Translocated promoter region b, nuclear basket protein

Overview
NameTranslocated promoter region b, nuclear basket protein
Smed IDSMED30016090
Length (bp)6255
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Translocated promoter region b, nuclear basket protein (SMED30016090) t-SNE clustered cells

Violin plots show distribution of expression levels for Translocated promoter region b, nuclear basket protein (SMED30016090) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Translocated promoter region b, nuclear basket protein (SMED30016090) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Translocated promoter region b, nuclear basket protein (SMED30016090) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016090

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016090h1SMcG0018753 dd_Smed_v6_2899_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016090h1SMcG0018753 dd_Smed_v4_2899_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Human
Match: TPR (translocated promoter region, nuclear basket protein [Source:HGNC Symbol;Acc:HGNC:12017])

HSP 1 Score: 170.244 bits (430), Expect = 2.144e-41
Identity = 345/1422 (24.26%), Postives = 656/1422 (46.13%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMK---LEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKID------KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSEN----------RASSSANLTITESCTVGVIQTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAI---LQRENDWN----EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI--LIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSEIVKI 4354
            R  +EL Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++   LE E       Q   E+  +I R + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y++  ++    +++  R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + ++++++   L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE A  E++          QL+K+   ++H +Q +  +  + D+  +L S   GV  P   A  L  V   +      T+    +     V ES E I+      +LQ   +  + EK    +  +  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  L     E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E           + +     T+ +  +   +Q A +  ++TG           DL SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q++EL++ L    N         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q       + +S L    + W   +R L++E S+   + E L   NRL  L+DQ+  L   +  S    +   +   L  E        E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R  +L+ + K  + EE++++  EK+    +I  L EE         +  LK +I     SL + +N ++SLKE  D N+  T+K +                  ITQ++ IGR+YKT+ E L ++  K+
Sbjct:  133 RLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVE---QSKDQMEKEMLEKIGRLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELE----------QLRKS---RQHQMQLVDSIVRQRDMYRILLSQTTGVAIP-LHASSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLH----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQ-------KAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRL--LHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEE---------IGRLKAEIARSNASLTNNQNLIQSLKE--DLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQDKV 1455          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Human
Match: TPR (translocated promoter region, nuclear basket protein [Source:HGNC Symbol;Acc:HGNC:12017])

HSP 1 Score: 117.087 bits (292), Expect = 1.326e-25
Identity = 145/561 (25.85%), Postives = 275/561 (49.02%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMK---LEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHL 1996
            R  +EL Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++   LE E       +++ E   +I R + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y++  ++    +++  R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + ++++++   L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+                                     SS    ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE A  E++          QL+K+   ++H +Q +  +  + D+  +L S   GV  P  ++ L
Sbjct:  133 RLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVEQSKDQMEKEMLE---KIGRLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEV-------------------------------------SSADISSSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELE----------QLRKS---RQHQMQLVDSIVRQRDMYRILLSQTTGVAIPLHASSL 633          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Fly
Match: Mtor (gene:FBgn0013756 transcript:FBtr0088033)

HSP 1 Score: 62.7734 bits (151), Expect = 4.859e-9
Identity = 88/332 (26.51%), Postives = 165/332 (49.70%), Query Frame = 2
Query: 3605 VIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEE------------KSRVNSE----------LLEELKTQIEEYE------------------RSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYK------------TESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKK 4444
            +I++LR+EK+      +  + +  RL +++  Q++ +D+LN  L +ER     +  +  +H E++ ++E+   + +SN  LR +R  +   +AE T+++  + + + PL+   K   ++IE + ++  SL  E   WR+R + L+EKS + NPEEFK++  E++ L   +  E+E            K R+N+E          L E  K Q++E+                   R L+ +E  L++ +E+  K++    K +  + QLR + ++YK            TES   ++E+ K+  E E    +L+ALK E  +I +  DE KK
Sbjct: 1207 IIKFLRKEKDLFAAKLDILKAENARLISEHAIQQKKVDELNGYLNQERAKSQTDVVSANKHEEVLRKIETLNAITDSNRILREERNALTLRVAELTDRISSVEKELFPLQCSNKELTSKIEEINVENTSLRTEAIKWRQRANALVEKSNR-NPEEFKRLQAEREHLAKLLTAEKELNKKQSDELTVLKQRMNTEIPMLNKQMQILDEARKKQVDEFTNLKQNNTRQTQDIMELKNRLLQKEEELLKANEELETKDKTIADKETKEL-QLRKLAKRYKDFYIGLQSQGGGTES---AAELEKVRSELEEVNNQLRALKDEHEKITKECDEVKK 1533          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Fly
Match: Mtor (gene:FBgn0013756 transcript:FBtr0332464)

HSP 1 Score: 62.7734 bits (151), Expect = 4.859e-9
Identity = 88/332 (26.51%), Postives = 165/332 (49.70%), Query Frame = 2
Query: 3605 VIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEE------------KSRVNSE----------LLEELKTQIEEYE------------------RSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYK------------TESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKK 4444
            +I++LR+EK+      +  + +  RL +++  Q++ +D+LN  L +ER     +  +  +H E++ ++E+   + +SN  LR +R  +   +AE T+++  + + + PL+   K   ++IE + ++  SL  E   WR+R + L+EKS + NPEEFK++  E++ L   +  E+E            K R+N+E          L E  K Q++E+                   R L+ +E  L++ +E+  K++    K +  + QLR + ++YK            TES   ++E+ K+  E E    +L+ALK E  +I +  DE KK
Sbjct: 1207 IIKFLRKEKDLFAAKLDILKAENARLISEHAIQQKKVDELNGYLNQERAKSQTDVVSANKHEEVLRKIETLNAITDSNRILREERNALTLRVAELTDRISSVEKELFPLQCSNKELTSKIEEINVENTSLRTEAIKWRQRANALVEKSNR-NPEEFKRLQAEREHLAKLLTAEKELNKKQSDELTVLKQRMNTEIPMLNKQMQILDEARKKQVDEFTNLKQNNTRQTQDIMELKNRLLQKEEELLKANEELETKDKTIADKETKEL-QLRKLAKRYKDFYIGLQSQGGGTES---AAELEKVRSELEEVNNQLRALKDEHEKITKECDEVKK 1533          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Zebrafish
Match: tprb (translocated promoter region b, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-030131-6410])

HSP 1 Score: 131.724 bits (330), Expect = 8.206e-30
Identity = 177/691 (25.62%), Postives = 330/691 (47.76%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMND-------LEFRRKDFEQMEQMSLLRSK--KLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS----LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSA--HLL-------SPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKE-LNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKS 2353
            RR +E+ +   +++ L   L E   ++++ +L + +       ++++ K  EQ  +  LL+S+   L+TE+K   E+L   ++   NE       + +    L+ K +EI   +  +  LK      ++   E    +R A E Q  ++     ELN  + ++ L K    + E K E    A+ EL + LKE  E    ++++     S   ++++EL+ +I+ ++ EL  AN L    R +     L+E ++  M+P  AA    +K G  +T+IY+ Y++     +  +++  RL++Y+  I++E+E KAP+LK+Q+EE+  ++ SVS+L  K +  +++++  Q E +ES+++   L R  +R E   +D+++QV  L+ E+E  RG  V+R D+                                 G++  SS      ++VI+ HLVTF+++ ELQQQN RL+   RDLS+++E  E   +     ++ K LE+  +E++ +KEK  Q+ Q   TV  Q+             D+  +L +   GV  P G+    L+       SP    T      T L   +  + +  E++  + +LQ      + EK I  EK      E L   ++E++  N  +  ++ F  ++   L+ N+          + DI+ LN+KL K++
Sbjct:  133 RRSQEMEHQSEDLKRLNDRLVEVSAEKMQLQLKLEESETSEVSIKYKEKRMEQ--EKDLLQSQVTWLNTELKAKSEELLSLSRQRGNE-------ILELQCNLNNKEDEITRLQDQVTSLKASNETFQKQAEEMIIKMREAKEQQAALEEKFSNELNANIKLSNLYKGAAADAEAKSEELSRAVDELHKLLKEAGEAHKDLEVKMADLESHKNKEIAELKEKISSQEKELDNANDLLSDSRHRGAASILTEEQVTIMSPTAAAVAKMIKPGMKLTEIYTAYVETQEHLQREKLENKRLHKYLDDIVQEMEAKAPILKRQREEYERMQKSVSSLSAKLEQAVTEVHRLQKESDESNKRASVLERDNQRFEVQLADMAQQVRVLLVELEEARGNHVMREDD-------------------------------DVGSADVSST-----SEVISQHLVTFRSVEELQQQNQRLLVALRDLSEEKEKDELEGDTMKRSEVEKYLEELQRELEQLKEKRTQDLQKVDTVARQR-------------DMFRMLLTQTTGVTFPQGAGAEELMLTSTPRRSPA--VTPTTGTPTALVATAIESTESVEAKAALKQLQEVFVAYKKEK-IESEKAQIEQNEKLQDQVTELRSENMKISTQLEFTSKRYEMLQDNV-------EGYRKDIASLNEKLQKQA 755          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Zebrafish
Match: tpra (translocated promoter region a, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-081104-2])

