KN E    + D T     +  +  ++GE                               I   L +  +DF    PYHFV D++  L Q G ++   IP +  +    I +  ++  P      FE++ N   +  V++V  + L                         +    Q   + L+GQM+ L   + I+++CSP V+S+N++ + GM+++ +P HD T+       + +   SD  +   N     +N  +ET  H   +    T S L       I   L  G   + C     ++FCD+  F  I+    P  ++ +LN +  + DR+  +  V K++++ D+Y+ VSGI D+ ++ +E + ++AL M+  ++++  P +         L+RIGL+ G II G++G+  P++ + G++V  AS+MES G+  +I  ++  Y + + +  ++   RG I ++G+G   TYFL R+L  S   +    RD 
Sbjct:   82 GWDELVRSMSPNLKGFLDNLDSLHYFIDHVVYKANLRGPSFRCEENPDGT--LMLHYFTGRPGLYHIVKGVVKEVAKLVFNLDISLVVQGRTQR--------SVHMNNGERVEEHVIFLI----KNVEEPRRDSD-TSTTSALTSVEPDFGE------------------------------IIDDNLKVSLQDFSRALPYHFVLDESCRLVQCGDELYNHIPNELLQPGTPILRIFEINRP-QIPLDFENICNFINAVFVLQVKTSPLRKKHMNAMTKEEREQEVEAMEEEVESNELTQGCHLKLKGQMMMLSTKKHIIYLCSPYVTSINELMQFGMRLTAMPLHDATR---DLILLNQQRLSDVEV---NLQLEANNEQLETMTHELEVERQKTDSILKDMLPRKIAKQLLSGEHLEPCEYEATVMFCDLPAFQQIIPVCQPKNIVKLLNEVFFKLDRIVVLRGVYKVETVSDSYMTVSGIPDYTSEHAENMCHVALGMMWEARSVMDPVNKTP-----FLLRIGLHSGTIIAGVVGTKMPRYCLFGETVTLASQMESLGVAGKIQCSSWTYSKAMETGRFEFSPRGRINVKGRGDVETYFLMRSLKKSIWEITDHERDV 646          
BLAST of Gucy1b2 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|20271378 (tr|A0A5P8I4I8|A0A5P8I4I8_SCHMD Gucy1b2 protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 861.677 bits (2225), Expect = 0.000e+0
Identity = 410/414 (99.03%), Postives = 412/414 (99.52%), Query Frame = 3
Query:  861 MNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 2102
            MNIMYSRMLPTIPK LSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENL CSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVH+VQKIDS+GDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY
Sbjct:    1 MNIMYSRMLPTIPKALSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLLCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHDVQKIDSVGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 414          
BLAST of Gucy1b2 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|27593355 (tr|A0A4X1SP69|A0A4X1SP69_PIG Guanylate cyclase domain-containing protein OS=Sus scrofa OX=9823 PE=3 SV=1)

HSP 1 Score: 356.295 bits (913), Expect = 8.103e-109
Identity = 196/619 (31.66%), Postives = 340/619 (54.93%), Query Frame = 3
Query:  297 EPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRML-----PTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSG-EDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 2102
            E  LKL GE +    + +G +++LR LG +L EF++N+D +H+     Y + N P F+V+  A     + LHY+S R  L  ++  ++EA++K FF   + ++IL    EE++  ++ H+++                LI Q       + + KD    +E +E       E  L V+      SRW+   ++ +   R L     P  P+ L I  + FC  FP+H VFD ++ +KQ+G+ IQ  IP  R   + +  Y  ++HP    F   S+     SP V+K    +L         + LRGQMI +   +C++++CSP + SL ++E + M +S+I  HD T+     + Q + + + S++   +         +  +E     A L   + +   + N L+EGRK     +K C ILF D+V F+TI  +  P ++++MLN+++++FDRLT VH+V K+++IGDAY++V G+   I   ++R+AN AL M L +K + +P       G+   IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+++H++   YR L +  +++ ERG IE++GKG+  TYFL RN++ S++ L+G+ R  ++
Sbjct:    2 EAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVERAAD--EKMLLHYYSDRSGLCHIVPGIIEAVAKDFFDVDVTLEILDVHQEEERTAKKEHVVF----------------LIVQKSHRQMRRAKPKDSQRDQEALEAAFLRMKEKYLSVSVCPVKKSRWEVVRRIVMFGKRHLRNTFEPIYPERLWIEERTFCNAFPFHLVFDASLRVKQAGVNIQKYIPGLRTPKIRLDTYFSIVHPP-VAFDIFSICQFINSPFVLKARGERLPEAGRSRPPLKLRGQMIWMESTRCMVYLCSPKLRSLRELEERQMHLSDIAPHDTTRDLILLNQQRLAEMELSNQLERKKEELRVLSKHLAIEKKKTEALLY--AMLPKHVANQLKEGRKVAAGEFKTCTILFSDVVTFTTICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGVPVPIGSHAQRVANFALGMRLSAKEVMNPVT-----GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALENQGFEITERGEIEVKGKGKMTTYFLIRNVNASEDELMGRPRTPLH 594          
BLAST of Gucy1b2 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|27558415 (tr|I3LIP7|I3LIP7_PIG Guanylate cyclase domain-containing protein OS=Sus scrofa OX=9823 GN=LOC100625149 PE=3 SV=2)

HSP 1 Score: 356.295 bits (913), Expect = 8.912e-109
Identity = 196/619 (31.66%), Postives = 340/619 (54.93%), Query Frame = 3
Query:  297 EPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRML-----PTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSG-EDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 2102
            E  LKL GE +    + +G +++LR LG +L EF++N+D +H+     Y + N P F+V+  A     + LHY+S R  L  ++  ++EA++K FF   + ++IL    EE++  ++ H+++                LI Q       + + KD    +E +E       E  L V+      SRW+   ++ +   R L     P  P+ L I  + FC  FP+H VFD ++ +KQ+G+ IQ  IP  R   + +  Y  ++HP    F   S+     SP V+K    +L         + LRGQMI +   +C++++CSP + SL ++E + M +S+I  HD T+     + Q + + + S++   +         +  +E     A L   + +   + N L+EGRK     +K C ILF D+V F+TI  +  P ++++MLN+++++FDRLT VH+V K+++IGDAY++V G+   I   ++R+AN AL M L +K + +P       G+   IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+++H++   YR L +  +++ ERG IE++GKG+  TYFL RN++ S++ L+G+ R  ++
Sbjct:    2 EAILKLFGEYFFKFCKMSGYDRMLRTLGGNLTEFIENLDALHSYLALSYQEMNAPSFRVERAAD--EKMLLHYYSDRSGLCHIVPGIIEAVAKDFFDVDVTLEILDVHQEEERTAKKEHVVF----------------LIVQKSHRQMRRAKPKDSQRDQEALEAAFLRMKEKYLSVSVCPVKKSRWEVVRRIVMFGKRHLRNTFEPIYPERLWIEERTFCNAFPFHLVFDASLRVKQAGVNIQKYIPGLRTPKIRLDTYFSIVHPP-VAFDIFSICQFINSPFVLKARGERLPEAGRSRPPLKLRGQMIWMESTRCMVYLCSPKLRSLRELEERQMHLSDIAPHDTTRDLILLNQQRLAEMELSNQLERKKEELRVLSKHLAIEKKKTEALLY--AMLPKHVANQLKEGRKVAAGEFKTCTILFSDVVTFTTICAACEPIQIVNMLNSMYSKFDRLTSVHDVYKVETIGDAYMVVGGVPVPIGSHAQRVANFALGMRLSAKEVMNPVT-----GEPIQIRVGIHTGPVLAGVVGDKMPRYCLFGDTVNTASRMESHGLPNKVHLSPTAYRALENQGFEITERGEIEVKGKGKMTTYFLIRNVNASEDELMGRPRTPLH 594          
BLAST of Gucy1b2 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|174984753 (tr|W5MSK3|W5MSK3_LEPOC Guanylate cyclase 1, soluble, beta 2 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 4.995e-107
Identity = 196/618 (31.72%), Postives = 346/618 (55.99%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMY------SRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK 2084
            L +  E  LKL GE + S  + +G +++LR LG +L+EF++N+D +H+     Y + N P F+V+    G   + LHY+S R+ L  ++  ++EA++K FF   + + IL    EE++ G++ H+++ L IQ    ++         T  +  H  E   V  QK K +        +ALP    R   + W+  L+  +M+      S   P  P  L I  K FC  FP+H VFD A+ +KQSG+ IQ  +P  + +++ + +Y  +IHP    FT +S++    S  V+K     +  ++     + LRGQM+ +    C++++CSP + SL ++E +GM +++I  HD T+     + Q + + + S++ L R        +  +E           + +   + N L+EG+K     +K C ILF D+V F+ I  +  P ++++MLN+++++FDRLT +H+V K+++IGDAY++V G+    +  +ER+AN AL M + ++ + +P       G    IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+ IH++   YR L +  +++ ERG IE++GKGR  T+FL +NL  S++ ++G+
Sbjct:   57 LNVSSEVVLKLFGEYFFSFCKMSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERREDGK--MLLHYYSDRRGLCHIVPGIIEAVAKDFFNSQVSMTILNQSEEEERTGKKEHVVF-LVIQK-THLVKRKARPAGGTSTDKTHDKECAQVLLQKMKAKY-------SALPHCSGRR--THWEI-LRSIVMFGQGNLVSSFTPFYPSKLWIEEKAFCNAFPFHIVFDGALRVKQSGVNIQKFVPGLQTMDIQLNEYFSIIHP-QVTFTIDSIKKFINSQFVLKTRREMMPESSKNQPMLKLRGQMLWMDALGCMVYLCSPKLRSLQELEERGMHIADIAQHDTTRDLILLNQQRLAEIELSNQ-LERKKEELRILSRTLEVEKKKTETLLYAMLPRHVANQLKEGKKVEAGEFKECTILFSDVVTFTYICAACEPIQIVNMLNSMYSKFDRLTSIHDVYKVETIGDAYMVVGGVPIPADSHAERVANFALGMRIAAREVTNPIT-----GDPIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPNHIHLSPTSYRALENKGFEISERGEIEVKGKGRMSTFFLLKNLQASEDEIMGR 653          
BLAST of Gucy1b2 protein vs. TrEMBL
Match: gnl|BL_ORD_ID|175029414 (tr|W5MSL5|W5MSL5_LEPOC Guanylate cyclase 1, soluble, beta 2 OS=Lepisosteus oculatus OX=7918 PE=3 SV=1)