HSP 1 Score: 118.242 bits (295), Expect = 1.002e-25
Identity = 317/1341 (23.64%), Postives = 620/1341 (46.23%), Query Frame = 2
Query:  623 NLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNES-------LRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQV-----SELRMEINRKDNELTEAN---ALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLA---KKSEENVSLASQ-LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIE--QANEDQIE-LKSKIKQLTLELKQE------------------KSKYQSSLEMWQAK---FSESNAVIDTLKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQ-------IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREK--------------SLEDQVNELERLLGD-KTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTV-----NSIDFAILQRENDWNE----VIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSEL------LEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKELQ 4390
            NLEL   R  +++ K+ + +L++Q++ L++ N    +S       L+ A E + +++   R ELN  + +  L K    ++E K      A+ EL + LKE +E +       E KLS   Q V     S+LR ++   + EL  +N   A F++  V +L+E E+ +++P  AA    +K G  + ++Y+ +++  ++    +++  R+N+ +  I+ E+E KAP+LK+Q+EE+  ++ S+++L  K +  + +++  Q E +E++++   L R  ++ E+  +D+S QV  L+ EVE  RG  V+R D  S  ++  E    R+                                       V F++I ELQQQN  L+ + RDL +Q+E  +N        ++ + LE+  KE++ IKE+    K L ++   Q+ + + L    G      L   G+      DG +   +P + G     + T L   +  + +  +S+  + ++ +     + EK    +  +  I+ L   +S++    A L +++ F  ++   L++N+   + E   L+    E NQK++   ++ E+ +   +Q L     +L   E+  + ++  R  ++ +E +LN EK        S + +   L SIQ+ + + + E  Q   +QI+ L+ +I QL   L+QE                  K K +S   + Q        +   + +L+ QLN+    S++    +     V    + P+  ++  DL ++L+ +   N  LK++       +E Y  ++ + E  +    QL E              Q +   +  L+ A+ +N+QLE+   + EK              S+E++V EL+R + + +T   + L    + +  +E +   D + Q ++   A   Y++EL+ HA + +AL    KQ   +    + L E+ Q+      QY++D       W+ +++ L+   S+ + + E L  +   L++Q+ NL   +  ST      +S++ + L  E   +E    +++++R+EKE  E      E++  R + +    E  + +L  +L  ER    V  +T  Q  E M  MES   L ++N  L+ ++ R++  L +T  K+ KL   I+PL+    EL  K+  ++  K   R LE +    + R   L+ + K  + EE K++  E++    +I  + EE  ++ +E+      +   ++Q++  + SL     + +SLK+  +    + Q+    ITQ++ IGR+YKT+ E L  +  K+  E  +K  + Q
Sbjct:  213 NLEL---RCSLESKKEEVTRLQDQVNTLKKANDSMQKSTEDLMRKLKEAKEQRASMEEKYRNELNANLKLCNLYKGAASDSEAKNTELNRAVEELNKLLKEAMEANKGT----EKKLSEL-QSVREKAESDLREKVRHLEKELENSNTRLADFKRRGVPALTEEELTNLSPTAAAVAKIVKPGMKLMELYNAFVEAQDQLHLEKLENKRVNKVLDEIVLEVETKAPILKRQREEYESMQKSMTSLCYKLEQAMKEVHRLQKETDEANKRALVLERDNQKSERQLADMSEQVRVLLVEVEEARGNQVVREDVSSAVSSSSEVQGSRQ---------------------------------------VAFRSIQELQQQNQNLLVKIRDLEEQREKDQNQAKSAKQTELEQSLEKVQKELEQIKEQQNHQKLLAESAIRQRDMYRILLQTAGV----ELPPQGS------DGGSQSTTPSRPGPMATRS-TPLRAAAAESFQATQSKAALKQINDAFTTYKKEKAENDKLLNEQIERLRGQVSDLLSQKAKLSSQLEFASKRYDMLQENVNGFRRETEALR----ERNQKMSATHQRHEQIIHTMTQDLREANEKLTMSESRAENIRKERDILKQVENRLNQEKESILTEQRSQNLLLTNLKSIQLTMERSETETKQRYNNQIQHLEKEIIQLKKRLEQEVEQRHALERNQDTQLLEAKKKLESQTALHQKTKELLRSAEQQVTSLRQQLNNNENQSAAPKQPVRTLPRVSAP-SVPQ--QEADDLRARLQQVEEQNSDLKERLKNTTTNVEQYRSMVLSLEESVNKEKQLAE--------------QARTSTDNQLKMARELNQQLEARLVEAEKEKLELQQEKMKAVDSVEERVKELKRSMTNMQTELQEALQRSTAAV-TQEQKATQDSKVQAKLAAEAQNKYERELMLHAADVEALQAAKKQGQLLTQNMKQLEEKAQKAASELHQYRTD-------WVMQEKRLKETLSKEQKRAEELQKQNTLLHEQMENLSSKITASTQQETGESSLNIS-LNEEGKSHEQILDILRFVRREKEIAETRLEVAEVETLRYKQRMEYLECELKELQDSLNVEREKLQVTTKTLVQQEETMKRMESMSALTDTNKMLKNEKNRLEHELQQTQAKMRKLEADIKPLQEANGELSEKSGMLQAEK---RLLEEDVKRLKSRTQQLLNQQKDSDQEESKKLHSERETHLKRIQQLTEETGKLKNEVARSQASITTAQSQVQNLQDSLGKVTTERDSLKKELEAKTLDIQEKVKTITQVKKIGRRYKTQYEELKEQHDKMVAEAASKPAQEQ 1462          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 178.718 bits (452), Expect = 6.177e-44
Identity = 354/1456 (24.31%), Postives = 674/1456 (46.29%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVI-RSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGV--DSPDGSAHLLSPVQ-DGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNS-----ENRAS-SSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELER----LLGDKTNAFDMLNGEMS-LLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKM--------------SSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKEL--QALKKEIVEIKQLLDES 4438
            RR +EL +  ++I  L   L E  T ++E ++ +++++       +R K  EQ +++   ++  L+ E+K   E+L    +   NE       + +    L+ K++E+   +  ++ LK    +L++   E    L+   E Q + +     ELN  + +  L K   E++E K      A+ EL + LKE  E +  ++ +     +   Q   ++  +I+  + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ ++    Q++ EK+E +    R+ +Y+  I++E+E KAP+LK+Q+EEH  ++ +V++L  K +  + ++   Q E +++++    L R+ +R E    DLS+Q+  L+ E+E  RG  + R D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV   +PD  +   +P +  G     + +    +++ + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S I+E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y++ L +    +     S+  I  LK QLNS      +R+S    N+   E     + Q+           E Q+ DL     +    +E Y  ++ + E  L    Q+ EE     + R+ E ++ + ++E+ +  ++   ++L    +   + +E QV +L +    L  +   A        S   KAK+     D + Q ++   A   Y++EL+ HA + +AL    +Q++   +  +   E  Q+        +S L    + W   +R L+ E S+++S+ E L   NRL  L++Q+ +L K +    V+S+    L        + +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR ++++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   +NQL+S+KE   K +AE  K+              +  ITQ++ IGR+YKT+ E L     K+T +   K ++L  QA +KE+ E+K  L+ S
Sbjct:  157 RRAQELEHLNDDIIRLNDKLKEANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNE-------ILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGESNKSIQEQLSQMDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAFVETQDQLLMEKQENK----RITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLERENQRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTSTPAAVASDSTEAAEAKAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNIEDVEEIKTKLRQS-----------EEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTEEARKTIEVRLKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQ-----DCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKA-------ESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRL--LHEQIESLSKKM----VSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNRILREEKEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVKRWRARTQHLLNQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQNQLQSVKEDLTKIKAEKDKLQKELDAKILDIQEKTKTITQVKKIGRRYKTQYEEL-----KVTHDTVTKAEQLQEQASQKEMQELKDSLERS 1494          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 177.948 bits (450), Expect = 8.902e-44
Identity = 354/1456 (24.31%), Postives = 674/1456 (46.29%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVI-RSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGV--DSPDGSAHLLSPVQ-DGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNS-----ENRAS-SSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELER----LLGDKTNAFDMLNGEMS-LLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKM--------------SSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKEL--QALKKEIVEIKQLLDES 4438
            RR +EL +  ++I  L   L E  T ++E ++ +++++       +R K  EQ +++   ++  L+ E+K   E+L    +   NE       + +    L+ K++E+   +  ++ LK    +L++   E    L+   E Q + +     ELN  + +  L K   E++E K      A+ EL + LKE  E +  ++ +     +   Q   ++  +I+  + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ ++    Q++ EK+E +    R+ +Y+  I++E+E KAP+LK+Q+EEH  ++ +V++L  K +  + ++   Q E +++++    L R+ +R E    DLS+Q+  L+ E+E  RG  + R D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV   +PD  +   +P +  G     + +    +++ + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S I+E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y++ L +    +     S+  I  LK QLNS      +R+S    N+   E     + Q+           E Q+ DL     +    +E Y  ++ + E  L    Q+ EE     + R+ E ++ + ++E+ +  ++   ++L    +   + +E QV +L +    L  +   A        S   KAK+     D + Q ++   A   Y++EL+ HA + +AL    +Q++   +  +   E  Q+        +S L    + W   +R L+ E S+++S+ E L   NRL  L++Q+ +L K +    V+S+    L        + +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR ++++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   +NQL+S+KE   K +AE  K+              +  ITQ++ IGR+YKT+ E L     K+T +   K ++L  QA +KE+ E+K  L+ S
Sbjct:  169 RRAQELEHLNDDIIRLNDKLKEANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNE-------ILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGESNKSIQEQLSQMDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAFVETQDQLLMEKQENK----RITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLERENQRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTSTPAAVASDSTEAAEAKAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNIEDVEEIKTKLRQS-----------EEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTEEARKTIEVRLKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQ-----DCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKA-------ESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRL--LHEQIESLSKKM----VSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNRILREEKEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVKRWRARTQHLLNQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQNQLQSVKEDLTKIKAEKDKLQKELDAKILDIQEKTKTITQVKKIGRRYKTQYEEL-----KVTHDTVTKAEQLQEQASQKEMQELKDSLERS 1506          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 177.563 bits (449), Expect = 1.099e-43
Identity = 354/1456 (24.31%), Postives = 674/1456 (46.29%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVI-RSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGV--DSPDGSAHLLSPVQ-DGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNS-----ENRAS-SSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELER----LLGDKTNAFDMLNGEMS-LLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKM--------------SSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKEL--QALKKEIVEIKQLLDES 4438
            RR +EL +  ++I  L   L E  T ++E ++ +++++       +R K  EQ +++   ++  L+ E+K   E+L    +   NE       + +    L+ K++E+   +  ++ LK    +L++   E    L+   E Q + +     ELN  + +  L K   E++E K      A+ EL + LKE  E +  ++ +     +   Q   ++  +I+  + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ ++    Q++ EK+E +    R+ +Y+  I++E+E KAP+LK+Q+EEH  ++ +V++L  K +  + ++   Q E +++++    L R+ +R E    DLS+Q+  L+ E+E  RG  + R D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV   +PD  +   +P +  G     + +    +++ + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S I+E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y++ L +    +     S+  I  LK QLNS      +R+S    N+   E     + Q+           E Q+ DL     +    +E Y  ++ + E  L    Q+ EE     + R+ E ++ + ++E+ +  ++   ++L    +   + +E QV +L +    L  +   A        S   KAK+     D + Q ++   A   Y++EL+ HA + +AL    +Q++   +  +   E  Q+        +S L    + W   +R L+ E S+++S+ E L   NRL  L++Q+ +L K +    V+S+    L        + +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR ++++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   +NQL+S+KE   K +AE  K+              +  ITQ++ IGR+YKT+ E L     K+T +   K ++L  QA +KE+ E+K  L+ S
Sbjct:  133 RRAQELEHLNDDIIRLNDKLKEANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNE-------ILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGESNKSIQEQLSQMDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAFVETQDQLLMEKQENK----RITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLERENQRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTSTPAAVASDSTEAAEAKAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQDVNIEDVEEIKTKLRQS-----------EEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTEEARKTIEVRLKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQ-----DCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKA-------ESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRL--LHEQIESLSKKM----VSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNRILREEKEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVKRWRARTQHLLNQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQNQLQSVKEDLTKIKAEKDKLQKELDAKILDIQEKTKTITQVKKIGRRYKTQYEEL-----KVTHDTVTKAEQLQEQASQKEMQELKDSLERS 1470          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 174.481 bits (441), Expect = 9.111e-43
Identity = 355/1452 (24.45%), Postives = 673/1452 (46.35%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVI-RSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGV--DSPDGSAHLLSPVQ-DGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNS-ENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELER----LLGDKTNAFDMLNGEMS-LLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKM--------------SSLITQLRDIGRKYKTESESLS-SEIVKITDEKENKCKEL--QALKKEIVEIKQLLDES 4438
            RR +EL +  ++I  L   L E  T ++E ++ +++++       +R K  EQ +++   ++  L+ E+K   E+L    +   NE       + +    L+ K++E+   +  ++ LK    +L++   E    L+   E Q + +     ELN  + +  L K   E++E K      A+ EL + LKE  E     K ++        +++S L       + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ ++    Q++ EK+E +    R+ +Y+  I++E+E KAP+LK+Q+EEH  ++ +V++L  K +  + ++   Q E +++++    L R+ +R E    DLS+Q+  L+ E+E  RG  + R D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV   +PD  +   +P +  G     + +    +++ + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S I+E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y++ L +    +     S+  I  LK QLNS E + +S  ++ I +   V  I+T      K    E Q+ DL     +    +E Y  ++ + E  L    Q+ EE     + R+ E ++ + ++E+ +  ++   ++L    +   + +E QV +L +    L  +   A        S   KAK+     D + Q ++   A   Y++EL+ HA + +AL    +Q++   +  +   E  Q+        +S L    + W   +R L+ E S+++S+ E L   NRL  L++Q+ +L K +    V+S+    L        + +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR ++++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   +NQL+S+KE   K +AE  K+              +  ITQ++ IGR+YKT+ E L  +    + +    K ++L  QA +KE+ E+K  L+ S
Sbjct:  128 RRAQELEHLNDDIIRLNDKLKEANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNE-------ILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGE----CKSDYAIVEKDMGEKISNL-------ERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAFVETQDQLLMEKQENK----RITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLERENQRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTSTPAAVASDSTEAAEAKAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASHKDVNIED---VEEIKT------KLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTEEARKTIEVRLKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSHSSLQAEVQQALQRATTSASNEQKAKQ-----DCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKA-------ESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRL--LHEQIESLSKKM----VSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNRILREEKEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVKRWRARTQHLLNQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQNQLQSVKEDLTKIKAEKDKLQKELDAKILDIQEKTKTITQVKKIGRRYKTQYEELKVTHDTLVAEASTAKAEQLQEQASQKEMQELKDSLERS 1457          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Match: sos2 (SOS Ras/Rho guanine nucleotide exchange factor 2 [Source:Xenbase;Acc:XB-GENE-1006170])

HSP 1 Score: 173.711 bits (439), Expect = 1.724e-42
Identity = 346/1432 (24.16%), Postives = 662/1432 (46.23%), Query Frame = 2
Query:  410 LTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEE-LSRKLKREEQTSSDLSRQVCCLIREVETYRGTVI-RSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVD--SPDGSAHLLSPVQD-GTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNS-----ENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNEL---ERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNL-KKLLDPSTVNSIDFAILQR---ENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKM--------------SSLITQLRDIGRKYKTESESLS-SEIVKITDEKENKCKEL--QALKKEIVEIKQLLDES 4438
            L E  T ++E ++ +++++       +R K  EQ +++   ++  L+ E+K   E+L    +   NE       + +    L+ K++E+   +  ++ LK    +L++   E    L+   E Q + +     ELN  + +  L K   E++E K      A+ EL + LKE  E +  ++ +     +   Q   ++  +I+  + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ ++    Q++ EK+E +    R+ +Y+  I++E+E KAP+LK+Q+EEH  ++ +V++L  K +  + ++     +      KC   L R+ +R E    DLS+Q+  L+ E+E  RG  + R D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV   +PD  +   +P +  G     + +    +++ + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S I+E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y++ L +    +     S+  I  LK QLNS      +R+S  A++ I +   V  I+T      K    E Q+ DL     +    +E Y  ++ + E  L    Q+ EE     + R+ E ++ + ++E+ +  ++   ++L    +   + +E QVN +   E L  +   A        S     E +   D + Q ++   A   Y++EL+ HA + +AL    +Q++   +  +   E  Q+        +S L    + W   +R L+ E S+++S+ E L   NRL  L++Q+ +L KK++      +++ +  +    +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR ++++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   +NQL+S+KE   K +AE  K+              +  ITQ++ IGR+YKT+ E L  +    + +    K ++L  QA +KE+ E+K  L+ S
Sbjct:   85 LKEANTAKMELQMKLDEIQSSEVSIKYREKRLEQEKELLQSQNTWLNGELKSKTEELLAVQKGKGNE-------ILELKGALENKQDEVARLEDQVKSLKSCNENLQKQAEELMNKLKETKEQQASSEEKFHNELNANIKLCNLYKSASEDSEAKSTELTRAVEELHKLLKEAGESNKSIQEQLSQMDAAKIQVEKDMGEKISNLERELENANDLLCSTKRKGVLLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAFVETQDQLLMEKQENK----RITKYLDEIVKEVEAKAPILKRQREEHERMQKTVASLSAKLEQAMRRMQDETDKAN----KCSSVLERENQRLELQMKDLSQQIRVLLMELEEARGNYVQRDDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQETTSSRVSELEKELEHALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVSLPAPDEISLTSTPRKSPGVTQVVSTSTPAAVASDSTEAAEAKAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITTLQEKTQKLSATTQKQEQIINTLTQDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLIAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIERLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYETELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQADVNIED---VEEIKT------KLRQSEEQVNDLKERLKTATSNVEQYRSVVLSLEESLNKEKQVTEEARKTIEVRLKEASEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVNIMSLPEVLQAEVQQALQRATTSAS----NEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKEQLASAASVRQKFEETAQKA-------ESQLLECTASWEERERMLKEEVSQIQSRCEDLEKQNRL--LHEQIESLSKKMVSSVQEGALNISFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMEREVHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNRILREEKEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVKRWRARTQHLLNQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQNQLQSVKEDLTKIKAEKDKLQKELDAKILDIQEKTKTITQVKKIGRRYKTQYEELKVTHDTLVAEASTAKAEQLQEQASQKEMQELKDSLERS 1406          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Mouse
Match: Tpr (translocated promoter region, nuclear basket protein [Source:MGI Symbol;Acc:MGI:1922066])