HSP 1 Score: 350.903 bits (899), Expect = 6.881e-107
Identity = 195/618 (31.55%), Postives = 349/618 (56.47%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMY------SRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK 2084
            L +  E  LKL GE + S  + +G +++LR LG +L+EF++N+D +H+     Y + N P F+V+    G   + LHY+S R+ L  ++  ++EA++K FF   + + IL    EE++ G++ H+++ L IQ    ++         T  +  H  EE +     E +  ++ +Y  +ALP    R   + W+  L+  +M+      S   P  P  L I  K FC  FP+H VFD A+ +KQSG+ IQ  +P  + +++ + +Y  +IHP    FT +S++    S  V+K     +  ++     + LRGQM+ +    C++++CSP + SL ++E +GM +++I  HD T+     + Q + + + S++ L R        +  +E           + +   + N L+EG+K     +K C ILF D+V F+ I  +  P ++++MLN+++++FDRLT +H+V K+++IGDAY++V G+    +  +ER+AN AL M + ++ + +P       G    IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P+ IH++   YR L +  +++ ERG IE++GKGR  T+FL +NL  S++ ++G+
Sbjct:    2 LNVSSEVVLKLFGEYFFSFCKMSGYDRMLRTLGGNLMEFIENLDALHSYLALSYQEMNAPSFRVERREDGK--MLLHYYSDRRGLCHIVPGIIEAVAKDFFNSQVSMTILNQSEEEERTGKKEHVVF-LVIQK-THLVKRKARPAGGTSTDKTHDKEEME-----EALRKMKAKY--SALPHCSGRR--THWEI-LRSIVMFGQGNLVSSFTPFYPSKLWIEEKAFCNAFPFHIVFDGALRVKQSGVNIQKFVPGLQTMDIQLNEYFSIIHP-QVTFTIDSIKKFINSQFVLKTRREMMPESSKNQPMLKLRGQMLWMDALGCMVYLCSPKLRSLQELEERGMHIADIAQHDTTRDLILLNQQRLAEIELSNQ-LERKKEELRILSRTLEVEKKKTETLLYAMLPRHVANQLKEGKKVEAGEFKECTILFSDVVTFTYICAACEPIQIVNMLNSMYSKFDRLTSIHDVYKVETIGDAYMVVGGVPIPADSHAERVANFALGMRIAAREVTNPIT-----GDPIQIRVGIHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPNHIHLSPTSYRALENKGFEISERGEIEVKGKGRMSTFFLLKNLQASEDEIMGR 598          
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 324.709 bits (831), Expect = 1.125e-99
Identity = 185/615 (30.08%), Postives = 329/615 (53.50%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEE----DQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRD 2093
            L +  E  LKL GE + S  + +G + +LR LG +L+EF++N+D +H+     Y + N P F+V+    G     LHY+S RK L  ++  ++EA++K FF   + + ILE+    ++ G+R H+++                L+ QT + A+   EE  +      +E                       +  +  +I +S   P  PK L I  + FC  FP+H VFDQ +++K +G+ IQ  +P  ++    + +Y  ++HP        S++    S  V+K     L  +      + LRGQM+ +    C++++CSP + SL ++E +G+ +++I  HD T+     + Q + + + S++ L R        + ++E           + +   + N L+EG+K     +K C ILF D+V F+ I  +  P +++ MLN++++ FDRLT VH+V K+++IGDAY++V G+    +  +ER+AN AL M + ++ + +P       GK   IR+GL+ G ++ G++G   P++ + GD+V TAS+MESHG+PD IH++   Y  L    +++ ERG I+++GKG   TYFL +NL +S++ ++G+ ++
Sbjct:   63 LDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTL--LHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIF----------------LMTQTSEGAKG--EEAHLNGGDGTVE-----------------------RKVMSDHIQHS-FCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHP-EVTLNIHSIKKFINSQFVLKTRREMLPESLQNQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQ-LERKKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPIT-----GKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFLIQNLQLSEDQIMGRGKE 626          
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 324.324 bits (830), Expect = 1.435e-99
Identity = 185/615 (30.08%), Postives = 329/615 (53.50%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEE----DQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRD 2093
            L +  E  LKL GE + S  + +G + +LR LG +L+EF++N+D +H+     Y + N P F+V+    G     LHY+S RK L  ++  ++EA++K FF   + + ILE+    ++ G+R H+++                L+ QT + A+   EE  +      +E                       +  +  +I +S   P  PK L I  + FC  FP+H VFDQ +++K +G+ IQ  +P  ++    + +Y  ++HP        S++    S  V+K     L  +      + LRGQM+ +    C++++CSP + SL ++E +G+ +++I  HD T+     + Q + + + S++ L R        + ++E           + +   + N L+EG+K     +K C ILF D+V F+ I  +  P +++ MLN++++ FDRLT VH+V K+++IGDAY++V G+    +  +ER+AN AL M + ++ + +P       GK   IR+GL+ G ++ G++G   P++ + GD+V TAS+MESHG+PD IH++   Y  L    +++ ERG I+++GKG   TYFL +NL +S++ ++G+ ++
Sbjct:   57 LDVSSEVVLKLFGEYFFSFCKMSGYDTMLRTLGGNLVEFIENLDALHSYLALSYEEMNAPSFRVERTNDGRTL--LHYYSDRKGLHYIVPGIIEAVAKDFFGSKVTMTILEQPKEQERTGKREHVIF----------------LMTQTSEGAKG--EEAHLNGGDGTVE-----------------------RKVMSDHIQHS-FCPRYPKRLWIEEQAFCNAFPFHIVFDQNLVVKHTGVNIQKFVPGLQKTGCRLDEYFSVVHP-EVTLNIHSIKKFINSQFVLKTRREMLPESLQNQTMLKLRGQMVWMESLHCMVYLCSPKLRSLQELEERGLHLADIAQHDTTRDLILLNQQRLAEIELSNQ-LERKKEELRILSRNLEVEKKKTETLLYAMLPRHVANQLKEGKKVDAGEFKVCTILFSDVVTFTNICAACEPIQIVHMLNSMYSRFDRLTNVHDVYKVETIGDAYMVVGGVPIPKDTHAERVANFALGMRIAAREVTNPIT-----GKPIQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSPFTYSALKDKMFEIRERGEIQVKGKGLMDTYFLIQNLQLSEDQIMGRGKE 620          
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Match: ENSAMXT00000013658.2 (pep primary_assembly:Astyanax_mexicanus-2.0:17:5336467:5343990:1 gene:ENSAMXG00000013166.2 transcript:ENSAMXT00000013658.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 306.22 bits (783), Expect = 2.692e-93
Identity = 184/614 (29.97%), Postives = 328/614 (53.42%), Query Frame = 3
Query:  306 LKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQIL----EEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRML-----PTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSF--QTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGK-TRDA 2096
            LKL GE +    + +G + ++R LG +L EF++N+D +H      Y + N P F+V+  + G   + LHY+S R+ L  ++  ++ A++K FF   ++++I+    E ++ G++ H+++ L  Q   D I +  T       ++  Q  +K    +  K+  I K+ G+                   + N+ +S  L     P  P  L I  K FC  FP+H VFD+ + ++Q+G+ +Q I+P  + + + + +Y  ++HP    FT  S+     S  V++     +  +      +   G  +    +       SP++ SL ++E + M +S+I  HD T++      Q + + + S + L R      + +  +E           + +   + N L+EG+K     +K C ILF D+V F+TI +   P +++ MLN+++ +FDRLT VHNV K+++IGDAY++V G+   ++   ER+AN AL MI+ SK + +P   G        IR+GL+ G ++ G++G   P++ + GD+V TAS+MESHG+PD+IH++  +Y  L    + +EERG I+++GKGR  TYFL +NL  +++ ++G+ TR+A
Sbjct:    7 LKLFGEYFFEFCKRSGYDHMMRTLGANLFEFIENLDALHGYLSISYKEMNAPSFRVEKNSDGT--MLLHYYSDRRGLCHIVPGIIGAVAKDFFNSRIEMKIVNQMEEVERTGKKEHVVF-LITQHFPDKICSKST-------SSPSQQTQKPSGCRHNKVH-INKQVGD-------------------EYNLFFSGKLLRGFEPVYPNELCIDLKTFCNAFPFHIVFDEELRVRQAGVAVQKIVPGLQTMGIQLDQYFTILHP-EVTFTIASIRKFINSHFVLQTRREMMPESWKDTPMLECCGWPL----SAACSTRASPLLRSLQELEERRMYLSDIAPHDATRHLILLNQQRLAEMELSSQ-LERKKEELRQLSQHLEQEKQKTENLLYAMLPKHVANQLKEGKKVEAGEFKECTILFSDVVTFTTICSQCEPIQIVIMLNSMYLKFDRLTTVHNVYKVETIGDAYMVVGGVPIPVSSHGERVANFALGMIIASKEVTNPITGGP-----IQIRVGLHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPDKIHVSPNVYYALRDKGFQLEERGEIDVKGKGRMRTYFLVKNLRATESEIMGRWTREA 579          
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Match: gucy1b1 (guanylate cyclase 1 soluble subunit beta 1 [Source:ZFIN;Acc:ZDB-GENE-090313-160])

HSP 1 Score: 162.54 bits (410), Expect = 2.918e-42
Identity = 112/406 (27.59%), Postives = 201/406 (49.51%), Query Frame = 3
Query:  912 IGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTT-TANQDDEIY--------LRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTIVT----SSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL-----ASSHYDMEERGCIEIRGKGRQF-TYFLNR 2048
            I P  FC+ FP+H +FD+ ++L Q G  I  ++P  +    ++     L+ P H  F+F  + +   +  V++  +  L    A  +DE+         L+GQMI L E + ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++           + E     +   H         +   + N LR  R     +Y N  ILF  IV F+   +    + G  +++++LN+I+ +FD LT       V K++++GD Y+ VSG+ +     ++ I ++AL M+ I+  +K   +          I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR L     A   +++E RG I ++GK      +FL+R
Sbjct:  140 ISPYTFCKAFPFHLMFDKDLMLTQCGNAIFRVLPQLQPGVCNLSSVFSLVRP-HIDFSFHGILSHINTVFVLRSKEGLLNVEMAECEDELTGTEISCLRLKGQMISLPETENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEY---------KLTQELEILTDLLPHPIITPTTPLLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNAFCSKHASAEGAIKIVNLLNDIYTKFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAQSICHLALDMMEIAGQVKVDEE-------PVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQSVENADPQFNLEYRGPITMKGKKEPMKVWFLSR 528          

HSP 2 Score: 60.4622 bits (145), Expect = 5.058e-9
Identity = 32/119 (26.89%), Postives = 68/119 (57.14%), Query Frame = 3
Query:  312 LLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQD 668
            + G+ +    Q +G + +LRVLG ++ EFLQN+D +H      YP    P F+  T+A+  N + LHY+S R+ L  ++  +++ +++      ++++++++  + E  HI + +  +D
Sbjct:    1 MFGKMFFEFCQESGYDTILRVLGSNVREFLQNLDALHDHLGTIYPGMRAPSFRC-TDAEKGNNLILHYYSEREGLQDIVIGIIKTVAQQIHGTEIEMKVIQQKSE-ECDHIKFLIEEKD 117          
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Match: GUCY1A2 (guanylate cyclase 1 soluble subunit alpha 2 [Source:HGNC Symbol;Acc:HGNC:4684])

HSP 1 Score: 142.51 bits (358), Expect = 4.668e-36
Identity = 97/365 (26.58%), Postives = 175/365 (47.95%), Query Frame = 3
Query:  897 PKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRIN--VDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIY-LRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREG-----RKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL 1964
            P  L IG   FC   P+H V   +M + Q G  ++ +    R+ +  +      QL+ P     +F+++     +P  ++   +  T  ++    +  L+GQMI L E+  I+F+ SP V  L ++  +G+ +S+IP HD T+         K  D   K + +   T    +  +E           S   G +   L +G     +K+ +  +LF DIV F+ +     P +V+ MLN ++  FD    V +V KI++IGDAY + +G+       +  IA +AL M+ +S+ + +P        K   +RIG++ G ++ G++G   P++ + G++V  ASK ES   P  ++++   Y+ L
Sbjct:   11 PSDLRIGLSTFCRACPFHLVIGPSMEVLQVGEGLRQVGEGLRKPHRTLSFSDSFQLVSP-RIPCSFQNILLRLATPFTIRTRPDASTKKSSLCFSVMELKGQMIHLPESNSIMFLGSPRVDRLEELMGRGLHLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKRRTVELLYSIFPGGVAQRLWQGLPVQAKKFDDVTMLFSDIVGFTAVCAQCTPMQVISMLNELYTRFDYQCGVLDVYKIETIGDAYCVAAGLHKKCESHARPIALMALKMMELSEEVLTPD------AKPIQLRIGIHSGSVLAGVVGVKMPRYCLFGNNVTLASKFESGSKPRCVNVSPTTYQLL 368          
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Match: gucy1b2 (guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;Acc:ZDB-GENE-130530-664])

HSP 1 Score: 231.491 bits (589), Expect = 2.743e-69
Identity = 129/379 (34.04%), Postives = 215/379 (56.73%), Query Frame = 3
Query:  975 LKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSG-EDNSDVETYDHFATLAGASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKT 2087
            +KQ+G+ IQ  +P  + +++ + +Y  + HP    FT ES+     S  V+K     L         + LRGQM+ +  ++ +L++CSP++ SL ++E + + +S+I  HD T+     + Q + + + S +   +         N  VE     A L   + +   + N L+EG+K     +K C ILF D+V F+ I     P +++ MLN ++  FDRLT VHNV K+++IGDAY++V G+   +   +ER+AN AL M+L ++ + +P       G    IR+G++ G ++ G++G   P++ + GD+V TAS+MESHG+P RIH++ +    L    +D+EERG IE++GKGR  TYFL  N  V +  +LG+T
Sbjct:    3 VKQAGVNIQKFVPGLQTMDIRLDEYFTIGHP-EVTFTIESIRKFINSQFVLKTRREMLPEARRSQPMLDLRGQMVWMEGSRSMLYLCSPLLRSLEELEERQLHISDIAPHDATRDLILLNQQRLAEMELSTQLERKKEELRVLSKNLQVEKKKTEALLY--AMLPHHVANQLKEGKKVEAGEFKVCTILFSDVVTFTNICAVCEPIQIVHMLNAMYMRFDRLTTVHNVYKVETIGDAYMVVGGVPIPVPSHAERVANFALGMVLAAREVTNPVT-----GSAIQIRVGIHSGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGLPGRIHLSPSTREALQGKEFDVEERGEIEVKGKGRMSTYFLLGNRSVGEQEILGRT 373          
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002650.1 (pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 gene:ENSPMAG00000002416.1 transcript:ENSPMAT00000002650.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 119.783 bits (299), Expect = 1.045e-28
Identity = 66/207 (31.88%), Postives = 120/207 (57.97%), Query Frame = 3
Query: 1449 STMSGLINNSLREGR-----KYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGI-LDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHI---TAAMYRELASSHYDMEERGCIEIRGKGRQFTYFL 2042
            S +   I + LR+GR      Y +  + F DIV F+ + +SS P EV+D LN ++  FD +   ++V K+++IGDAY++VSG+  ++ NQ +   AN+AL ++ + +    P+           IR G++ G ++ G++G+  P++ + GD+V TAS+MES     +I     T+++ +++ S  Y +  RG + ++GKG   T++L
Sbjct:  294 SMLPKQIADDLRQGRVTKAQSYASATVFFSDIVGFTQLSSSSTPYEVVDFLNKLYTSFDGIIDNYDVYKVETIGDAYMVVSGVPTENHNQHAVETANMALDLVNVCQAFVIPHKPEMQLK----IRAGIHTGPVVAGVVGTKMPRYCLFGDTVNTASRMESTSEALKIQCSPSTSSILQQIGS--YLLSCRGTVTVKGKGEMITWWL 494          
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008942.1 (pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 gene:ENSPMAG00000008084.1 transcript:ENSPMAT00000008942.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 115.161 bits (287), Expect = 1.600e-26
Identity = 72/217 (33.18%), Postives = 124/217 (57.14%), Query Frame = 3
Query: 1446 ASTMSGLINNSLREGRK-----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGI-----LDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRAL------IRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-SHYDMEERGCIEIRGKGRQFTYFLN 2045
            +S +  ++   L+ G+      ++   I FCDIV F+ +   S P EV+ +LN+++N  D + + ++V K+++IGDAY++ SG+     + H+ + S       +++  +S  I        NF  R L      IRIG+N G ++ G++G+  P++ + GD+V  AS+MES G P RIH++ +    L S   Y++ ERG I+++GKG Q TY+LN
Sbjct:  848 SSLLPSVVVEQLKAGKTVQPEHFEQVTIFFCDIVGFTAMSAISSPLEVITLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIS------IMSLHFLSSII--------NFRIRHLPKEQLKIRIGVNSGSVVAGVVGNTMPRYCLFGDTVNVASRMESTGYPLRIHVSESTASLLKSIGGYELVERGAIQLKGKGSQLTYWLN 1050          
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008986.1 (pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-1 gene:ENSPMAG00000008096.1 transcript:ENSPMAT00000008986.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.923 bits (276), Expect = 1.559e-25
Identity = 73/213 (34.27%), Postives = 122/213 (57.28%), Query Frame = 3
Query: 1446 ASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRS-ERIANIALAMILISKTIKSPYDYGSNFGKRAL------IRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-SHYDMEERGCIEIRGKGRQFTYFLN 2045
            +S + G++ + L+ G+     +Y+   I FCDIV F+ +   S P EV+++LN+++N  D + + ++V K+++IGDAY++ SG+      R  E IA ++L    +S  +        NF  R L      +RIG+N G ++ G++G+  P++ + GD+V  AS+MES G P  IH++ A    L     Y + ERG I ++GKG Q TY+L 
Sbjct:  424 SSLLPGIVVDQLKAGKTVQPEQYELVTIFFCDIVGFTAMSAISTPLEVINLLNDLYNLLDDIIKEYDVYKVETIGDAYMVASGLPVRNGVRHVEEIATMSLH--FLSSIM--------NFRIRHLPQEQLKLRIGINSGPVVAGVVGNTMPRYCLFGDTVNVASRMESTGFPLHIHVSEATTNLLKQIGGYFLVERGTINLKGKGNQLTYWLK 626          
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006352.1 (pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 gene:ENSPMAG00000005587.1 transcript:ENSPMAT00000006352.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 110.538 bits (275), Expect = 3.248e-25
Identity = 61/188 (32.45%), Postives = 111/188 (59.04%), Query Frame = 3
Query: 1485 EGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGI-LDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELAS-SHYDMEERGCIEIRGKGRQFTYFL 2042
            +   + +  I F DIV F+++   S P +V+ +LN+++  FD +    +V K+++IGDAY++VSG+ + +    ++ IA ++LA++   KT K  +           +RIG++ G +  G++G   P+F + GD+V TAS+MES+G   +IH++      L     + +E RG +E++GKG+  TY+L
Sbjct:  634 QAEAFDSVTIYFSDIVGFTSLSAESTPMQVVTLLNDLYTCFDAIIDNFDVYKVETIGDAYMVVSGLPVRNGKLNAKEIARMSLALLDAVKTFKIRHRQEDKLK----LRIGIHTGPVCAGVVGLKMPRFCLFGDTVNTASRMESNGEALKIHVSQTTKEVLDEFGCFRLELRGDVEMKGKGKMRTYWL 817          
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Match: EDO47083 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN69])