HSP 1 Score: 162.155 bits (409), Expect = 4.665e-39
Identity = 348/1425 (24.42%), Postives = 655/1425 (45.96%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQ---------ALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTL--NGKVAESQEKID--KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSE-NRASSSANLTITESCTVGVI---------QTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAI---LQRENDWN----EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSE 4342
            R  +E+ Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++           Q   E+  +I + + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y+    Q++ EK+E +    R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + +++++    L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE +  E++ ++E  +   QL  ++  Q+ + +         A+ +     D  SLL++      S   S     PV D T     +  L  +  +  N K    +EKID  KLQNE                  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  LQ    E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E N   ++  L       +  +         Q A +  ++TG           DL+SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q++EL++ L    N         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q       + +S L    + W   +R L++E S+  S+ E L   NRL  L+DQ+  L   +  S  +++   +   L  E        E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R   LI + K  + EE++++  EK+    +I  + EE  R        LK +I     SL + +N ++SL+E  D ++A T+K                    ITQ++ IGR+YKT+ E L ++
Sbjct:  207 RLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKTIQDHLLQVEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKQENK----RINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGMAIPLQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYK----KEKIDSEKLQNE-----------------QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQ----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLNSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLSTVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQ-------KAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRL--LHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGR--------LKAEIARSNASLTNNQNLIQSLRE--DLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEELKAQ 1525          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Mouse
Match: Tpr (translocated promoter region, nuclear basket protein [Source:MGI Symbol;Acc:MGI:1922066])

HSP 1 Score: 160.614 bits (405), Expect = 1.286e-38
Identity = 347/1424 (24.37%), Postives = 656/1424 (46.07%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQ---------ALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTL--NGKVAESQEKID--KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSE-NRASSSANLTITESCTVGVI---------QTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAI---LQRENDWN----EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSE 4342
            R  +E+ Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++           Q   E+  +I + + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y+    Q++ EK+E +    R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + +++++    L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE +  E++ ++E  +   QL  ++  Q+ + +         A+ +     D  SLL++      S   S     PV D T     +  L  +  +  N K    +EKID  KLQNE                  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  LQ    E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E N   ++  L       +  +         Q A +  ++TG           DL+SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q++EL++ L    N         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q+        +S L    + W   +R L++E S+  S+ E L   NRL  L+DQ+  L   +  S  +++   +   L  E        E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R   LI + K  + EE++++  EK+    +I       ++N E +  LK +I     SL + +N ++SL+E  D ++A T+K                    ITQ++ IGR+YKT+ E L ++
Sbjct:  133 RLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKTIQDHLLQVEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKQENK----RINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGMAIPLQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYK----KEKIDSEKLQNE-----------------QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQ----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLNSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLSTVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQKA-------ESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRL--LHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRI------QQLNEE-VGRLKAEIARSNASLTNNQNLIQSLRE--DLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEELKAQ 1451          
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Match: sp|P12270|TPR_HUMAN (Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3)

HSP 1 Score: 170.244 bits (430), Expect = 1.030e-40
Identity = 345/1422 (24.26%), Postives = 656/1422 (46.13%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMK---LEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKID------KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSEN----------RASSSANLTITESCTVGVIQTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAI---LQRENDWN----EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI--LIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSEIVKI 4354
            R  +EL Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++   LE E       Q   E+  +I R + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y++  ++    +++  R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + ++++++   L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE A  E++          QL+K+   ++H +Q +  +  + D+  +L S   GV  P   A  L  V   +      T+    +     V ES E I+      +LQ   +  + EK    +  +  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  L     E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E           + +     T+ +  +   +Q A +  ++TG           DL SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q++EL++ L    N         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q       + +S L    + W   +R L++E S+   + E L   NRL  L+DQ+  L   +  S    +   +   L  E        E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R  +L+ + K  + EE++++  EK+    +I  L EE         +  LK +I     SL + +N ++SLKE  D N+  T+K +                  ITQ++ IGR+YKT+ E L ++  K+
Sbjct:  133 RLSQELEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVSVKYREKRLEQEKELLHSQNTWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVSRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVEELHKLLKEAGEANKAIQDHLLEVE---QSKDQMEKEMLEKIGRLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSVKLEQAMKEIQRLQEDTDKANKQSSVLERDNRRMEIQVKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLVALRELGETREREEQETTSSKITELQLKLESALTELE----------QLRKS---RQHQMQLVDSIVRQRDMYRILLSQTTGVAIP-LHASSLDDVSLASTPKRPSTSQTVSTPAPVPVIESTEAIEAKAALKQLQEIFENYKKEKAENEKIQNEQLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLH----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTETNLHLNTKELLKNAQKEIATLKQHLSNMEVQVASQSSQRTGKGQPSNKEDVDDLVSQLRQTEEQVNDLKERLKTSTSNVEQYQAMVTSLEESLNKEKQVTEEVRKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRRAIESMEQQLSELKKTLSSVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQ-------KAESQLLECKASWEERERMLKDEVSKCVCRCEDLEKQNRL--LHDQIEKLSDKVVASVKEGVQGPLNVSLSEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQDLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQHLVSQQKDPDTEEYRKLLSEKEVHTKRIQQLTEE---------IGRLKAEIARSNASLTNNQNLIQSLKE--DLNKVRTEKETIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQYEELKAQQDKV 1455          
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Match: sp|F6ZDS4|TPR_MOUSE (Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr PE=1 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 3.263e-38
Identity = 348/1425 (24.42%), Postives = 655/1425 (45.96%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYL----QVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQ---------ALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTL--NGKVAESQEKID--KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSE-NRASSSANLTITESCTVGVI---------QTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNSIDFAI---LQRENDWN----EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSE 4342
            R  +E+ Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++           Q   E+  +I + + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y+    Q++ EK+E +    R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + +++++    L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE +  E++ ++E  +   QL  ++  Q+ + +         A+ +     D  SLL++      S   S     PV D T     +  L  +  +  N K    +EKID  KLQNE                  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  LQ    E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E N   ++  L       +  +         Q A +  ++TG           DL+SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q++EL++ L    N         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q       + +S L    + W   +R L++E S+  S+ E L   NRL  L+DQ+  L   +  S  +++   +   L  E        E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R   LI + K  + EE++++  EK+    +I  + EE  R        LK +I     SL + +N ++SL+E  D ++A T+K                    ITQ++ IGR+YKT+ E L ++
Sbjct:  207 RLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVAVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNE-------ILELKCNLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKTIQDHLLQVEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKQENK----RINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQHKLENSLAELEQLRESRQHQMQLVDSIVRQRDMYRILLSQTTGMAIPLQASSLDDISLLSTPKRSSTSQTVSTPAPEPVIDSTEAIEAKAALKQLQEIFENYK----KEKIDSEKLQNE-----------------QLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQ----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLNSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSTSNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLSELKKTLSTVQNEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMTSIRQHLEETTQ-------KAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRL--LHDQIEKLSDKVVTSMKDAVQAPLNVSLNEEGKSQEQILEILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNVEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQQLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGR--------LKAEIARSNASLTNNQNLIQSLRE--DLSKARTEKEGIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEELKAQ 1525          
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Match: sp|Q5EE04|TPR_XENLA (Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=8355 GN=tpr PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.021e-37
Identity = 300/1229 (24.41%), Postives = 567/1229 (46.14%), Query Frame = 2
Query:  992 INRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQ----VVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSP--DGSAHLLSPVQDGTG---DNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEK----EIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQ------LSSIQIYLNKP--QIEQANEDQI-----ELKSKIKQLTLELKQE--------------KSKYQSSLEMW---QAKFSESNAVIDTLKSQLNSE--NRASSSANLTITESCTVGV--IQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE---LKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS--------------SLITQLRDIGRKYKTESESLSSEIVKITDEKEN-KCKEL--QALKKEIVEIKQLLDES 4438
            I+  + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y++    ++ EK+E +    R+ +Y+  I++E+E K+P+LK+Q+EE+  ++ +V++L  K +  + ++   Q E +++++    L R+ +R E    DLS+Q+  L+ E+E  RG  ++ D++S                                          ++++VIT HLVT++NI ELQQQN RL+   R+L + +E  E     + + ++ K+LE A  E+  ++E             A+ H +  +  +  + D+  +L S   GV  P  D +A L S  +   G   D +  T    + + + + AE++  + +LQ   +  R EK     ++ E+H     +L + ++E++  N  +  ++ F  ++   L+ N+   + E+  LQ    +L+    K+ +   +L   L +   +L   E   + ++  ++ ++  E +L  E+       S ++E   Q      L +IQ+ L +   +I+Q   +QI     EL    K+L  E++Q               K +Y+  L +    +     S+  I  LK QLNS     AS S+         V +  ++    K+ ++ +L   + DL     +    +E Y  ++ N E  L    Q+ EE+    + R+ E ++ + ++E+ +  ++   ++L    +   + +E QV +L + L              +   + E +   D + Q ++   A   Y++EL+ HA + +AL    KQ++          E  Q+           LE+R S W   +R L+ E S+++S+ + L  +   L++Q+ +L K +    V S+    L        + +    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  +L+ESN  LR + ++ ++ L +   K+ KL  +I PL+   AEL  K+  ++  K   + LE +   WR R  +L+ + K  + EE+K++  E++    +I           +L EE   LKT++     SL   ++QL+S+K+   K +AE +K+                 ITQ++ IGR+YKT+ E L     K+  E  + K  +L  QA +KE+ E+K  L  S
Sbjct:   22 ISNLERELENANDLLCSTKRKGVMLSEEELTAMSPTAAAVAKVVKPGMKLTELYNAYVETQDKLLMEKQENK----RITKYLDEIVKEVEAKSPILKRQREEYERMQKTVASLSAKLEQAMREIQRMQDETDKANKCSSVLERENQRLELQIKDLSQQIRVLLMELEEARGNFVQRDDVSSANIS-------------------------------------SSSEVITQHLVTYRNIEELQQQNQRLLVALRELGEAKEREEQESTSSRVSELEKELENALSELQQLRE-------------ARSHQMTLVESIVRQRDMYRILLSQTTGVVLPAQDETA-LTSTPRKSPGVSLDGSTSTPAAVVVSDSTEAAEARAALKQLQEVFENYRKEKAENDRMLNEQHD----KLQEQVTELRSQNTKISTQLEFASKRYEMLQDNVEGYRREITALQEKTQKLSATTQKQEQIINTLTHDLRAANEKLAVAEVRAENLKREKELLKMSEVRLTQERE------SLVAEQRGQNLLLTNLQTIQVTLERSETEIKQRYNNQIEKLEQELAQTKKKLEHEIEQRHLLGKNQDVQVLELKKQYEMELNLHNNTKELLKNSHKEISVLKQQLNSFELQLASRSSQQAANRDKDVNIEDVEEIKTKLRQSEEL---VNDLKERLKTATSNVEQYRSVVLNLEESLNKEKQVTEEVRKTIEVRLKESSEYQSQLEKKMMESEKEKQELRDEKHKTVEQMEQQVTQLRQSLSSLQAEVQQALQRATTSASNEQKAKQDCQEQARIAAEAQNKYERELMLHAADVEALQAAKKQLTSASAIRHKCEETAQKA------GSQLLESRAS-WEERERMLKEEVSQIQSRCKDLEKQNGLLHEQIESLSKKM----VTSVQEGALNMSFGEEGKSQEQVMEILRFVRREKEIAEARFEVAQVECLRYRQRIEHMERELHELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVLIESNKILREENEKQEQELQQLQAKIRKLESNILPLQESNAELSEKSGMLQAEK---KLLEEDVRRWRARTQHLLSQQKDTDAEEYKKLLSEREVNTKRI----------QQLTEETGKLKTEVARTNASLNTCQSQLQSVKDDLTKIKAEKEKLQKELDAKILDIQEKIKTITQVKKIGRRYKTQYEELKVTHDKMVAEASSAKADQLQEQASQKEVQELKDSLQRS 1158          
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Match: sp|F1MA98|TPR_RAT (Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN=Tpr PE=1 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 2.198e-37
Identity = 338/1416 (23.87%), Postives = 661/1416 (46.68%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS--LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHL--LSPVQDGTGDNNNQTNLNTISTLNG-KVAESQEKID------KLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL---AKKSEENVSLASQ--------LGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSE-NRASSSANLTITESCTVGVI---------QTAPEKIEKTG-----------DLESQL----EDLSVLNYSLKKQ---IEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETS-------ELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVN-SIDFAILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMS----------------SLITQLRDIGRKYKTESESLSSE 4342
            R  +E+ Y   +++ L   L E  T + E +L +++L+       +R K  EQ +++   ++  L+TE+K   ++L    +   NE       + +    L+ K+ E+   ++ +  LK    HL++   +    L+ A E Q +++     ELN  + ++ L K   +++E K      A+ EL + LKE  E +  ++           Q   E+  +I + + EL  AN L    + K   LSE E+ +M+P  AA    +K G  +T++Y+ Y++  ++    +++  R+N+Y+  I++E+E KAP+LK+Q+EE+   + +V++L  K +  + ++   Q + +++++    L R  +R E    DLS+Q+  L+ E+E  RG  VIR +E+S                                          ++++VI+ HLV+++NI ELQQQN RL+   R+L + +E  E     + + ++  KLE +  E++ ++E             +++H +Q +  +  + D+  +L S   G+  P  ++ L  +S V      + +Q    T+ST     + ES E I+      +LQ   +  + EK    +  +  +++L + +++++  N  +  ++ F  ++   L+ N+   + E+  LQ    E NQKL    +K E+ ++  +Q        L   ++R    + E + ++ +   +    E L +E+  +  L+++       L +IQ  L + + E        L S+I++L  E+   K K ++ +E         +  +   K QL++E N   ++  L       +  +         Q A +  ++TG           DL+SQL    E ++ L   LK     +E Y  ++ + E  L    Q+ EE+    + R+ E  + + ++E+ L   +   ++L+ +     +S+E Q+ EL++ L    +         S   + E Q   D + Q ++   A   Y++EL+ HA + +AL    +Q+S++ +  ++L E  Q       + +S L    + W   +R L++E S       +L+ Q   L++++  L+D++V   K +  S +N S++     +E    E+++++R+EKE  E      +++  R R +    E  + +L  +L  ER    V A+T  QH E+M + E+  ++ME+N  LR +++R+++ L +   K+ KL   I PL+   AEL  K+  ++  K   + LE +   W+ R  +LI + K  + EE++++  EK+    +I  + EE  R        LK +I     SL + +N ++SLKE  D ++  T+K S                  ITQ++ IGR+YKT+ E L ++
Sbjct:  133 RLSQEVEYLTEDVKRLNEKLKESNTTKGELQLKLDELQASDVTVKYREKRLEQEKELLHNQNSWLNTELKTKTDELLALGREKGNE-------ILELKCTLENKKEEVLRLEEQMNGLKTSNEHLQKHVEDLLTKLKEAKEQQASMEEKFHNELNAHIKLSNLYKSAADDSEAKSNELTRAVDELHKLLKEAGEANKTIQDHLLQVEESKDQMEKEMLEKIGKLEKELENANDLLSATKRKGAILSEEELAAMSPTAAAVAKIVKPGMKLTELYNAYVETQDQLLLEKLENKRINKYLDEIVKEVEAKAPILKRQREEYERAQKAVASLSAKLEQAMKEIQRLQEDTDKANKHSSVLERDNQRMEIQIKDLSQQIRVLLMELEEARGNHVIRDEEVSSADIS-------------------------------------SSSEVISQHLVSYRNIEELQQQNQRLLFALRELGETREREEQETTSSKIAELQNKLENSLTELEQLRE-------------SRQHQMQLVDSIVRQRDMYRILLSQTTGMAIPLQASSLDDISLVSTPKRSSTSQ----TVSTPAPEPIIESTETIEAKAALKQLQEIFENYKKEKMDSEKLQNEQLEKLQEQVTDLRSQNTKISTQLDFASKRYEMLQDNVEGYRREITSLQ----ERNQKLTATTQKQEQIINTMTQDLRGANEKLAVAEVRAENLKKEKEMLKLSEVRLSQQRESLLAEQRGQNLLLTN-------LQTIQGILERSETETKQ----RLSSQIEKLEHEISHLKKKLENEVEQRHTLTRNLDVQLLDTKRQLDTEINLHLNTKELLKNAQKDIATLKQHLNNMEAQLASQSTQRTGKGQPGDRDDVDDLKSQLRQAEEQVNDLKERLKTSASNVEQYRAMVTSLEDSLNKEKQVTEEVHKNIEVRLKESAEFQTQLEKKLMEVEKEKQELQDDKRKAIESMEQQLTELKKTLSSVQSEVQEALQRASTALSNEQQARRDCQEQAKIAVEAQNKYERELMLHAADVEALQAAKEQVSKMASVRQHLEETTQ-------KAESQLLECKASWEERERVLKDEVSKSVSRCEDLEKQNRLLHDQIEKLSDKVVTSMKEVVQSPLNISLNEEGKSQEQIL-EILRFIRREKEIAETRFEVAQVESLRYRQRVELLERELQELQDSLNAEREKVQVTAKTMAQHEELMKKTETMNVVMETNKMLREEKERLEQNLQQMQAKVRKLELDILPLQEANAELSEKSGMLQAEK---KLLEEDVKRWKARNQHLINQQKDPDTEEYRKLLSEKEIHTKRIQQLNEEVGR--------LKAEIARSNASLTNNQNLIQSLKE--DLSKVRTEKESIQKDLDAKIIDIQEKVKTITQVKKIGRRYKTQFEELKAQ 1451          
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Match: sp|A1Z8P9|TPR_DROME (Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.871e-8
Identity = 88/332 (26.51%), Postives = 165/332 (49.70%), Query Frame = 2
Query: 3605 VIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEE------------KSRVNSE----------LLEELKTQIEEYE------------------RSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYK------------TESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKK 4444
            +I++LR+EK+      +  + +  RL +++  Q++ +D+LN  L +ER     +  +  +H E++ ++E+   + +SN  LR +R  +   +AE T+++  + + + PL+   K   ++IE + ++  SL  E   WR+R + L+EKS + NPEEFK++  E++ L   +  E+E            K R+N+E          L E  K Q++E+                   R L+ +E  L++ +E+  K++    K +  + QLR + ++YK            TES   ++E+ K+  E E    +L+ALK E  +I +  DE KK
Sbjct: 1207 IIKFLRKEKDLFAAKLDILKAENARLISEHAIQQKKVDELNGYLNQERAKSQTDVVSANKHEEVLRKIETLNAITDSNRILREERNALTLRVAELTDRISSVEKELFPLQCSNKELTSKIEEINVENTSLRTEAIKWRQRANALVEKSNR-NPEEFKRLQAEREHLAKLLTAEKELNKKQSDELTVLKQRMNTEIPMLNKQMQILDEARKKQVDEFTNLKQNNTRQTQDIMELKNRLLQKEEELLKANEELETKDKTIADKETKEL-QLRKLAKRYKDFYIGLQSQGGGTES---AAELEKVRSELEEVNNQLRALKDEHEKITKECDEVKK 1533          
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Match: A0A0V0J6Z3 (TPR_MLP1_2 domain-containing protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR150502 PE=4 SV=1)