HSP 1 Score: 208.379 bits (529), Expect = 3.646e-57
Identity = 158/621 (25.44%), Postives = 296/621 (47.67%), Query Frame = 3
Query:  282 LGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKV-DTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTAN-------------QDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDW---------SDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLT--RVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYR-----ELASSHYDMEERGCIEIRGKGRQF-TYFLNRN 2051
            L I+    L+  GE +    Q +G +++L+VLG +L +F+ N+D +H      YP    P F+V D E+ G   + LHY+S R  L P++  +++ +++      + ++++    +G+ +         D  DV                 Q   K+++D                    R R+ +S+ K      I  S  L   PK   I P  FC+ FP+H +F++ + + Q+G  +  ++P     + D+ +  +LI P   +FT+E++     +  V++  + KL+  AN                 + L+GQM+ + E+  ++F+CSP V +L D+   G+ +S+IP HD TK         K ++         +DK L + +N   E     +      ++   S  + L +N   +  + +   +LF  IV F+ I  +S P E++ +LNNI+ +FD LT   +++V K++++GD Y+ VSG+ +     +  I N+AL M  ++++I        + G +  I+IG++ GE++ G++G   P++ + G++V   S+ E+ G P +++IT   YR     E     +  E RG + ++G+     TY L R+
Sbjct:  157 LDIETSAILEKFGEMFFDFCQESGYDRILQVLGGTLRDFIGNLDALHDHLGSIYPGMRAPSFRVSDRESDGA--LILHYYSERDGLEPIVVGIVKTVARKLLNTEVSVEVV----KGKEY---------DGDDV-----------------QFVIKEISD--------------------RGRDCDSQVKNYDP--IKDSFQLSNEPK---ISPATFCKAFPFHLMFNRDLKVTQAGESVSRVVPSLTPGDADMSEIFELIRP-QLRFTYEAIIAHINTVFVLRTREGKLSKPANNMCNKNGCCKLCWDSLPLRLKGQMVYIPESDNMIFLCSPSVGNLEDLADVGLYLSDIPLHDATKDLILLSEQFKAEYVLTQQLEILTDK-LRQTHNALAEKKQLTDQL--LYSVLPPSVANELRHNRPVQAERAEMVTLLFSGIVDFAQICKNSKPMEIVMLLNNIYTKFDMLTDPSINDVYKVETVGDKYMAVSGLPERCAFHARSICNMALDMKHVTQSI-------IHKGDKIQIKIGIHSGEVVAGVVGHKTPRYCLFGNTVNLTSRTETTGAPGQVNITEFTYRCLLEPECQDPSFVFERRGPVAMKGRQEPMVTYLLTRD 709          
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Match: EDO47086 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN72])

HSP 1 Score: 204.527 bits (519), Expect = 5.497e-57
Identity = 149/567 (26.28%), Postives = 281/567 (49.56%), Query Frame = 3
Query:  285 GIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWK-AALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQL--IHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTAN---QDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVE----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSG--PNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHIT 1943
            G++ +  L++ G  + +  + +G +++L+VLG++L +FL N+D +H      YP    P F+      G   + LHY+S R  LS ++  L++AI+K   +  + + I  +D   E  H+ ++  I++  +   +   L  QT  +  H+ E                            + AN R K A++K      R +  +          FC+ FP+H +FD+ + +KQ+G+ +  I+   +++N D  K+  L  I     +F+F++V +   +  V+      +    N    D  + L+GQM+ + ++ C+LF+CSP V +++ +  KG+  S+IP HD T+   F S     + +  +K     NN    ++  +E    T D   ++      + L  N       YK   ILF DIV F+ + ++    P +++ MLN ++  FD L+ +++V K+++IGDAY++V G+       ++R+A++ L M+  +  + SP D      +   IRIG++ G ++ G++G   P++ + G++V  A+KMES   P RI+I+
Sbjct:   61 GLELDTVLEVFGAHFFAYCEKSGYDRILKVLGRNLRDFLCNLDALHDHLATIYPGMEAPSFRCTETDNGT--LLLHYYSKRPGLSYIVIGLVKAIAKQLLETEVNVTI-HQDIDEENDHVTFA--IREAENKHSSGSKLGLQTFASG-HETE----------------------------KEANKRSKDASVKSETHKKREMNLL---------SFCKAFPFHVMFDRKLHIKQAGLSLTRIMTK-QKLN-DTLKFTDLFRISRPRMEFSFQAVISHINTVFVVTTKAGAVQLPDNIESTDASLRLKGQMLYVPDSDCLLFLCSPRVKNMDSLREKGLYFSDIPVHDATRDLLFLSHARRAERELVEKLEETSNNLKKVESKLIEHKKRTDDLLYSILPKEVAAKLRLNQSVPAESYKTVTILFSDIVGFTALCSNDKIVPMDIVKMLNRLYTYFDMLSGMNDVYKVETIGDAYMVVGGLPHPCEDHADRVASMGLGMMEAADVVLSPVDR-----EPLKIRIGIHTGPVMAGVVGKKMPRYCLFGNTVTLANKMESGTQPGRINIS 577          
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Match: EDO47084 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN70])

HSP 1 Score: 188.734 bits (478), Expect = 4.256e-51
Identity = 153/606 (25.25%), Postives = 274/606 (45.21%), Query Frame = 3
Query:  315 LGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMK----VIDNKLTTTANQDD-------EIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTK--YFCSFQTIGKGDWSDK---FLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLR-----EGRKYKNCYILFCDIVHFSTIVTS-SGPNEVLDMLNNIHNEFDRLTRVH-NVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL---ASSHYDMEERGCIEIRGKGR-QFTYFLNRN 2051
             G+A+      +G + ++R LG +L++F  ++D +H   L  YP    P F+          + L Y S R  L  M+  L++ ++   +   + +++     + +   + Y L                       +HQ E K +      +E   KE                     L +  + SR          IG   FC   P+H VFDQ M++ Q+GI +  ++P  R     +    + I P   + TF+++       +V+K    ++D+   +T ++DD        +  RGQM+ L E   I+F+ SP V +L+ +  KG+ MS+IP HD T+     S Q   +   S +      +   TS E  ++ +  D        S +   + N LR        KY+   I+F  IV F+        P E+++MLN ++ EFD+LT  + ++ K++++GD Y+ VSG+    ++ +  IAN+AL MI ISK +K+        G +  + IG++ GE++ G++G   P++ + G++V   S+ E+ G+  +I+++   YR L       +  ++RG + ++GK     TY L RN
Sbjct:   72 FGDAFFEHCIGSGYDSMIRSLGGNLMDFFNSLDGLHEQLLLLYPGMRPPSFRAKQHNINMK-LELVYTSERSGLEYMVVGLVKTVASKLYGIQVNVELASMSSKDQSWAMFYVL----------------------PQHQDEMKYILPTDTTLERTMKE---------------------LSIMTLSSR----------IGTAAFCRACPFHAVFDQRMVIYQAGISLCRVLPAVRVGKSKLTDIFESIRPPI-KLTFDNILQYINKVYVIKTKSGLLDSASLSTVSEDDYGNLESPSMRFRGQMMYLPECNSIMFLASPSVVNLDGLNEKGLYMSDIPIHDATRDLILLSEQHNAEFKLSQRLEILTDKLQQTSRELENEQQLNDRLL----YSILPASVANDLRLRKPVNANKYEIVTIMFSGIVDFTNYCNKIKEPMEIVEMLNEVYTEFDQLTDSNDDIYKVETVGDKYMAVSGLPTRCDKHALNIANLALDMIDISKGMKAK-------GIQLQVTIGIHSGEVVAGVVGQKKPRYCLFGNTVNLTSRTETTGLKGKINVSEYAYRCLLVQPHEQFVFKKRGPVVMKGKKEPMITYILQRN 611          
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Match: EDO43095 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZH8])

HSP 1 Score: 184.111 bits (466), Expect = 1.691e-49
Identity = 156/631 (24.72%), Postives = 278/631 (44.06%), Query Frame = 3
Query:  285 GIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHP----------THEQFTFE--------------SVEN-LFCSPHVMKVI--------DNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPM-VSSLNDIERKGMKMSEIPNHDVTKYFC--SFQTIGKGDWS--DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREG-------RKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFL 2042
            G      L+  G  ++S I   G +++LR+LG+ + +FL  +D +H      YPK   P F    E +    ++LHY S RK     +   +  + K+F+ + +++++LE+ +  E    +  L         DN   + A+ R      I     TD                               ++ +++ Y                   E+FP+H V+D++M +   G  ++A++P+   +   I     LI P           H    FE               V+N L     +M  +        DN    T   D  I+L+GQM+ + E + + ++ +P+ +S+L  I       + + + DV   F     + I   D     K    + +    DN  + T      +   +     + + LR+G         + N  ILF D+V F+TI +   P +V+ MLN ++  FD+L+  HNV K+++IGDAY++VSGI +     +E +A++AL M+     I+ P    +       IRIG++ G ++ G++G   P++ + GD+V TAS+MES G+   IH++    + LA ++Y +++RG ++I+GKG   TY+L
Sbjct:   60 GEDRNSLLESTGALFVSFIGQFGYDKILRILGRHIRDFLNGLDNLHEFMRFTYPKLKAPSFHCSEETE--RGMKLHYRSSRKGFLYYVVGQIREVGKMFYDQQIEVEVLEQHESKEGFVAVMQL-------YFDNRAFISARKRPKRHSVISLGGETDS-----------------------------LSIHIDVFY-------------------EVFPFHVVYDKSMTITSVGSSLEAVLPNL--VGCKITDEFSLIRPFLDFSWESVFVHTNVVFELQSRSKALSMRKNGKVQNGLLMGCPIMDALGEGVNGNHDNNHNVT-EFDSRIHLKGQMMYIDEWKAMAYLATPINISTLMLINFTFFLQTYL-DVDVILLFLRKEIRIILSKDVKCMQKSAKLEESMRELDNEKLRTDALLYQMIPKT-----VADRLRKGEPALNTCETFSNVTILFSDVVGFTTICSLIAPMQVVTMLNCMYTTFDKLSEKHNVYKVETIGDAYMVVSGIPERTKYHAEHVADMALNMLSAMPEIEDP----AGLNDHLRIRIGIHTGTVVAGVVGLKMPRYCLFGDTVNTASRMESTGLAMAIHVSEDTQKFLAKANYALKQRGSMDIKGKGGMKTYWL 620          
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Match: EDO47085 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN71])

HSP 1 Score: 142.895 bits (359), Expect = 6.410e-37
Identity = 101/378 (26.72%), Postives = 180/378 (47.62%), Query Frame = 3
Query:  891 TIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDE------IYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGR--------DNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSE--RIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH 1976
            T P+ L IG +  C  FP+H + D+ + +KQ G  +  +I    R +     Y +L  P     T    + + C   +      +L +    DD       + L+GQMI L E+  ILF+ SP+V  L  ++ +G+ +S+IP HD T+         + +  D    R           +S  +    +T +  +++      + LIN      R  +N  +LF DIV F+ I       +V++ML +++ +FD+L    ++ K+++IGDAY++  G+ +H     +   +A +A+ MI   + + SP       G    +R+G++ G ++ G++G+  P++ + G  V  A+KMES     RI+I+   Y EL   H
Sbjct:    2 TSPQDLPIGVQTLCSTFPFHVILDKELQIKQMGSALLRLIGPAIRHDRKFSTYFELDQP---DITL-GFQPILC--RINATFSVQLKSATQIDDSGKRVTLMELKGQMIHLPESNAILFLASPLVEKLEQLKGRGLFLSDIPIHDATRDLILVSE--QANAQDGLKKRMEQIQKELQQASSELEEEKKKTENLLSSIFPHDVANKLINKQPIPARHIQNVTMLFSDIVGFTAICGKCSAMDVVEMLKSLYTKFDKLCGELDLYKVETIGDAYVVAGGVQNHCGTAEDAYHVALMAVGMIDHIRDVLSPE------GVPLKMRVGIHTGSVLSGVVGTKMPRYCLFGHDVTLANKMESESEAGRINISPTTY-ELIREH 364          
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Match: gucy1b1 (fatty acid binding protein 2 [Source:NCBI gene;Acc:101170642])

HSP 1 Score: 164.851 bits (416), Expect = 7.904e-43
Identity = 116/419 (27.68%), Postives = 207/419 (49.40%), Query Frame = 3
Query:  912 IGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTT-TANQDDEIY--------LRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWS-----DKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGR-----KYKNCYILFCDIVHFSTI----VTSSGPNEVLDMLNNIHNEFDRLTRVHN---VQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYR-----ELASSHYDMEERGCIEIRGKGRQF-TYFLNRNLDVSDNA 2072
            I P  FC+ FP+H +FD+ ++L Q G  I  ++P  +  +  +     L+ P H  F+F  + +   +  V++  +  L   T   +DE+         L+GQMI L E + ILF+CSP V +L+D+ R+G+ +S+IP HD T+         + ++      +    R  +T      + +  D        S +   + N LR  R     +Y N  ILF  IV F+T      ++ G  +++++LN+++  FD LT       V K++++GD Y+ VSG+ +     ++ I ++AL M+ I+  +K          +   I IG++ GE++ G+IG   P++ + G++V   S+ E+ G   +I+++   YR     E A   + +E RG I ++GK      +FL+R    +D A
Sbjct:  164 ISPYTFCKAFPFHLMFDKDLMLTQCGNAIYRVLPQLQPGSCILPSVFSLVRP-HIDFSFHGILSHINTVFVLRSKEGLLNVETVENEDELTGVEISCLRLKGQMIYLPEAENILFLCSPSVMNLDDLTRRGLYLSDIPLHDATRDLVLLGEQFREEYKLTQELEILTDRLQHTLRALEDEKKKTDRLL----YSVLPPSVANELRHKRPVPAKRYDNVTILFSGIVGFNTFCSKHASAEGAIKIVNLLNDVYTRFDILTDSRKNPYVYKVETVGDKYMTVSGLPEPCTHHAKSICHLALDMMEIAGQVKVD-------DESVQITIGIHTGEVVTGVIGQRMPRYCLFGNTVNLTSRTETTGEKGKINVSEYTYRCLQCAENADPQFQLEYRGPITMKGKKEPMKVWFLSRKSSDADKA 570          
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Match: gucy1a2 (guanylate cyclase 1 soluble subunit alpha 2 [Source:NCBI gene;Acc:100049248])

HSP 1 Score: 157.147 bits (396), Expect = 2.093e-39
Identity = 118/421 (28.03%), Postives = 197/421 (46.79%), Query Frame = 3
Query:  885 LPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQ--SGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKG-DWSDKFLGRDNNTSGEDNSDVE-----TYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYREL---------ASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDA 2096
            L T P  L IG   FC  FP+H V    M L Q   G++ QA I   R  +   R   +++ P  E  +F+ +     SP  ++   +  T    ++  + L+GQMI + E+  ++F+ SP V  L ++  +G+ +S+IP HD T+         K  D   K + +   T    +  +E     T D   ++        L        RK+ +  +LF DIV F+ +     P +V+ MLN ++  FD    + +V KI++IGDAY +  G+   ++  ++ IA++AL M+ +S  + +P       GK   +RIG++ G ++ G++G   P++ + G++V  ASK ES   P  I+++   Y+ L           S  D+ E    EI G      YFL      S +A L  +R A
Sbjct:  379 LSTNPSDLRIGLATFCRAFPFHLVLGPHMELLQLGEGLRRQARIEPHR--SFSFRDCFEIVSPKMEP-SFQGILLRLASPFTIRTRPDS-TQAGTKEKVMELKGQMIHVPESCSLMFLGSPRVDKLEELMGRGLYLSDIPIHDATRDVILVGEQAKAQDGLKKRMDKLKATLERTHQALEEEKRRTVDLLYSIFPGDVAQKLWQGQPVPARKFDDVTMLFSDIVGFTAVCAHCTPMQVISMLNELYTRFDYQCGILDVYKIETIGDAYCVAGGLHKKVDSHAKPIAHMALKMMELSDEVLTPD------GKPIKLRIGIHTGSVLAGVVGVKMPRYCLFGNNVTLASKFESGSHPRCINVSPTTYQLLKDDRSFSFVPRSRMDLPENFPKEIPGA----CYFLEAGTSHS-HASLTSSRSA 784          
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Match: gucy2g (guanylate cyclase 2g [Source:ZFIN;Acc:ZDB-GENE-130531-70])