HSP 1 Score: 287.73 bits (735), Expect = 2.832e-74
Identity = 375/1313 (28.56%), Postives = 631/1313 (48.06%), Query Frame = 2
Query:  629 ELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQE------------EHSFLEL--SVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQ---QEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQ-------NEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQL---NSENRASSSANLTITESCTVGVIQ------TAPEKIEKTGD---------LESQLEDLSVLNYSLKKQIEA-------YHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVN--------ELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQET-IILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSI---DFAI-LQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEELKTQ-IEEYERSLKDKENQLESLKEISD------KNQAETQ-----KMSSLITQLRDIGRKYKTESESLSSEI 4345
            EL  ++ E +N + T+ KL++ +  L   N +  E L+   +   N++ L   EL  Q  + +L KE+  E E K E    A+  +QE LK   E   +++ E E  L+ F ++   L  + N    EL  A  + EKFR++ LSE E++ +NPA A  I++LKRG S+TQIYS+Y+QVV E++ LR+D++RL E++  ++ +LE+K PLL+ QQE            EH+F  L      L + ++DN               R+     R+  R +Q+  D+S QV  L+RE+E  RGTVIRSDE    ++ P+           S ++    L+  +  S +     I AN VI  +LVTF ++ ELQ QN +L+   RDL+ Q   +E+T+  +  N + +++ K++    E++  +   K+ +        Q+   Q +   H  S   SL    +  ++   G    L+P  + +   N  +++NT  ++N     S   I+KL+       ++  + R+EK      ++ ++++L    SE ++ N  L +++ F  EK  +LE N+ N + E+A L+   +      A   +    L  +      RL   E +++Q+    +H  + E +L  E     +      ++ +QL  IQ  L+  Q E+  + Q E   ++  L +EL + + +    LE        +NA   TL+++L       +AS    L +  S      Q      TAP + E + D         L ++L DL     SL+  +EA       Y +L    E  +   S+  +E+E  F     E  Q + E  EL  N + + RQ   N N R   L +++N        EL     D T A +  +  +      E +  S++E   +  + A E Y+ EL  HA++   L E  K      ++   L   L+ +   LRD   S  E +  +W  E+  L  + SE  ++ + L  +++ L +QL  L+KLL+ ST ++I    F   +Q   D+ +++ YLR++K   E  +     ++ RL  + +  E  +  L   L EERR   V+AET +QHA +M ++E   +L ESN  LR +R+ V+E  A    +L  L    EP++ + KS  +  + +  + +SLE ERD W++RC  L+E +K+++PEE+KQ C E+D+LQ + L   E ++V SE   E K   +E +   L     QLE+ K +SD      ++Q +TQ     K  + I +LR+I RKY+ E++ L S I
Sbjct:  226 ELSTRKVEFENSQATLLKLEDLVKKLTESNEDHIEKLKQRTDELINLEQLHANELGAQKRLTDLYKEQATEAEKKVEQMQKAVASMQELLKAGHEHVLQLQSEKEALLNAFTEEKKNLLEKSNTLALELRSAKEIVEKFRIQGLSEDELRKLNPAVATTIASLKRGRSLTQIYSDYVQVVEERDLLRLDKERLTEHVREMVTQLEEKGPLLRSQQEAFIKSKSRVEELEHAFSALQNDFKELHENFEDNK--------------RRAGYFQRQNLRLKQSCRDMSAQVKTLLRELEIARGTVIRSDE----SDRPD-----------SSSSGGDRLADESLDSRKLLAACIAANSVIDDNLVTFASLSELQSQNQKLLLVARDLASQLEDRESTDEHLA-NRVAELSAKVDALSGEVNVARLAAKEARSEADLAVRQRDAYQRILERHSIST--SLADVSSSVLEESVGPGQSLTPYDNLSMLANRDSSINT--SMNVTTQPSSPAINKLEESLCSLHSDFQQYREEKAKTDAVYTETVEKLRLEASEARVLNQKLASQLDFTHEKFRTLEANVANYKQEIAILREMNARYTTSAAASDDALTHLREEAARTADRLTAAEADSRQLARQLEHSRANETRLTQELESLRKQAVMHEQLMHQLQLIQSNLD--QREEMEKRQAE--RRVTSLEMELAEVRRRSDERLEA-------ANAQSSTLQTELLLARQSLKASEDELLELRASLAEATKQRAPSPKTAPSQPEASADDLKTLEHNNLANRLRDLERECASLRVSLEAAREQSAEYQKLANEMEEHIARLSRERDELEKTFTTESEERNQ-RCEFLELQLNLERMERQDVVNENVR---LSEELNKLRTDLRAELAAARTDLTAAIERRDAALEF----ENKARSEIEAHEKTAREAREKYEMELKLHAEDVQLLTEARKVSCGASSEISALKVELEASRARLRD-ANSSAETQACLWDEERAKLSAKISESNAEVDRLQEQILKLTEQLNGLRKLLEQSTSDTIAAEQFTTQIQASEDFAQILDYLRRQKSIAEAAEEAANAEVARLTLRAKSLERQVADLQTKLAEERRNSEVKAETSRQHAHLMNQLEQLNLLSESNRLLRQERETVREAAARAEAQLAALRADTEPMRDQCKSLEDARDLLISEKKSLEEERDRWKERCTRLVETTKRMDPEEYKQACNERDELQRR-LRSLEDAKVASEREAEAKVNGLEAHIAELSTTVAQLEAQKRVSDVQISSIESQCKTQKEELEKRQTNIIKLREIARKYRHETDELRSRI 1483          
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Match: A0A087VYJ1 (Nucleoprotein TPR OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000102000 PE=4 SV=1)

HSP 1 Score: 281.567 bits (719), Expect = 3.893e-72
Identity = 414/1576 (26.27%), Postives = 703/1576 (44.61%), Query Frame = 2
Query:  629 ELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENM--INENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTI--------STLNGKVAESQ------------EKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNK--------------------PQIEQANED-QIELKSKIKQLTLELKQEKSKYQSS------LEMWQAKFSESNAVIDTLKSQLNSENRASSSAN--LTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQ-----------EKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDF----AILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKS----RVNSELLEELKTQIEEYERSLKDKENQLESL--KEISDKNQAETQ-----KMSSLITQLRDIGRKYKTESESLSSEI---------VKITDEK--------ENKCKELQ-------ALKKEIVEIKQLLD--ESKKDCXXXXXXXXXXXXXXXXXNDEFVKKLGSILQCQNSPIDIIETLEKIM-----KEYQNKIQLLEARESELKFRMQVIEGHLTNLRLENERMKKQLDSRL----------------NMMNSLDDENGTSE-ENSTEMLPTTSSSSGCHGVPAVARVAANVHPVVQKPQNIVPGXXXXXXXXXXXXXXXCTSTARQTAEIRPI 4981
            EL  +R E++N + TI KL++ +  L + N +  E L+   +   N + L   EL  Q  + +L +++  + E K E    A+ E+QE LK+  E   K++ E    ++  A +  +L  E      EL  A  + +KFR++ LSE E++ +NPA A  I++LKRG S+T+IYS+Y+QVV E++ L++D++RL E++  ++ +LE+KAPLL+ QQE        V+ L  +    L+     Q   E+  R+     R+ K  +Q+  DLS QV  L+ E+ET RGTVI S        E E I   + F   S N+  S   ++  ++  S     TA  VI  +LVTF+++ ELQ QN RL+   RDL+ Q E  E+   +  + + ++  K+E    E+D  +    + +        Q+    AL   H               +  PD S H     Q     N N  +   +        S L+     +Q            E +  L  E  + R++K    E ++ +I+ L +  +E ++ N  L  ++ F  EK  +LE N+ N + E++ L+   +      A   E  ++L  Q      RL   E E +Q+    +H  + E +L+ E     +       + +QL SIQI L                       ++++ +ED Q +L S    L  EL   +   +S+      L    A    S+ + +T  S L ++  +SSSAN  LT  +  +    Q  P ++    +LE +   L V   +++KQ   Y  L    E+ +   ++  E +E      I + +Q           EK E ++L+    L+  + +++     K L D +  ++  L D   A +     + L    E    S++   ++  + A E Y+ EL  HAQ+   L E  K   + + +   L   L+ T     Q +  L  + S+W   +  L     +  ++   L  +++ L +Q+VNL+KL+D S+  S         ++   D+  +++YLR++K   E  +     +++RL  + +  E  +  L   L EER+   V+ ET  QHA IM ++E   +L ESN  LR +RQ +++      E+L  L   I+PL+ + K   +  E + L+ RS+  ERD W++RC  L+E SK+++PEE+KQ C  +D+LQ  +   EE      R ++  +  L+ QI E   +L  +E++ +S   K  S + Q + Q     K    IT+LR+IGRKY+ E++ L  ++         +K T+E          N    LQ        L++E+  ++QL+D  ES  D          S              +GS L   +        L  I+     + Y+ + Q  E  +SE   RMQ+IE  L   + + + +K QL S +                 +  ++D    + E + +  +  + +S+    G     R AA V PV                 P++   S  +S ARQTAEIRP+
Sbjct:  226 ELASRRTELENAQVTIAKLEDLVKQLTKSNDDHIEKLKLRTDELVNTEQLHTNELEAQRRLTDLYRDQASDVEKKYEEMQKAVTEMQEMLKQGHEHVSKLQSEKTIVVNALAAEKDKLMSENVALARELAAAKEIVDKFRIQGLSEDELRRLNPAVATTIASLKRGRSLTEIYSDYVQVVEERDLLKLDKERLTEHIREMMAQLEEKAPLLRSQQEAFYKSRDRVAELETQLGAALTNAKEKQDVAEDQRRRSSYFQRQNKLLKQSCKDLSIQVKTLLHELETARGTVITS-------TEEENI---QVFPDSSTNDIDSRTLLNLCSADNS-----TAASVIDKNLVTFRSLSELQTQNARLLLVARDLASQLEDHESKKDLLASQVSEITAKVEVLSGEVDVARLAASEARSEANFAARQRDACMALLQRH--------------AIPLPDFSVHNEQTPQKCVDSNTNPHDSAIVLAHLDRSASALDWTGGSAQMLHQSQTIVKLEESLLSLHAEFKQYREDKARSDEVYTGTIETLRRESTEARILNQKLAGQLDFTHEKFRTLESNVANYKQEISILREMNARYTTSAAASDEALIALREQSARTGDRLAAAEVECRQLIRQLEHTRANEARLSHELEIAQKTTLMHEHLMHQLQSIQINLEHREEMEARKATRHIEALEAKLEELKKGSEDRQQQLLSLNATLQTELSHTRQALRSAEEEVSQLRAAIAANKPSSPISNTGSSDLQTQA-SSSSANEQLTSADVTSGDGAQLMPTQLR---NLEHECASLRVSLEAVRKQCAEYQHLGIEMETHIAKLTKEREHLEHTHATEIEDASQRCELLSLQLVLEKSERQDLIHEKTLLTEEYQASL----KKLRDDLASVQLALRD---AEERQEAALKL----ESSAHSEVAAHQKAAQEAREKYETELRLHAQDVQLLTEARKMADEARAEVEGLRVALETTKTSLGQSEEQLTAQTSLWEESRARLVKRVEDADAEINRLQEQILTLTEQIVNLRKLMDRSSDQSFSCEESGGQIKESEDFIHLLEYLRRQKSIAEAAEESANAEVSRLHLRTKTLEMQVADLEAKLAEERQRNEVQLETSSQHANIMQQIEQVNLLSESNRLLRQERQMIRDAAVRAEERLTALAREIDPLRTQCKELEDAREILALEKRSIAEERDRWKERCTRLVETSKRMDPEEYKQACNARDQLQATLKATEEVKAIVERESAARIAALEQQISELSSNLVQRESEGQSFTAKLASLEGQCKIQEDELAKRQVKITKLREIGRKYRQEADELKRQLSNTQEQEKSIKTTEEAIIAVRADLLNAQANLQIEQEQSSMLRQEMDHLQQLIDRVESLPDLDPIKHSPPESL-------------IGSSLPTSSRASVTYNRLNHILSIMIAEFYRMRGQAEE--QSERLLRMQLIESQLAKTKSQCDELKAQLASVMAAASTEAVSTVHSAATTLAEAVDQPISSPETKGNAAVTKSVTSTVATGGASWGLRAAATVQPV-------------QTSPPSTASPSPLSSAARQTAEIRPL 1729          
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Match: A0A068WV05 (Nucleoprotein TPR OS=Echinococcus granulosus OX=6210 GN=EgrG_000102000 PE=4 SV=1)