HSP 1 Score: 130.954 bits (328), Expect = 7.787e-31
Identity = 68/195 (34.87%), Postives = 122/195 (62.56%), Query Frame = 3
Query: 1464 LINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGI-LDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELA-SSHYDMEERGCIEIRGKGRQFTYFL 2042
            L++    E + Y    I F DIV F+++ + S   EV+  LN++++ FD + ++++V K+++IGDAY++ SG+ + + N+ +  I+ +AL  +   K  K P+           IRIG++ G ++ G++G+  P++ + GD+V TAS+MES+ +P +IHI+ +    L  +  ++MEERG IE++GKG Q TY+L
Sbjct:  747 LMSGKSVEPQSYDMVTIFFSDIVGFTSMCSVSSAMEVVTFLNDLYSLFDDIIKMYDVYKVETIGDAYMVASGLPISNGNKHALEISTMALHFLAAIKIFKIPHMPNEGLA----IRIGIHSGPVVAGVVGTTMPRYCLFGDTVNTASRMESNSLPLKIHISQSTADILVLAGSFEMEERGEIEMKGKGFQKTYWL 937          
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Match: olgc-r2 (guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:100216004])

HSP 1 Score: 128.642 bits (322), Expect = 4.169e-30
Identity = 69/185 (37.30%), Postives = 117/185 (63.24%), Query Frame = 3
Query: 1497 YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGI-LDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSH--YDMEERGCIEIRGKGRQFTYFL 2042
            + +  + F DIV F+TI  +S P EV+D+LN+++  FD +   H+V K+++IGDAY++ SG+ + + N+ +  IAN++L ++    T K    +  +   R  IRIGL+ G  + G++G   P++ + GD+V TAS+MES G+P RIH+  ++ + L   +  Y +E RG  E++GKG + TY+L
Sbjct:  887 FDSVSLYFSDIVGFTTISANSEPIEVVDLLNDLYTLFDAIIGNHDVYKVETIGDAYMVASGVPVPNANRHAAEIANMSLDILSAVGTFK--MRHMPDVPVR--IRIGLHTGPCVAGVVGLTMPRYCLFGDTVTTASRMESSGMPYRIHVHESIVKVLKELNLGYKLELRGRTEVKGKGTEETYWL 1067          
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Match: olgc9 (membrane guanylyl cyclase [Source:NCBI gene;Acc:100125818])

HSP 1 Score: 128.257 bits (321), Expect = 5.812e-30
Identity = 74/204 (36.27%), Postives = 123/204 (60.29%), Query Frame = 3
Query: 1455 MSGLINNSLRE-GRK----YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQR-SERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASS--HYDMEERGCIEIRGKGRQFTYFL 2042
            + G +  SL+E GR     ++   I F DIV F+T+   S P EV+DMLNNI+  FD +   H+V K+++IGDAY++ SG+ +    R +  IA++AL ++    T    ++     G    IRIG++ G    G++G+  P++ + GD+V TAS+MES G+P RIH++ +  + L  +   ++ E+RG   ++GKG++ TY+L
Sbjct:  792 LPGPVVRSLKETGRVEPELFEEVTIYFSDIVGFTTLCHYSTPMEVVDMLNNIYKNFDSILDHHDVYKVETIGDAYMVASGLPNRNGDRHAVDIAHMALDILSFVGT----FELQHLPGIPLWIRIGVHSGPCAAGVVGNKMPRYCLFGDTVNTASRMESTGLPLRIHVSQSTIKILQRTPCKFEFEQRGETYLKGKGKEMTYWL 991          
BLAST of Gucy1b2 protein vs. Planmine SMEST
Match: SMESG000016261.1 (SMESG000016261.1)

HSP 1 Score: 1265.75 bits (3274), Expect = 0.000e+0
Identity = 608/629 (96.66%), Postives = 614/629 (97.62%), Query Frame = 3
Query:  216 LRSYARVLEAIVKNIMPIKIFHLGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 2102
            +  Y     ++   ++ I +   GIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY
Sbjct:   35 INEYGNYEMSLFDRMIKISVEQCGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTRDAVY 663          
BLAST of Gucy1b2 protein vs. Planmine SMEST
Match: SMESG000007273.1 (SMESG000007273.1)

HSP 1 Score: 466.463 bits (1199), Expect = 4.829e-156
Identity = 241/592 (40.71%), Postives = 357/592 (60.30%), Query Frame = 3
Query:  315 LGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTR 2090
            +GE Y + + +  N+Q +R+LG S  EF+QN+DF+HT A+ KYPKA+IP F++DTE    N +RLHY+S R+ LS M+ESLL  I K  FKK + I+I+ E+ + +R+H++YS+ + +     + PPT++AQT+KN E+Q+   +V  QKEK++ +R E+G+ ALPV R R+  S+ KA+ +M + Y  + P IP +L +   DFC++F                                         P H    F+S  NL  +   M++I               ++GQMI+L     IL++CSP V +L+ IE+ GM +S+IP HDVTKY        +GDW + FLG +     +D+ D +  +H   +        +      EG+ Y+NC ILFCD+V F  IV  + P EVL MLN++H++FDRL  VH+V K+D IGDAY+IVSGI   I   +ERIA +ALAM+  S+    PY+YGSN G R L RIGL+ G++IGG+IG    +FT+MG++VV AS+MESHGIPDR+H++ ++Y EL    +++E RG IEIRGKGR +TY L  N  ++ + ++G+ +
Sbjct:    1 MGETYCAIMVSKENSQSVRLLGGSFYEFIQNLDFLHTTAMAKYPKADIPLFRMDTEGASLNKMRLHYYSKREYLSRMVESLLRCIGKTVFKKEIDIRIISENHEDDRYHVIYSVILDEFRMEQEVPPTMVAQTKKNGENQLHNVEVEHQKEKLDHLRMEFGDDALPVNRFRSDRSKLKASTRMLVFYKNVKPRIPASLLLDASDFCDIF-----------------------------------------PYH--IIFDSSMNLKQAGIQMQLI---------------VQGQMIELSNKHLILYLCSPYVHNLDAIEQHGMHISDIPTHDVTKYLFQGSQAIEGDWLEGFLGSNGQPIFDDDLDGDLGEHRFAMVPRGIADVMKTGQRVEGKMYRNCSILFCDLVQFGMIVQHASPTEVLTMLNDLHDKFDRLAEVHDVFKVDVIGDAYVIVSGIPTPIRNHAERIAKMALAMLYASRLTPCPYNYGSNIGARVLARIGLHSGDVIGGVIGRPVHRFTIMGENVVMASRMESHGIPDRVHLSESLYSELKPFKFEVESRGNIEIRGKGRLYTYLLKENQAINKDVIMGERK 534          
BLAST of Gucy1b2 protein vs. Planmine SMEST
Match: SMESG000049374.1 (SMESG000049374.1)

HSP 1 Score: 470.7 bits (1210), Expect = 2.777e-154
Identity = 244/605 (40.33%), Postives = 363/605 (60.00%), Query Frame = 3
Query:  276 FHLGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNVDFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLLEAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQTRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALKMNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAIIPDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTANQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTR 2090
            F    + E F +++GE Y + + +  N+Q +R+LG S  EF+QN+DF+HT A+ KYPKA+IP F++DTE    N +RLHY+S R+ LS M+ESLL  I K  FKK + I+I+ E+ + +R+H++YS+ + +     + PPT++AQT+KN E+Q+   +V  QKEK++ +R E+G+ ALPV R R+  S+ KA+ +M + Y  + P IP +L +   DFC++F                                         P H    F+S  NL  +   M++I               ++GQMI+L     IL++CSP V +L+ IE+ GM +S+IP HDVTKY        +GDW + FLG +     +D+ D +  +H   +        +      EG+ Y+NC ILFCD+V F  IV  + P EVL MLN++H++FDRL  VH+V K+D IGDAY+IVSGI   I   +ERIA +ALAM+  S+    PY+YGSN G R L RIGL+ G++IGG+IG    +FT+MG++VV AS+MESHGIPDR+H++ ++Y EL    +++E RG IEIRGKGR +TY L  N  ++ + ++G+ +
Sbjct:  246 FQEDTRRELFFEVMGETYCAIMVSKENSQSVRLLGGSFYEFIQNLDFLHTTAMAKYPKADIPLFRMDTEGASLNKMRLHYYSKREYLSRMVESLLRCIGKTVFKKEIDIRIISENHEDDRYHVIYSVILDEFRMEQEVPPTMVAQTKKNGENQLHNVEVEHQKEKLDHLRMEFGDDALPVNRFRSDRSKLKASTRMLVFYKNVKPRIPASLLLDASDFCDIF-----------------------------------------PYH--IIFDSSMNLKQAGIQMQLI---------------VQGQMIELSNKHLILYLCSPYVHNLDAIEQHGMHISDIPTHDVTKYLFQGSQAIEGDWLEGFLGSNGQPIFDDDLDGDLGEHRFAMVPRGIADVMKTGQRVEGKMYRNCSILFCDLVQFGMIVQHASPTEVLTMLNDLHDKFDRLAEVHDVFKVDVIGDAYVIVSGIPTPIRNHAERIAKMALAMLYASRLTPCPYNYGSNIGARVLARIGLHSGDVIGGVIGRPVHRFTIMGENVVMASRMESHGIPDRVHLSESLYSELKPFKFEVESRGNIEIRGKGRLYTYLLKENQAINKDVIMGERK 792          
BLAST of Gucy1b2 protein vs. Planmine SMEST
Match: SMESG000007273.1 (SMESG000007273.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.071e-90
Identity = 139/299 (46.49%), Postives = 197/299 (65.89%), Query Frame = 3
Query: 1194 MIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDVTKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMSGLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTR 2090
            MI+L     IL++CSP V +L+ IE+ GM +S+IP HDVTKY        +GDW + FLG +     +D+ D +  +H   +        +      EG+ Y+NC ILFCD+V F  IV  + P EVL MLN++H++FDRL  VH+V K+D IGDAY+IVSGI   I   +ERIA +ALAM+  S+    PY+YGSN G R L RIGL+ G++IGG+IG    +FT+MG++VV AS+MESHGIPDR+H++ ++Y EL    +++E RG IEIRGKGR +TY L  N  ++ + ++G+ +
Sbjct:    1 MIELSNKHLILYLCSPYVHNLDAIEQHGMHISDIPTHDVTKYLFQGSQAIEGDWLEGFLGSNGQPIFDDDLDGDLGEHRFAMVPRGIADVMKTGQRVEGKMYRNCSILFCDLVQFGMIVQHASPTEVLTMLNDLHDKFDRLAEVHDVFKVDVIGDAYVIVSGIPTPIRNHAERIAKMALAMLYASRLTPCPYNYGSNIGARVLARIGLHSGDVIGGVIGRPVHRFTIMGENVVMASRMESHGIPDRVHLSESLYSELKPFKFEVESRGNIEIRGKGRLYTYLLKENQAINKDVIMGERK 299          
BLAST of Gucy1b2 protein vs. Planmine SMEST
Match: SMESG000007273.1 (SMESG000007273.1)