HSP 1 Score: 275.789 bits (704), Expect = 1.967e-70
Identity = 420/1568 (26.79%), Postives = 725/1568 (46.24%), Query Frame = 2
Query:  629 ELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRS-DEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENM--INENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKS----DLRSLLASGAIGVDS---PDGSAHLLSPVQDGTGDNNNQTNLNT-ISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYL-NKPQIE--QANEDQIELKSKIKQL----------------TL--ELKQEKSKYQSS------LEMWQAKFSESNAVIDTLKSQLNSENRASSSAN--LTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAF-----DMLNGEMSLLKAKECQ---------LISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDF----AILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEE----KSRVNSELLEELKTQIEEYERSLKDKENQLESL--KEISDKNQAETQ-----KMSSLITQLRDIGRKYKTESESLSSEI---------VKITDEK--------ENKCKELQ-------ALKKEIVEIKQLLD--ESKKDCXXXXXXXXXXXXXXXXXNDEFVKKLGSILQCQNSPIDIIETLEKIMKE-----YQNKIQLLEARESELKFRMQVIEGHLTNLRLENERMKKQLDSRLNMMNS---------------LDDENGTSEENSTEMLPTTSSSS--GCHGVPAVARVAANVHPVVQKPQNIVPGXXXXXXXXXXXXXXXCTSTARQTAEIRPI 4981
            EL  +R E++N + TI KL++ +  L + N +  E L+   +   N + L   EL  Q  + +L +++  + E K E    A+ E+QE LK+  E   K++ E  + ++  A +  +L  E      EL  A  + +KFR++ LSE E++ +NPA A  I++LKRG S+T+IYS+Y+QVV E++ L++D++RL E++  ++ +LE+KAPLL+ QQE        V+ L  +    L+     Q   E+  R+     R+ K  +Q+  DLS QV  L+ E+ET RGTVI S +E +I             F   S N+  S   ++  ++  S     TA  VI  +LVTF+++ ELQ QN RL+   RDL+ Q E  E+   +  N + ++  K+E    E+D  +    + +        Q+   +AL   H        +R+ L      VDS   P  SA +L+ + D +    ++T  +T +   +  + + +E +  L  E  + R++K    E ++ +I++L +  +E ++ N  L A++ F  EK  +LE N+ N + E++ L+   +      A   E  ++L  Q      RL   E E +Q+    +H  + E +L+ E     +       + +QL SIQI L ++ ++E  QA      L++K+++L                TL  EL   +   +S+      L    A    S+ + +T  S L ++  +SSSAN  LT  +  +    Q  P ++    +LE +   L V   +++KQ   Y  L    E+ +   ++  E +E               EIE+  +  +L++ QL    ++R    +D ++E  RL  +   +      D+ + +++L  A+E Q           S++   ++  + A E Y+ EL  HAQ+   L E  K   + + +   L   L+ T     Q +  L  + S+W   +  L     +  ++   L  +++ L +Q+V+L+KL+D S+  S         ++   D+  +++YLR++K   E  +     +++RL  + +  E  +  L   L EER+   V+ ET  QHA +M ++E   +L ESN  LR +RQ +++      E+L  L   +EPL+ + K   +  E + L+ RSL  ERD W++RC  L+E S +++PEE+KQ C  +D+LQ  +   EE      R ++  +  L+ QI E   +L  +E++ +S   K  S + Q + Q     K    IT+LR+IGRKY+ E++ L  ++         +K T+E          N    LQ        L++E+  ++QL+D  ES  D          S              +GS +   +        L  I+       Y+ + Q  E  +SE   RMQ+IE  L   + + + +K QL S +   ++                 D+  +S E +     T S++S     G     R AA V PV                 P++   S  +S ARQTAEIRP+
Sbjct:  226 ELVSRRTELENAQVTIAKLEDLVKQLTKSNDDHIEKLKLRTDELVNAEQLHTNELEAQRRLTDLYRDQASDVEKKYEEMQKAVTEMQEMLKQGHEHVSKLQSEKTSVVNALAAEKDKLMSENAALARELAAAKEIVDKFRIQGLSEDELRRLNPAVATTIASLKRGRSLTEIYSDYVQVVEERDLLKLDKERLTEHIREMMAQLEEKAPLLRSQQEAFYKSRDRVAELETQLGAALTNAKEKQDVAEDQRRRSSYFQRQNKLLKQSCKDLSIQVKTLLHELETARGTVITSIEEENIQV-----------FPDSSTNDIDSRTLLNLCSADNS-----TAASVIDKNLVTFRSLSELQTQNARLLLVARDLASQLEDHESKKDLLANQVSEITAKVEVLSGEVDVARLAASEARSEANFAARQRDACKALLQRHAIPLPDFSVRNELTPQKC-VDSNTNPHDSAIVLAHL-DRSASALDRTGGSTQMLHQSQTIVKLEETLLSLHAEFKQYREDKARSDEVYTGTIEKLRRESTEARILNQKLAAQLDFTHEKFRTLESNVANYKQEISILREMNARYTTSAAASDEALIALREQSARTGDRLAAAEVECRQLIRQLEHTRANEARLSHELEIAQKTTLMHEHLMHQLQSIQINLEHREEMEARQATRHIEALEAKLEELKKGSEDRQQQLLSLNATLQTELSHTRQALRSAEEEVSQLRAAIAANKPSSPISNTGSSDLQTQA-SSSSANEQLTSADVTSGDGAQLMPTQLR---NLEHECASLRVSLEAVRKQCAEYQHLGIEMETHIAKLTKEREHLEHTH----------ATEIEDASQRCELLSLQLVLEKSER----QDLIHEKTRLTEEYQTSLKKLRDDLASVQLALRDAEERQEAALKLESSAHSEVAAHQKAAQEAREKYETELRLHAQDVQLLTEARKLADEARAEVEGLRAALETTQASLGQSEEQLTAQTSLWEESRARLVKRVEDADAEINRLQEQILTLTEQIVSLRKLMDRSSDQSFSCEESGGQIKESEDFIHLLEYLRRQKSIAEAAEESANAEVSRLHLRTKTLEMQVADLEAKLAEERQRNEVQLETSSQHANLMQQIEQVNLLSESNRLLRQERQMIRDAAVRAEERLTALAREMEPLRTQCKELGDAQEILALEKRSLAEERDRWKERCTRLVETSMRMDPEEYKQACNARDQLQATLKATEEVKAIAERESAARIAALEQQISELSSNLVQRESEGQSFTAKLASLEGQCKIQEDELAKRQVKITKLREIGRKYRQEADELKRQLSNTQEQEKSIKTTEEAIIAVRADLLNAQANLQIEQEQSSMLRQEMDHLQQLIDRVESLPDLDPIKHSPPESL-------------IGSSIPTSSRASVTYNRLNHILSTMIAEFYRMRGQAEE--QSERLLRMQLIESQLAKTKSQCDELKAQLASVMAAASTEAVSTVHSAATTSAEAVDQPISSPETTGNAAVTKSATSTVATGGASWGLRAAATVQPV-------------QTSPPSTASPSPLSSAARQTAEIRPL 1729          
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Match: A0A5K3FBY2 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 275.018 bits (702), Expect = 3.822e-70
Identity = 351/1337 (26.25%), Postives = 624/1337 (46.67%), Query Frame = 2
Query:  617 DFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIR-SDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQ---QEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIG-------VDSPDGSAHLLSPVQDGTGDNNNQTNLN--TISTLNGKVAESQEKIDK----LQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNK--------------------PQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSEN----------RASSS---ANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSL---KKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKA--------KECQLI------SDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSID----FAILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKS----RVNSELLEELKTQIEEYERSLKDKE-------NQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCK 4381
            D   EL  ++ E++  + ++ KL++ +  L   N +  E L+   +   N++ L   EL+ Q  + +L K++  E E K E    A+ E+QE L +  E   K++ E    +     +  +L  +     NEL  AN + +KFR++ LSE E++ +NPA A  I++LKRG S+TQIYS+Y+QVV E++ L++D  RL E++  ++ +LE+K PLL+ QQE     +  ++ L  + +  L+          +  R+     R+  R +Q+  DLS QV  L+ E+ET RGTVI+ +D+ +++A           F   S +++ S   +   +S  S+     A  VI  +LVT++++ ELQ QN RL+   RDL+ Q    E+ E+++  + + ++  K+E    E+   +    + +   +    Q+   +AL   H      S +A G+           S D ++ L+ P   G  D ++ + L+    +T  G  ++S  K+++    L +E+ + R++K    E ++ +I++L +  SE ++ N  L A++ F  EK  +LE N+ N + E++ L+   +      A   E   +L  Q      RL   E E +Q+    +H  + E +L  E     +L  +  ++  QL SIQ  L                        + +++E+++E   K+  L + L+ E S  + +L   + +  +    I T K+   +            RA  S   A+    ++       T PE             + S L  SL   +KQ   Y +L +  E+ + + ++  EE+E               E+E+  +  +L+N QL    ++R    +D V    RL  +   A   L  ++   +A        +E  L       S++   ++  + A E Y+ EL  H+Q+   L E  K+  + +++   L   L+      +Q +   + +  +W  E+       ++   +   L  +++ L +Q VNL+KL++ S+  S       A ++   D+  V++YLR++K   E  +     +++RL  +    E  I  L   L EERR   + AET  QHA +M ++E   +L ESN  LR +R+ ++   A+  E+L  L   +EPL+ + K   +  E +  + RSL  ERD W++RC  L+E SK+++PEE+KQ C  +D+LQ ++L  EE      R +   +  L+ Q+ E   SL   E        +  SL E     Q E  +    I +LR+IGRKY+ ES+ L  ++   T EKE   K
Sbjct:  222 DLESELASRKVELEKSQSSVAKLEDLVKRLTESNEDHIEKLKIRTDELVNMEQLHGNELDAQRRLTDLYKDQATEAEKKCEEMQKAVAEMQEMLNQGHEHVIKLQNEKAAFVETLVAEKEKLASQNAMLTNELKVANEIVDKFRIQGLSEEELRQLNPAVATTIASLKRGRSLTQIYSDYVQVVEERDLLKLDNGRLTEHIREMISQLEEKGPLLRSQQEAFYKSKERIAELESQLETALANAKEQHEMANDHSRRSGYYQRQNLRLKQSCKDLSTQVKTLLYELETARGTVIKLTDQGALDA-----------FPDSSTDDTDSRKLLELCSSNNSA-----AASVIDCNLVTYRSLAELQTQNARLLLVARDLATQLEDHESKEDVLA-SRVSEITAKVEVLSGEVQVARLAASEARSEAQFAARQRDAFKALLQKHAIPLPDSAIAEGSTPCKRGPSDATSIDNASLLVHPDTSGVIDVSSVSTLDRTNATTSGGNDSQSAVKLEESLCSLHSELKQYREDKAKSDEVYTETIEKLRKEGSEARILNQKLAAQLDFTHEKFRTLEANVANYKEEISILREMNARYTTSAAASDEALTALREQSACTSDRLAAAEVECRQLTRQLEHARANETRLTQELESAQKLAVTHEQLMRQLQSIQNNLEHREEMERMQASRRIAALETELADLRKSSEEKLE---KMDALNMTLQSELSHARQALRSAEEEACQLRTAIATSKTGPGTPTSSTDGSSPNARAKPSDQLAHAVGDQTSASAETSTCPENQPSLAQFREVERECSFLRVSLEAVRKQFAEYQQLGSEMEAHIASLTREREELEHAH----------AAEVEDKNQQCELLNMQLMLEKSER----QDLVQANARLTDESQAALTKLRADLVAAQAALKDAEARRETALKVEESSRSEVASHQRTAQEAREKYEVELRLHSQDVQLLMEARKRAEEARSEVEGLRTALETAKACAEQSEERSKEQLKLWEEERARFTKRIADADEEVNRLQEQILKLTEQTVNLRKLMERSSDESFPSEELGAQIKASEDFTHVLEYLRRQKSIAEAAEEAANAEVSRLHLRVHSLESRIADLQAQLSEERRESEIRAETSSQHASLMSQIEQVSVLSESNRLLRQERESIRNAAAQAEEQLVALRAEMEPLRIQCKELEDMREILAAEKRSLAEERDRWKERCTRLVETSKRMDPEEYKQACNARDQLQARLLATEEAKASLERESESRIAALEHQMGELSSSLSKLEAERLALATKTASLDEQCRNQQEELSRKQVNIVKLREIGRKYRQESDELRRQL-STTQEKEKSMK 1523          
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Match: A0A5K3FEG1 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 2.049e-69
Identity = 351/1337 (26.25%), Postives = 624/1337 (46.67%), Query Frame = 2
Query:  617 DFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIR-SDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQ---QEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIG-------VDSPDGSAHLLSPVQDGTGDNNNQTNLN--TISTLNGKVAESQEKIDK----LQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNK--------------------PQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSEN----------RASSS---ANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSL---KKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKA--------KECQLI------SDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSID----FAILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKS----RVNSELLEELKTQIEEYERSLKDKE-------NQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCK 4381
            D   EL  ++ E++  + ++ KL++ +  L   N +  E L+   +   N++ L   EL+ Q  + +L K++  E E K E    A+ E+QE L +  E   K++ E    +     +  +L  +     NEL  AN + +KFR++ LSE E++ +NPA A  I++LKRG S+TQIYS+Y+QVV E++ L++D  RL E++  ++ +LE+K PLL+ QQE     +  ++ L  + +  L+          +  R+     R+  R +Q+  DLS QV  L+ E+ET RGTVI+ +D+ +++A           F   S +++ S   +   +S  S+     A  VI  +LVT++++ ELQ QN RL+   RDL+ Q    E+ E+++  + + ++  K+E    E+   +    + +   +    Q+   +AL   H      S +A G+           S D ++ L+ P   G  D ++ + L+    +T  G  ++S  K+++    L +E+ + R++K    E ++ +I++L +  SE ++ N  L A++ F  EK  +LE N+ N + E++ L+   +      A   E   +L  Q      RL   E E +Q+    +H  + E +L  E     +L  +  ++  QL SIQ  L                        + +++E+++E   K+  L + L+ E S  + +L   + +  +    I T K+   +            RA  S   A+    ++       T PE             + S L  SL   +KQ   Y +L +  E+ + + ++  EE+E               E+E+  +  +L+N QL    ++R    +D V    RL  +   A   L  ++   +A        +E  L       S++   ++  + A E Y+ EL  H+Q+   L E  K+  + +++   L   L+      +Q +   + +  +W  E+       ++   +   L  +++ L +Q VNL+KL++ S+  S       A ++   D+  V++YLR++K   E  +     +++RL  +    E  I  L   L EERR   + AET  QHA +M ++E   +L ESN  LR +R+ ++   A+  E+L  L   +EPL+ + K   +  E +  + RSL  ERD W++RC  L+E SK+++PEE+KQ C  +D+LQ ++L  EE      R +   +  L+ Q+ E   SL   E        +  SL E     Q E  +    I +LR+IGRKY+ ES+ L  ++   T EKE   K
Sbjct:  222 DLESELASRKVELEKSQSSVAKLEDLVKRLTESNEDHIEKLKIRTDELVNMEQLHGNELDAQRRLTDLYKDQATEAEKKCEEMQKAVAEMQEMLNQGHEHVIKLQNEKAAFVETLVAEKEKLASQNAMLTNELKVANEIVDKFRIQGLSEEELRQLNPAVATTIASLKRGRSLTQIYSDYVQVVEERDLLKLDNGRLTEHIREMISQLEEKGPLLRSQQEAFYKSKERIAELESQLETALANAKEQHEMANDHSRRSGYYQRQNLRLKQSCKDLSTQVKTLLYELETARGTVIKLTDQGALDA-----------FPDSSTDDTDSRKLLELCSSNNSA-----AASVIDCNLVTYRSLAELQTQNARLLLVARDLATQLEDHESKEDVLA-SRVSEITAKVEVLSGEVQVARLAASEARSEAQFAARQRDAFKALLQKHAIPLPDSAIAEGSTPCKRGPSDATSIDNASLLVHPDTSGVIDVSSVSTLDRTNATTSGGNDSQSAVKLEESLCSLHSELKQYREDKAKSDEVYTETIEKLRKEGSEARILNQKLAAQLDFTHEKFRTLEANVANYKEEISILREMNARYTTSAAASDEALTALREQSACTSDRLAAAEVECRQLTRQLEHARANETRLTQELESAQKLAVTHEQLMRQLQSIQNNLEHREEMERMQASRRIAALETELADLRKSSEEKLE---KMDALNMTLQSELSHARQALRSAEEEACQLRTAIATSKTGPGTPTSSTDGSSPNARAKPSDQLAHAVGDQTSASAETSTCPENQPSLAQFREVERECSFLRVSLEAVRKQFAEYQQLGSEMEAHIASLTREREELEHAH----------AAEVEDKNQQCELLNMQLMLEKSER----QDLVQANARLTDESQAALTKLRADLVAAQAALKDAEARRETALKVEESSRSEVASHQRTAQEAREKYEVELRLHSQDVQLLMEARKRAEEARSEVEGLRTALETAKACAEQSEERSKEQLKLWEEERARFTKRIADADEEVNRLQEQILKLTEQTVNLRKLMERSSDESFPSEELGAQIKASEDFTHVLEYLRRQKSIAEAAEEAANAEVSRLHLRVHSLESRIADLQAQLSEERRESEIRAETSSQHASLMSQIEQVSVLSESNRLLRQERESIRNAAAQAEEQLVALRAEMEPLRIQCKELEDMREILAAEKRSLAEERDRWKERCTRLVETSKRMDPEEYKQACNARDQLQARLLATEEAKASLERESESRIAALEHQMGELSSSLSKLEAERLALATKTASLDEQCRNQQEELSRKQVNIVKLREIGRKYRQESDELRRQL-STTQEKEKSMK 1523          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Match: tprb (translocated promoter region b, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-030131-6410])

HSP 1 Score: 190.66 bits (483), Expect = 6.566e-48
Identity = 364/1516 (24.01%), Postives = 729/1516 (48.09%), Query Frame = 2
Query:   50 FKSELEAFKVENDNLKRDYDKVTIDYELKIENLKKEMNLKTVNYENLMINFQELDGKYKNSCQEKITVNQNYFD-LSQEKFNIVKKYDXXXXXXXXXXXXXXRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIK-KLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFE--KFRVKS-----LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGT---------GDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIM----REKHSSS------IKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLA---KKSEENV-SLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIE-------QANEDQIELKSKIKQLTLELKQE--------------KSKYQSSLEMWQAKFSESNAV---IDTLKSQLNSEN--RASSSANLTITESCT-VGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGD-KTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESD---ALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAILQRENDWN---EVIQYLRQEKENVERVKNQFELD-----LNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSEL------LEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESL 4333
             ++  E F+V+++    D +K   + + K  +L K       ++  L  +F +L  + K + QEK   +++    L  EK  + K  D LE+E   L+  + RR +E+     ++  L   L E    +++ +L ++DLE       ++ K  EQ +++   +   L+ E+K K +E LA S Q            + +    L+ K +E+   +  +  LK    +L++   +    L+ A E Q + +   R ELN  + ++ L K    + E K E    A+ EL + LKE  E    ++++     SG  ++++E + +I+  + EL  AN L    K R  S     L+E ++ +M+P TAAA+S ++    +T+IY+ Y++     +  R++  R+N+Y+  I++E+E KAP+LK+Q+EE    + SV+ L  K +  + ++   Q E +E++++   L R  +R E   +D+++QV  L+ E+E  RG  +  DE        +++                           SS    + ++VI+ HLVTF+++ ELQ QN RL+   R+LS+ QE  E   + +   ++ K LE+A  E++ ++E+     QL +++  Q+             D+  +L + A GV  P          Q GT             +     T +T  G VA S E  + ++ +   L+  +E+     REK  S        ++L   +SE++  N+ +  ++ F  ++   L+ N+   + E+A L+    E  QK A   +KSE+ + +L   L +   +L   E+  + ++  +  ++ +E +L+ EK        S + +   L SIQ  L + + E       Q ++ + E+    K+L  E++Q               K + +S   ++Q    + NA    ++TL+ QL+S +  RAS +A+  +  S + V  ++    ++++T   ES+ EDL+    S    +E Y  +  + E  L    Q+ E++ S  + ++ E  ++  ++E+ L   +   ++++        ++E QV+EL + L   +    D L  +++L  ++E Q + D + Q ++   A + Y++E+I HA + +   A      + SQ++ Q    ++R    ++   + +   E ++ I   E+  +E    +L+ Q E L+ ++  ++ ++    +L   ++ +S++ ++ + +       E+++++R+EKE  E   ++FE+       ++LR ++ ++E  + ++ ++L  ER    V + T  QH E+M + E+  +L+E+N  LR +++++++ L +   K+ KL   I P++   +EL  K+  ++  K   + LE +   W+ R  +L+ + K  +PEE+K++  EK+    +I  + E+ SR+ +E       +  L++Q++    SL     + +SLK+  D    + Q+    ITQ++ IGR+YKT+ E L
Sbjct:   39 LRAHHEQFRVDSEQQYFDLEKRCTESQDKFLSLTK-------DHHALKEDFSKLQEELK-ALQEKTKEHESLISKLESEKNQLSKVKDELEAEKRELVRTLERRSQEVESQSEDLNRLNDRLVETNAAKMQLQLKLDDLESSEVSIKYKEKRMEQEKELLQSQLTWLNDELKSKSDELLALSRQKGSE--------ILELKCSLNDKEDEVTRLQDQVASLKASHENLQKQAEDMICKLKEAKEQQASSEEKFRNELNANIKLSNLYKGAAADAEAKSEELNQAVEELHKLLKEAGEAHKALEVKMAEMESGKQKEMTEFKEQISSLEKELENANELLTHTKHRGGSTSAPILTEEQLTTMSP-TAAAVSKIRPDMKLTEIYTAYIESQEHLQLERLENKRVNKYLDDIVQEVEAKAPILKRQREEFERTQKSVANLSAKLEQAVQEVQRLQRETDEANKRASVLERDNRRFETQLADMAQQVRVLLLELEEARGNHVLRDE--------DYL---------------------------SSADVSSTSEVISQHLVTFRSVEELQSQNQRLLVALRELSEAQEKEEMESDSSKRSELQKSLEKAQAELEQLREQRAHQMQLAESIVRQR-------------DMYRVLLAQATGVSFP----------QQGTTPEEFSLTSTPRRSPAVTPTAATPTGLVATSMESTETVEAKAA-LKQLQEVFGAYKREKAESGKVLGEQCEKLQDQVSELRSQNSKISTQLEFASKRYEMLQDNVEGYRKEIASLR----EKTQKQATDVQKSEQTIHTLTQDLRAANEKLTMAESRVESLRKEKDMLKMVESRLSQEKESILSQQRSQNLLLTNLKSIQATLERSETETRQRLTAQVDKQEREISQLQKRLEHEVEQRHLLGRNQDMQLLDAKKQLESQTALYQRTKEQLNAAQQELNTLQQQLSSGDYHRASPTAHTRLQGSNSDVDELRG---RLKQT---ESKAEDLAERVKSTTASVEQYRAMCLSLEEALEKEKQVTEQVRSSVESQVMEAQEQHRQLEKKLLEVEKEKQEIQEEKQKAVTAIEQQVSELRKSLNSLQAEHQDTLQ-KVALAASQEQQALLDSQEQARLAAEAQDKYEREMILHAADVEALQAAKAQALKASQLRQQLEESAQRASAQLL---EARVSWEEQEKILKEEQGKVEARCVDLQKQNELLHEQIQSMSSKMAT--QLQQAASESSLNISLTEEDKSQEQLLEILRFVRREKEIAE---SRFEVAQGETLRHKLRVEHLERE--LKEVQQSLCAERERMQVTSRTLAQHDELMKKTETMNVLVETNKMLREEKEKMEQELQQAQAKITKLESDILPMQESNSELSEKSGMLQAEK---KLLEEDIKRWKARTQHLVSQQKDTDPEEYKRLHSEKEAHLKRIQQLTEDTSRLKAEAARSSGSVTTLQSQVQTLRESLGKVTVERDSLKKDIDAKALDLQEKVKTITQVKKIGRRYKTQYEEL 1454          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Match: tprb (translocated promoter region b, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-030131-6410])