HSP 1 Score: 231.491 bits (589), Expect = 2.189e-70
Identity = 105/198 (53.03%), Postives = 145/198 (73.23%), Query Frame = 3
Query: 1497 YKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFDRLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIKSPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKMESHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDVSDNALLGKTR 2090
            Y+NC ILFCD+V F  IV  + P EVL MLN++H++FDRL  VH+V K+D IGDAY+IVSGI   I   +ERIA +ALAM+  S+    PY+YGSN G R L RIGL+ G++IGG+IG    +FT+MG++VV AS+MESHGIPDR+H++ ++Y EL    +++E RG IEIRGKGR +TY L  N  ++ + ++G+ +
Sbjct:    2 YRNCSILFCDLVQFGMIVQHASPTEVLTMLNDLHDKFDRLAEVHDVFKVDVIGDAYVIVSGIPTPIRNHAERIAKMALAMLYASRLTPCPYNYGSNIGARVLARIGLHSGDVIGGVIGRPVHRFTIMGENVVMASRMESHGIPDRVHLSESLYSELKPFKFEVESRGNIEIRGKGRLYTYLLKENQAINKDVIMGERK 199          
The following BLAST results are available for this feature:
BLAST of Gucy1b2 protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GUCY1A15.163e-4428.92guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
GUCY1A19.734e-4328.80guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
GUCY1A11.659e-4228.92guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
GUCY1A11.659e-4228.92guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
GUCY1A11.659e-4228.92guanylate cyclase 1 soluble subunit alpha 1 [Sourc... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gcy-352.129e-5826.07Soluble guanylate cyclase gcy-35 [Source:UniProtK... [more]
gcy-323.593e-5124.64Soluble guanylate cyclase gcy-32 [Source:UniProtK... [more]
gcy-341.043e-4924.12Soluble guanylate cyclase gcy-34 [Source:UniProtK... [more]
gcy-362.584e-4924.28Soluble guanylate cyclase gcy-36 [Source:UniProtK... [more]
gcy-371.139e-4422.59Soluble guanylate cyclase gcy-37 [Source:UniProtK... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gycbeta100B5.245e-4528.39gene:FBgn0013973 transcript:FBtr0085753[more]
Gyc88E2.746e-4223.69gene:FBgn0038295 transcript:FBtr0110961[more]
Gyc88E2.746e-4223.69gene:FBgn0038295 transcript:FBtr0306245[more]
Gyc88E2.823e-4223.69gene:FBgn0038295 transcript:FBtr0334926[more]
Gycalpha99B2.472e-3023.29gene:FBgn0013972 transcript:FBtr0085453[more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b22.532e-10431.60guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b11.264e-4227.98guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
gucy1b11.374e-4227.98guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1A22.719e-3526.92guanylate cyclase 1, soluble, alpha 2 [Source:NCBI... [more]
si:ch211-215j19.128.739e-3335.75si:ch211-215j19.12 [Source:ZFIN;Acc:ZDB-GENE-14121... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank11.014e-10232.21ankyrin 1 [Source:Xenbase;Acc:XB-GENE-5838516][more]
GUCY1B16.943e-5024.68guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.146e-4924.80guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B11.233e-4924.80guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1B13.802e-4823.67guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gucy1b21.382e-9729.92guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b23.640e-9630.08guanylate cyclase 1, soluble, beta 2 [Source:MGI S... [more]
Gucy1b14.984e-4123.49guanylate cyclase 1, soluble, beta 1 [Source:MGI S... [more]
Gucy1a18.850e-4027.84guanylate cyclase 1, soluble, alpha 1 [Source:MGI ... [more]
Gucy1a18.850e-4027.84guanylate cyclase 1, soluble, alpha 1 [Source:MGI ... [more]
back to top
BLAST of Gucy1b2 protein vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P22717|GCYB2_RAT1.322e-9630.46Guanylate cyclase soluble subunit beta-2 OS=Rattus... [more]
sp|O75343|GCYB2_HUMAN4.209e-9629.98Guanylate cyclase soluble subunit beta-2 OS=Homo s... [more]
sp|O02298|GCY35_CAEEL2.708e-5726.07Soluble guanylate cyclase gcy-35 OS=Caenorhabditis... [more]
sp|Q6DNF7|GCY32_CAEEL4.571e-5024.64Soluble guanylate cyclase gcy-32 OS=Caenorhabditis... [more]
sp|P92006|GCY34_CAEEL1.326e-4824.12Soluble guanylate cyclase gcy-34 OS=Caenorhabditis... [more]
back to top
BLAST of Gucy1b2 protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|202713780.000e+099.03tr|A0A5P8I4I8|A0A5P8I4I8_SCHMD Gucy1b2 protein OS=... [more]
gnl|BL_ORD_ID|275933558.103e-10931.66tr|A0A4X1SP69|A0A4X1SP69_PIG Guanylate cyclase dom... [more]
gnl|BL_ORD_ID|275584158.912e-10931.66tr|I3LIP7|I3LIP7_PIG Guanylate cyclase domain-cont... [more]
gnl|BL_ORD_ID|1749847534.995e-10731.72tr|W5MSK3|W5MSK3_LEPOC Guanylate cyclase 1, solubl... [more]
gnl|BL_ORD_ID|1750294146.881e-10731.55tr|W5MSL5|W5MSL5_LEPOC Guanylate cyclase 1, solubl... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b21.125e-9930.08guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
gucy1b21.435e-9930.08guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSAMXT00000013658.22.692e-9329.97pep primary_assembly:Astyanax_mexicanus-2.0:17:533... [more]
gucy1b12.918e-4227.59guanylate cyclase 1 soluble subunit beta 1 [Source... [more]
GUCY1A24.668e-3626.58guanylate cyclase 1 soluble subunit alpha 2 [Sourc... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b22.743e-6934.04guanylate cyclase 1, soluble, beta 2 [Source:ZFIN;... [more]
ENSPMAT00000002650.11.045e-2831.88pep scaffold:Pmarinus_7.0:GL478983:4063:28109:1 ge... [more]
ENSPMAT00000008942.11.600e-2633.18pep scaffold:Pmarinus_7.0:GL476454:59555:94399:-1 ... [more]
ENSPMAT00000008986.11.559e-2534.27pep scaffold:Pmarinus_7.0:GL476454:105373:128493:-... [more]
ENSPMAT00000006352.13.248e-2532.45pep scaffold:Pmarinus_7.0:GL477176:19246:83539:-1 ... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Gucy1b2 protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470833.646e-5725.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470865.497e-5726.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470844.256e-5125.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO430951.691e-4924.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO470856.410e-3726.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Gucy1b2 protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gucy1b17.904e-4327.68fatty acid binding protein 2 [Source:NCBI gene;Acc... [more]
gucy1a22.093e-3928.03guanylate cyclase 1 soluble subunit alpha 2 [Sourc... [more]
gucy2g7.787e-3134.87guanylate cyclase 2g [Source:ZFIN;Acc:ZDB-GENE-130... [more]
olgc-r24.169e-3037.30guanylate cyclase OlGC-R2 [Source:NCBI gene;Acc:10... [more]
olgc95.812e-3036.27membrane guanylyl cyclase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Gucy1b2 protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000016261.10.000e+096.66SMESG000016261.1[more]
SMESG000007273.14.829e-15640.71SMESG000007273.1[more]
SMESG000049374.12.777e-15440.33SMESG000049374.1[more]
SMESG000007273.12.071e-9046.49SMESG000007273.1[more]
SMESG000007273.12.189e-7053.03SMESG000007273.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016104 ID=SMED30016104|Name=Gucy1b2 protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2311bp
GTAGTTCACTGAGGCAATCATATGTTAAGCCGTATGTCTCTTGGAAAATA
TCTACGTACCTTAGAATAAAAGATGTGTACACCTTTGATAACTTTTGTAC
CCGTGTAGAAATTCATATCTTAGAAACCTATAAATATTGCTTATGAAATG
TATCCAGAGGTTTTGTATAGTCGGTACGAGGCATATTTTAAACAAGTAAC
TAGAAAGGATATTTATTAAGATCCTATGCTAGGGTACTAGAAGCAATAGT
TAAGAATATTATGCCTATTAAAATCTTTCATTTAGGTATCAAAGAGGAGC
CTTTTCTAAAATTGCTTGGAGAAGCGTACCTCTCGCAAATACAAGCCAAT
GGTAACAATCAGCTATTACGAGTTCTTGGGAAAAGTCTTTTAGAATTTCT
ACAGAACGTCGACTTTATTCACACATTGGCTTTGGGTAAATATCCAAAAG
CCAATATTCCATTTTTTAAAGTTGACACCGAAGCCCAGGGACCAAACTAT
ATTCGGTTACATTATTTTTCCCATAGAAAGAATCTATCGCCAATGATAGA
GTCTCTTTTGGAAGCAATCAGTAAAGTGTTTTTCAAGAAAACTTTGAAAA
TTCAAATTCTGGAAGAAGACCAACAAGGAGAACGACATCATATTTTGTAT
TCGTTGAATATTCAAGATCTCGCCGATGTCATTGACAATCCTCCGACACT
TATTGCACAGACCAGGAAAAATGCTGAGCATCAAATTGAGGAGAAAGATG
TAACAGATCAAAAGGAAAAAATTGAAATGATCCGAAAAGAATACGGAGAG
GCAGCACTGCCAGTTGCACGGGCAAGAAACGCCAACAGCCGATGGAAAGC
GGCATTGAAGATGAATATTATGTATTCCCGGATGCTGCCGACAATTCCAA
AAACTTTGTCAATTGGACCGAAAGATTTCTGTGAATTGTTTCCTTATCAT
TTTGTGTTCGACCAAGCGATGTTGCTGAAACAATCTGGAATTCAAATCCA
AGCAATCATTCCAGATTTCCGACGGATCAACGTCGACATTCGTAAATATT
TGCAGTTGATCCATCCGACACATGAGCAATTCACTTTTGAGAGTGTGGAG
AACCTTTTTTGTAGTCCACACGTCATGAAGGTTATTGACAATAAGTTGAC
TACAACGGCAAATCAAGACGATGAAATTTATTTAAGGGGTCAAATGATCA
AGTTGATGGAAAACCAATGCATTCTCTTCATGTGCTCACCAATGGTGTCA
AGTTTGAATGATATAGAAAGAAAAGGCATGAAAATGTCAGAGATCCCAAA
TCATGATGTAACAAAATATTTTTGTTCATTCCAAACTATAGGAAAAGGAG
ATTGGAGTGATAAATTTCTCGGGAGAGACAATAATACATCGGGGGAGGAC
AATAGCGATGTGGAGACATATGACCATTTCGCTACGCTTGCTGGAGCATC
AACCATGTCTGGGCTTATTAACAATTCACTGAGAGAAGGGAGAAAATATA
AAAACTGCTATATTCTCTTCTGTGATATCGTTCATTTCAGTACAATTGTT
ACAAGTTCCGGACCGAATGAGGTACTGGACATGCTTAACAATATACACAA
TGAGTTTGATAGACTGACCCGAGTTCATAATGTCCAAAAGATCGACAGTA
TCGGTGACGCCTACCTTATTGTCAGCGGTATTCTCGACCATATCAACCAG
AGATCTGAAAGAATCGCAAATATTGCATTGGCAATGATTTTGATTTCTAA
AACTATAAAGAGCCCCTATGATTATGGATCAAACTTCGGGAAAAGAGCAC
TGATCAGAATTGGATTGAATTGCGGTGAGATAATTGGAGGAATTATCGGT
TCTGCAAATCCCAAATTTACAGTAATGGGTGACAGTGTGGTTACAGCTTC
TAAAATGGAGTCCCATGGAATACCCGACCGGATCCACATTACCGCTGCAA
TGTACAGAGAACTCGCTTCAAGTCACTACGATATGGAAGAACGAGGCTGC
ATTGAAATCAGAGGAAAAGGTCGGCAATTTACATATTTCCTCAACAGAAA
TCTCGACGTGTCTGACAATGCTCTGCTTGGAAAAACCAGAGATGCAGTCT
ATTCAAAGAAATAAAAATCATCAACAAAAATTTATTAGAATAATTTCTTG
TAATAGTTGCAGACAACTCCAAAATACAAAACTTGTTCATGGACTAATTG
CAGGAGGTAATGGTGGGTTGCTGCCATGATGCCTCGGCAGTGTTTTGGAA
TTTTAGAATATATTTTTGATATTTAGATTTCATTCAGGTCCTCATTTAGA
ATGTTTGGTGT
back to top