HSP 1 Score: 188.734 bits (478), Expect = 2.647e-47
Identity = 364/1519 (23.96%), Postives = 734/1519 (48.32%), Query Frame = 2
Query:   47 DFKSELEAFKVENDNLKRDYDKVTIDYELK-IENLKKEMNLKTVNYENLMINFQELDGKYKNSCQEKITVNQNYFD-LSQEKFNIVKKYDXXXXXXXXXXXXXXRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSK--KLSTEIK-KLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS------LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGT---------GDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIM----REKHSSS------IKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLA---KKSEENV-SLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIE-------QANEDQIELKSKIKQLTLELKQE--------------KSKYQSSLEMWQAKFSESNAV---IDTLKSQLNSEN--RASSSANLTITESCT-VGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGD-KTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESD---ALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAILQRENDWN---EVIQYLRQEKENVERVKNQFELD-----LNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSEL------LEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESL 4333
            D +++ +  +  ++  + D ++   D E +  E+  K ++L T ++  L  +F +L  + K + QEK   +++    L  EK  + K  D LE+E   L+  + RR +E+     ++  L   L E    +++ +L ++DLE       ++ K  EQ  +  LL+S+   L+ E+K K +E LA S Q            + +    L+ K +E+   +  +  LK    +L++   +    L+ A E Q + +   R ELN  + ++ L K    + E K E    A+ EL + LKE  E    ++++     SG  ++++E + +I+  + EL  AN L    + +       L+E ++ +M+P TAAA+S ++    +T+IY+ Y++     +  R++  R+N+Y+  I++E+E KAP+LK+Q+EE    + SV+ L  K +  + ++   Q E +E++++   L R  +R E   +D+++QV  L+ E+E  RG  +  DE        +++                           SS    + ++VI+ HLVTF+++ ELQ QN RL+   R+LS+ QE  E   + +   ++ K LE+A  E++ ++E+     QL +++  Q+             D+  +L + A GV  P          Q GT             +     T +T  G VA S E  + ++ +   L+  +E+     REK  S        ++L   +SE++  N+ +  ++ F  ++   L+ N+   + E+A L+    E  QK A   +KSE+ + +L   L +   +L   E+  + ++  +  ++ +E +L+ EK        S + +   L SIQ  L + + E       Q ++ + E+    K+L  E++Q               K + +S   ++Q    + NA    ++TL+ QL+S +  RAS +A+  +  S + V  ++    ++++T   ES+ EDL+    S    +E Y  +  + E  L    Q+ E++ S  + ++ E  ++  ++E+ L   +   ++++        ++E QV+EL + L   +    D L  +++L  ++E Q + D + Q ++   A + Y++E+I HA + +   A      + SQ++ Q    ++R    ++   + +   E ++ I   E+  +E    +L+ Q E L+ ++  ++ ++    +L   ++ +S++ ++ + +       E+++++R+EKE  E   ++FE+       ++LR ++ ++E  + ++ ++L  ER    V + T  QH E+M + E+  +L+E+N  LR +++++++ L +   K+ KL   I P++   +EL  K+  ++  K   + LE +   W+ R  +L+ + K  +PEE+K++  EK+    +I  + E+ SR+ +E       +  L++Q++    SL     + +SLK+  D    + Q+    ITQ++ IGR+YKT+ E L
Sbjct:   31 DQQTDTDVLRAHHEQFRVDSEQQYFDLEKRCTESQDKFLSL-TKDHHALKEDFSKLQEELK-ALQEKTKEHESLISKLESEKNQLSKVKDELEAEKRELVRTLERRSQEVESQSEDLNRLNDRLVETNAAKMQLQLKLDDLESSEVSIKYKEKRMEQ--EKELLQSQLTWLNDELKSKSDELLALSRQKGSE--------ILELKCSLNDKEDEVTRLQDQVASLKASHENLQKQAEDMICKLKEAKEQQASSEEKFRNELNANIKLSNLYKGAAADAEAKSEELNQAVEELHKLLKEAGEAHKALEVKMAEMESGKQKEMTEFKEQISSLEKELENANELLTHTKHRGGTSAPILTEEQLTTMSP-TAAAVSKIRPDMKLTEIYTAYIESQEHLQLERLENKRVNKYLDDIVQEVEAKAPILKRQREEFERTQKSVANLSAKLEQAVQEVQRLQRETDEANKRASVLERDNRRFETQLADMAQQVRVLLLELEEARGNHVLRDE--------DYL---------------------------SSADVSSTSEVISQHLVTFRSVEELQSQNQRLLVALRELSEAQEKEEMESDSSKRSELQKSLEKAQAELEQLREQRAHQMQLAESIVRQR-------------DMYRVLLAQATGVSFP----------QQGTTPEEFSLTSTPRRSPAVTPTAATPTGLVATSMESTETVEAKAA-LKQLQEVFGAYKREKAESGKVLGEQCEKLQDQVSELRSQNSKISTQLEFASKRYEMLQDNVEGYRKEIASLR----EKTQKQATDVQKSEQTIHTLTQDLRAANEKLTMAESRVESLRKEKDMLKMVESRLSQEKESILSQQRSQNLLLTNLKSIQATLERSETETRQRLTAQVDKQEREISQLQKRLEHEVEQRHLLGRNQDMQLLDAKKQLESQTALYQRTKEQLNAAQQELNTLQQQLSSGDYHRASPTAHTRLQGSNSDVDELRG---RLKQT---ESKAEDLAERVKSTTASVEQYRAMCLSLEEALEKEKQVTEQVRSSVESQVMEAQEQHRQLEKKLLEVEKEKQEIQEEKQKAVTAIEQQVSELRKSLNSLQAEHQDTLQ-KVALAASQEQQALLDSQEQARLAAEAQDKYEREMILHAADVEALQAAKAQALKASQLRQQLEESAQRASAQLL---EARVSWEEQEKILKEEQGKVEARCVDLQKQNELLHEQIQSMSSKMAT--QLQQAASESSLNISLTEEDKSQEQLLEILRFVRREKEIAE---SRFEVAQGETLRHKLRVEHLERE--LKEVQQSLCAERERMQVTSRTLAQHDELMKKTETMNVLVETNKMLREEKEKMEQELQQAQAKITKLESDILPMQESNSELSEKSGMLQAEK---KLLEEDIKRWKARTQHLVSQQKDTDPEEYKRLHSEKEAHLKRIQQLTEDTSRLKAEAARSSGSVTTLQSQVQTLRESLGKVTVERDSLKKDIDAKALDLQEKVKTITQVKKIGRRYKTQYEEL 1453          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Match: tprb (translocated promoter region b, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-030131-6410])

HSP 1 Score: 186.037 bits (471), Expect = 1.852e-46
Identity = 338/1415 (23.89%), Postives = 675/1415 (47.70%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSK--KLSTEIK-KLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS------LSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGT---------GDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIM-----REKHSSS------IKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLA---KKSEENV-SLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIE-------QANEDQIELKSKIKQLTLELKQE--------------KSKYQSSLEMWQAKFSESNAV---IDTLKSQLNSEN--RASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGD-KTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESD---ALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAILQRENDWN---EVIQYLRQEKENVERVKNQFELD-----LNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSEL------LEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESL 4333
            RR +E+     ++  L   L E    +++ +L ++DLE       ++ K  EQ  +  LL+S+   L+ E+K K +E LA S Q            + +    L+ K +E+   +  +  LK    +L++   +    L+ A E Q + +   R ELN  + ++ L K    + E K E    A+ EL + LKE  E    ++++     SG  ++++E + +I+  + EL  AN L    + +       L+E ++ +M+P TAAA+S ++    +T+IY+ Y++     +  R++  R+N+Y+  I++E+E KAP+LK+Q+EE    + SV+ L  K +  + ++   Q E +E++++   L R  +R E   +D+++QV  L+ E+E  RG  +  DE        +++                           SS    + ++VI+ HLVTF+++ ELQ QN RL+   R+LS+ QE  E   + +   ++ K LE+A  E++ ++E+     QL +++  Q+             D+  +L + A GV  P          Q GT             +     T +T  G VA S E  + ++ +       K+++     REK  S        ++L   +SE++  N+ +  ++ F  ++   L+ N+   + E+A L+    E  QK A   +KSE+ + +L   L +   +L   E+  + ++  +  ++ +E +L+ EK        S + +   L SIQ  L + + E       Q ++ + E+    K+L  E++Q               K + +S   ++Q    + NA    ++TL+ QL+S +  RAS +A+  +      G      E   +    ES+ EDL+    S    +E Y  +  + E  L    Q+ E++ S  + ++ E  ++  ++E+ L   +   ++++        ++E QV+EL + L   +    D L  +++L  ++E Q + D + Q ++   A + Y++E+I HA + +   A      + SQ++ Q    ++R    ++   + +   E ++ I   E+  +E    +L+ Q E L+ ++  ++ ++    +L   ++ +S++ ++ + +       E+++++R+EKE  E   ++FE+       ++LR ++ ++E  + ++ ++L  ER    V + T  QH E+M + E+  +L+E+N  LR +++++++ L +   K+ KL   I P++   +EL  K+  ++  K   + LE +   W+ R  +L+ + K  +PEE+K++  EK+    +I  + E+ SR+ +E       +  L++Q++    SL     + +SLK+  D    + Q+    ITQ++ IGR+YKT+ E L
Sbjct:  120 RRSQEVESQSEDLNRLNDRLVETNAAKMQLQLKLDDLESSEVSIKYKEKRMEQ--EKELLQSQLTWLNDELKSKSDELLALSRQKGSE--------ILELKCSLNDKEDEVTRLQDQVASLKASHENLQKQAEDMICKLKEAKEQQASSEEKFRNELNANIKLSNLYKGAAADAEAKSEELNQAVEELHKLLKEAGEAHKALEVKMAEMESGKQKEMTEFKEQISSLEKELENANELLTHTKHRGGTSAPILTEEQLTTMSP-TAAAVSKIRPDMKLTEIYTAYIESQEHLQLERLENKRVNKYLDDIVQEVEAKAPILKRQREEFERTQKSVANLSAKLEQAVQEVQRLQRETDEANKRASVLERDNRRFETQLADMAQQVRVLLLELEEARGNHVLRDE--------DYL---------------------------SSADVSSTSEVISQHLVTFRSVEELQSQNQRLLVALRELSEAQEKEEMESDSSKRSELQKSLEKAQAELEQLREQRAHQMQLAESIVRQR-------------DMYRVLLAQATGVSFP----------QQGTTPEEFSLTSTPRRSPAVTPTAATPTGLVATSMESTETVEAKAAL----KQVIFGAYKREKAESGKVLGEQCEKLQDQVSELRSQNSKISTQLEFASKRYEMLQDNVEGYRKEIASLR----EKTQKQATDVQKSEQTIHTLTQDLRAANEKLTMAESRVESLRKEKDMLKMVESRLSQEKESILSQQRSQNLLLTNLKSIQATLERSETETRQRLTAQVDKQEREISQLQKRLEHEVEQRHLLGRNQDMQLLDAKKQLESQTALYQRTKEQLNAAQQELNTLQQQLSSGDYHRASPTAHTRLQ-----GSNSDVDELRGRLKQTESKAEDLAERVKSTTASVEQYRAMCLSLEEALEKEKQVTEQVRSSVESQVMEAQEQHRQLEKKLLEVEKEKQEIQEEKQKAVTAIEQQVSELRKSLNSLQAEHQDTLQ-KVALAASQEQQALLDSQEQARLAAEAQDKYEREMILHAADVEALQAAKAQALKASQLRQQLEESAQRASAQLL---EARVSWEEQEKILKEEQGKVEARCVDLQKQNELLHEQIQSMSSKMAT--QLQQAASESSLNISLTEEDKSQEQLLEILRFVRREKEIAE---SRFEVAQGETLRHKLRVEHLERE--LKEVQQSLCAERERMQVTSRTLAQHDELMKKTETMNVLVETNKMLREEKEKMEQELQQAQAKITKLESDILPMQESNSELSEKSGMLQAEK---KLLEEDIKRWKARTQHLVSQQKDTDPEEYKRLHSEKEAHLKRIQQLTEDTSRLKAEAARSSGSVTTLQSQVQTLRESLGKVTVERDSLKKDIDAKALDLQEKVKTITQVKKIGRRYKTQYEEL 1438          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Match: tpra (translocated promoter region a, nuclear basket protein [Source:ZFIN;Acc:ZDB-GENE-081104-2])

HSP 1 Score: 76.2554 bits (186), Expect = 4.033e-13
Identity = 118/482 (24.48%), Postives = 229/482 (47.51%), Query Frame = 2
Query:  602 NKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEAN---ALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGT-VIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGA-IGVDSPDGSAHLLS-PVQDGTGDN 2029
             K +      L+ K  E    +K +  LK+    L++   +    L+   + +T ++   R ELN  + +  L K    + E K      A+ EL + LK++ E +   + +     S   +  +EL+ +I     EL E+N   A F++  V +L+E E+ +++P  AA    +K G  + ++Y+ +++  ++ +  +++  R+N+ +  I+ E+E KAP LK+Q+EE+  ++ S+ +L  K +  + +++  Q E +E++++     R  +R E+  +D+S+QV  L+ E+E  RG  V+R D                               +++  S        ++++V+    V F+++ ELQQQN  L+ Q R++ +Q+E +E   NE    ++ + LE+  KE + +KE+  Q KQL  +   Q+ + + L    G S       SG      +  GS    S PV+    D+
Sbjct:  210 GKEILQIKCTLESKNEEASRLQKEVTALKKTSETLQKKTEDLLNKLKEEKDQRTAMEEKYRNELNANLRLCTLYKSSAADAEAKNTELSRAVEELNKLLKDSTEANKTTEKKLSDVESSRGKVETELQEKIKNLQKELEESNKRLAEFKRRGVPALTEEELTNLSPTAAAVAKIVKPGMKLMELYNAFVESQDQLQLSKLENKRINKVLDEIVREVETKAPGLKRQKEEYENMQKSMGSLCAKLELAMKEIHKLQKETDEANKRAAVSDRANQRAEKQIADMSQQVRVLLVELEEARGNQVVRED-------------------------------VNSAVS--------SSSEVLGPRQVAFRSVEELQQQNQNLLAQLREMEEQRERSE---NEAKSKELEQSLEKVQKEHELLKEQRNQQKQLADSAMRQRDMYRILLETAGVSLPPQGTDSGTQPATPTRPGSMPTRSTPVRAAAADS 649          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Match: lama5 (laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-9823])