protein sequence of SMED30016104-orf-1

>SMED30016104-orf-1 ID=SMED30016104-orf-1|Name=SMED30016104-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=618bp
MPIKIFHLGIKEEPFLKLLGEAYLSQIQANGNNQLLRVLGKSLLEFLQNV
DFIHTLALGKYPKANIPFFKVDTEAQGPNYIRLHYFSHRKNLSPMIESLL
EAISKVFFKKTLKIQILEEDQQGERHHILYSLNIQDLADVIDNPPTLIAQ
TRKNAEHQIEEKDVTDQKEKIEMIRKEYGEAALPVARARNANSRWKAALK
MNIMYSRMLPTIPKTLSIGPKDFCELFPYHFVFDQAMLLKQSGIQIQAII
PDFRRINVDIRKYLQLIHPTHEQFTFESVENLFCSPHVMKVIDNKLTTTA
NQDDEIYLRGQMIKLMENQCILFMCSPMVSSLNDIERKGMKMSEIPNHDV
TKYFCSFQTIGKGDWSDKFLGRDNNTSGEDNSDVETYDHFATLAGASTMS
GLINNSLREGRKYKNCYILFCDIVHFSTIVTSSGPNEVLDMLNNIHNEFD
RLTRVHNVQKIDSIGDAYLIVSGILDHINQRSERIANIALAMILISKTIK
SPYDYGSNFGKRALIRIGLNCGEIIGGIIGSANPKFTVMGDSVVTASKME
SHGIPDRIHITAAMYRELASSHYDMEERGCIEIRGKGRQFTYFLNRNLDV
SDNALLGKTRDAVYSKK*
back to top

protein sequence of SMED30016104-orf-2

>SMED30016104-orf-2 ID=SMED30016104-orf-2|Name=SMED30016104-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=105bp
MEYPTGSTLPLQCTENSLQVTTIWKNEAALKSEEKVGNLHISSTEISTCL
TMLCLEKPEMQSIQRNKNHQQKFIRIISCNSCRQLQNTKLVHGLIAGGNG
GLLP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000096ventral epidermis
PLANA:0000421tail
Vocabulary: INTERPRO
TermDefinition
IPR038158H-NOX_domain_sf
IPR042463HNOB_dom_associated_sf
IPR001054A/G_cyclase
IPR011644Heme_NO-bd
IPR011645HNOB_dom_associated
IPR024096NO_sig/Golgi_transp_ligand-bd
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0035556intracellular signal transduction
GO:0009190cyclic nucleotide biosynthetic process
GO:0006182cGMP biosynthetic process
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
GO:0020037heme binding
GO:0004383guanylate cyclase activity
GO:0000166nucleotide binding
GO:0016829lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 316..577
e-value: 6.4E-32
score: 122.0
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 412..595
e-value: 1.0E-43
score: 149.1
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 417..550
score: 31.659
IPR011645Haem NO binding associatedPFAMPF07701HNOBAcoord: 217..352
e-value: 1.0E-21
score: 77.4
IPR011644Heme NO-bindingPFAMPF07700HNOBcoord: 8..116
e-value: 5.4E-20
score: 72.0
IPR038158H-NOX domain superfamilyGENE3DG3DSA:3.90.1520.10coord: 6..140
e-value: 8.7E-21
score: 76.2
IPR042463Haem NO binding associated domain superfamilyGENE3DG3DSA:3.30.450.260coord: 218..345
e-value: 3.4E-29
score: 103.3
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 407..597
e-value: 8.3E-51
score: 174.2
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 404..594
NoneNo IPR availablePANTHERPTHR45655:SF17GUANYLATE CYCLASE SOLUBLE SUBUNIT BETA-2coord: 8..613
NoneNo IPR availablePANTHERPTHR45655FAMILY NOT NAMEDcoord: 8..613
NoneNo IPR availableCDDcd07302CHDcoord: 418..594
e-value: 9.16823E-41
score: 144.259
IPR024096NO signalling/Golgi transport ligand-binding domain superfamilySUPERFAMILYSSF111126Ligand-binding domain in the NO signalling and Golgi transportcoord: 8..136