HSP 1 Score: 56.6102 bits (135), Expect = 4.333e-7
Identity = 102/496 (20.56%), Postives = 189/496 (38.10%), Query Frame = 2
Query: 2180 LNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLN-SEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERL----------LGDKTNAFDMLNGEMSLLKAKE-------------CQLISDLER----QRQMTKSATENYQQELIYHAQESDAL-DELNKQMSQ------------IKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLD 3544
            LN+S+    + N N  + +  +++K  +LE+       E+  + +D+ EL +K +  S +  +L +        +  +E     +   + +M+ +E   N S+  ++ +L   ++E+A  L  ++     PQ +QA+ +                                 S++N ++D +KS++         A+ T     TV  I+    K           ++L+ L  +L    EA +     SE    N  QL E      Q ++N+L +++ E+ + ++ A+    Q+    ND    L+D   E ERL          L +K   F     +  L++  E               +ISD  +    QR +  S   N    +I    E+D L  E NK  ++            +K Q +++  RLQ     +     DL+   +     +     E    KS  E  N+   D+ D L  +KK LD
Sbjct: 2195 LNKSIENKSINNYN--SSLDGSRDKANTLEK-------ELQTIDSDLFELQEKASLSSRKGATLENN------TIATKERAQNLLDTVKNYMKDIEAAQNGSQTMDEEELKRKLAEVAAMLRDMRFRSTTPQGKQADYE--------------------------------LSQANQLLDRVKSEM---------ADRTAANEATVEEIKNKLNKFH---------QELTSLRDALN---EAANNTALASEKNNANQKQLDEN-----QQKVNDLKKKQKEVTDTMQMAEDDVAQV----NDMLAMLQDSKEEYERLAAQLDGARQPLAEKVQNFSTSGAKSPLVEEAEKHAELLDQLAKNLSSVISDTNQDGFIQRALNASRAYN---NIINSVNEADNLAKEANKSATEALEPKCVLNWTELKPQLQDIKNRLQNATTKKSDLMMDLQKVQNYLNTSQGNTSGEIQAAKSAAEKANSTAADVLDTLDPIKKKLD 2610          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Medaka
Match: tprb (translocated promoter region, nuclear basket protein [Source:NCBI gene;Acc:101172151])

HSP 1 Score: 169.088 bits (427), Expect = 2.507e-41
Identity = 349/1423 (24.53%), Postives = 677/1423 (47.58%), Query Frame = 2
Query:  353 RREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLE-------FRRKDFEQMEQMSLLRSKKLSTEIK-KLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKS------LSETEIKSMNPATAAAISALKRGYSMTQIYSE---------YLQVVNEKEELRVDR---DRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEI-----DRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLA---KKSEENV-SLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQ--IEQANEDQIELKSK-IKQLTLELKQEKSKYQSSLEMWQAKFSESN---AVIDTLKSQLNSE----NRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSV-----------LNYSLKK---QIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAIL--------QRENDWNEVIQYLRQEKENVERVKNQFELDLN-----RLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLK---AELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQI-LIEEEKSRVNSELLEE------LKTQIEEYERSLK---DKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEK 4366
            RR  E+ +  +++++L   L E  T ++  ++ M++LE       ++ K  EQ +++   ++  L  E+K K EE L+ S Q  +         + +    L+ K++E+   +  +  LK    +L++ N +    L+   E Q +++   R ELN  + ++ L K    ++E K      A+ EL + LK+  E +  ++ + +       + V+EL+ +I   + EL  AN L    +++       L+E ++ +M+P TAAA+S ++    +T+++ +         Y   V   E+L+++R    R+N+Y+ +I++E+E KAP+LK+Q+EEH  ++ SV++L  K +    +++  Q+E +ES+++   L R  +R E   +D+++QV  L+ E+E  RG  +  +E  ++ +                                      + ++VI+ HLVTF+++ ELQ+QN RL+   R+LSD QE  E     +   ++ ++ ++A  E++ +KE+  Q  ++ +++  Q+ + + L            + +    + S    +H  +P   GT        L +++  + +  E++  + +LQ        +RL  +K +  +      ++L + LSE++  NA    ++ F  ++   L+ N+   + E+A L+    E  QK+A   +K E+ V +L   L + + +L   +   + ++  +  ++ LE +L  EK        S + +   L SIQ  L + +  + Q    QIE + + I QL   L+Q         E+ Q      N    V+D LK QL ++     R     N+   E  T  + Q   E +     L+   EDL             L  SL+     +E Y  +  + E  L    Q+ E+  S  + R+ E  ++   +EE L+  +   + LE         LE+++N L++ L         +   + L +A++ Q + D + Q ++   A + Y++E++ HA + +AL     Q SQ       L E+LQ            LE R S W  +++ L+   S+++S+ E L ++   L++QL  +   L  S   + + + L        + ++   EV++++R+EKE  E   ++FE+        RLR ++ ++E  + ++  +L   R    V A+T  QH E+M + E+  +LME+N  LR ++ ++++ L +T  K+EKL ++I PL+   +EL  K+  ++  K+    LE E   W+ R  +L+ + K ++PEE+K++  E++    +I  + EE +R+  EL         L+ QI+    +L    ++ N L+  KE+  KNQ   +K  + ITQ++ IGR+YKT+ + L     K+T +K
Sbjct:  102 RRSLEVEHLNDDLKQLNEKLVEANTSKLALQMKMDELETAEVNIKYKEKRMEQEKELLHDQTSWLKEELKAKTEEVLSLSRQKGNE--------ILELKCSLENKQDELNKLQDQVMTLKCSNENLQKQNDDTINKLKETKEQQASMEEKFRNELNANIKLSNLYKGAAADSEAKSVELSRAVEELHKLLKDAGEANKALEEKVQEINIATDKTVNELKEKIQSLEKELDNANELLSNSKLRGAGNRSVLTEEQLITMSP-TAAAVSKIRPNMKLTEVFDKLTSSLFIPLYTAYVETNEQLQLERLENKRINKYLDNIVQEVEAKAPILKRQREEHERMQKSVASLSTKLEQAYKEVHRLQNEADESNKRSSILERDNQRFELQVADMAQQVRVLLVELEEARGNHVVHEEEVMSGD------------------------------------ISSTSEVISQHLVTFRSVEELQKQNQRLLVALRELSDSQEREEFEATSDKRGELEQRFDKAQSELESLKEQRNQQIKMTESIVRQRDMYRMLLAQSTGVSFTQGVPAEEFSLTSTPRRSHAATPT-SGTS-----AALVSMAAESAEALEAKAALRQLQEVFTTYKKERLESDKALTEQN-----EKLQEQLSELRSQNAKTSTQLEFASKRYEMLQDNVEGYRKEIAALR----EKGQKMAADTQKLEQTVNTLQEDLKTAKEKLAMAQAHAENLRKEKDMLKLLESRLTQEKETILNQQQSQNLLLTNLQSIQASLERSETDVRQRLNSQIEKQEREITQLQKRLEQ---------EVEQRHLLSRNQEIQVVD-LKRQLETQVALHQRTKEQINVLEMELSTFRMQQGNIEGLASLQGLDQDREDLQARLKLAETRAEELAESLRAATSSMEQYRAMAQSLEESLNKEKQVTEQARSSIEARMKEAEEQHRALEERLQGMEKEKQDLEDQKRRVVAGLEEEINSLKKSLSSVQEDQQTVLQRLVLSEAQQQQALIDGQEQVKLAAEAQDKYEREMMLHAADVEALQAAKAQASQAVELRHQLEEKLQRV------SAELLEARVS-WEEQEKILKEAVSKVESRNEELQSQNTLLHEQLQTMSTKLADSVQRTANESALNISLTEEGKSQDQLLEVLRFVRREKELAE---SRFEVAQGESLRYRLRMEHLERE--LKEVQDSLSAARERMQVTAKTLAQHDELMKKTETMSILMETNKMLREEKDKMEQELQQTQAKVEKLEKAIMPLQQSNSELSEKSGMLQAEKM---ILEEEIKRWKARTQHLVSQQKDLDPEEYKRLHSEREAHVKRIQQLSEESARLKMELTRTNNLTTGLQGQIQNLRENLSKITEERNMLK--KEVETKNQELLEKART-ITQVKKIGRRYKTQYDEL-----KVTHDK 1431          
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Medaka
Match: tpra (nucleoprotein TPR [Source:NCBI gene;Acc:101165590])

HSP 1 Score: 83.9593 bits (206), Expect = 1.911e-15
Identity = 101/423 (23.88%), Postives = 199/423 (47.04%), Query Frame = 2
Query: 1049 VKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSR-KLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEI-DRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQ 2311
            V SL+E ++ SM P+ AA  + +K       +Y+ Y +   + +  + +  R++  +  I+ E+E KAP+LK+Q+EE+  ++ S+++L  K +         + + E   R C+EL R KLK E Q   D S Q+C L+ E+E  RG                                 + +S S G+S + S+   T+ D  ++ L T++++ ELQ+QN  L+ + RDL ++++  +++   + + ++   +++  KE++ +KE+  Q KQL  +   Q+ + +  T++   +         +   D P   A   +P Q        QT  +  +    + AE+    D++ NE  DRL+ +                  L+E++ ++A L +++ F+  +   L++ L   + E+A LQ
Sbjct:  335 VPSLTEDQLNSMCPSAAAIAAIVKPDMKFFDLYNAYAECQTQLQLEKQETKRVSRVLDEIVHEVESKAPVLKRQREEYESMQRSMASLCSKLEQAREIYSLQKEKEEAKQR-CDELERDKLKTERQL-EDASSQLCALLVELEEARG---------------------------------NQVSKSDGSSADISS---TSEDAGSSPL-TYRSVVELQRQNQSLLGRLRDLEEEKDKQQHL--SSRIAELESGVDKLQKEVELLKEQRNQQKQLADSSARQRDMFK--TLLTQSTGFSLPTQDPSPQPDRPSAPATRSTP-QRAAAAEAAQTLSDAFTLYKKEKAEN----DRMLNETNDRLQKQ------------------LTELRSSHAKLTSQLEFSNRRYEMLQETLAAYRREIAALQ 691          

HSP 2 Score: 62.003 bits (149), Expect = 9.209e-9
Identity = 108/431 (25.06%), Postives = 206/431 (47.80%), Query Frame = 2
Query: 3203 ISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYL--NNRLVDLNDQLVNLKKLLDPSTVNS----IDFAILQRENDWN---EVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQIL-IEEEKSRVNSELLE------ELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKELQALKKE--IVEIKQLLDESK 4441
            I D   Q ++   A   Y++EL+ HA + +AL +L K   Q   + R L E L++T  L  +  + L         EK+  EN  ++++   E    NN L    D++    +L            +D +  + E       E+++++R+EKE        +E +  R + +   Q+  + +L + L  ER    +  +T  Q  E +  MES   L E+N  L++DR ++++ L +   K+ KL   I PL+  L   + +  +++ D R LE +    R R   LI + K  + EE +++  E++  Q +I  + EE +++ +EL           +QI+  + S+    ++ ++LK+  +    + Q+ +  ITQ++ IGR+YKT+ E L ++         +K  + QAL ++  I +I++ L ++K
Sbjct: 1003 IQDSLLQTKLAAEAQGKYERELMLHAADVEALQQLKKTSQQHAARIRQLEEELKKTDALLQEKSAALNT------VEKQLKENLANQIRRCDELGKQNNLLHQQMDEMAAKSRLQQQQQQQQQQQQLDLSFSEEEKTTEQILEILRFVRREKEIALAQCEAYEGEALRHKQRVEHQDRELKELQEALNSEREKMQLTTKTLAQQQEQLKRMESINALQETNKMLKMDRNKLEQELQQAQAKVTKLQSDISPLQNSLSLLSEKNSSLQADKRLLEEDLKRCRNRIQQLISQQKTGDSEERQKLTSEREAQQKRISQLVEESAKLKTELARSNAGSNSAHSQIQALKDSMVHLMSERDTLKKDLEAKNNDIQEKNKTITQVKKIGRRYKTQFEELKAQ--------HDKSAQAQALTRQTMIQQIQRELQQAK 1419          
BLAST of Translocated promoter region b, nuclear basket protein vs. Planmine SMEST
Match: SMESG000025908.1 (SMESG000025908.1)

HSP 1 Score: 3382.42 bits (8769), Expect = 0.000e+0
Identity = 2055/2071 (99.23%), Postives = 2061/2071 (99.52%), Query Frame = 2
Query:   20 MDEPFDINRDFKSELEAFKVENDNLKRDYDKVTIDYELKIENLKKEMNLKTVNYENLMINFQELDGKYKNSCQEKITVNQNYFDLSQEKFNIVKKYDXXXXXXXXXXXXXXRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLEFRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSXXXXXXXXXXXXXXXXXXFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNXXXXXXXXXXXXXXHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQETETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAILQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLXXXXXXXXXXXXTQKQHAEIMLEMESKQMLMESNSKLRLDRQRVXXXXXXXXXXXXXXNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKKDCXXXXXXXXXXXXXXXXXNDEFVKKLGSILQCQNSPIDIIETLEKIMKEYQNKIQLLEARESELKFRMQVIEGHLTNLRLENERMKKQLDSRLNMMNSLDDENGTSEENSTEMLPTTSSSSGCHGVPAVARVAANVHPVVQKPQNIVPGXXXXXXXXXXXXXXXCTSTARQTAEIRPIPAVALHXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXGPTVIFPXXXXXXXXXXXXXXXXXXXXXXVGNXXXXXXXXXXXNRLKRCFDKSIEPDSRTSLIEESANSTFDNSNAIKKCRIRVSXXXXXXXXXXIGGQEALXXXXXXXXXXXXXXXXXGGFIDFDHLXXXXXXXXXXXAGXXXXXXXXXXXXXXXXXXXXNRSKNELEFMFTDMLDGRIHNFSDQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVIDLLXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXYKDDKNESVVEDLKSSENELELAKKKIEPIVWNDHNQRRNNRKDNFTISPSKSTRYSGNAGFRRKMVTSRRNFPFTTTXXXXXXXXXXXXXPFKGSFTPR 6232
            MDEPFDINRDFKSELEAFKVENDNLKRDYDKVTIDYELKIENLKKEMNLKTVNYENLMINFQELDGKYKNSCQEKITVNQNYFDLSQEKFNIVKKYDSLESEHTSLLELISRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLEFRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSINELLKEKIEENELKEENFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKK+DDNLSQLYS QSELEESHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKL KKSEENVSLASQLGSCQMRLREQETE KQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNA D LNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFA+LQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLEEERRFRVVEAETQKQHAEIMLEMESKQMLMESNSKLRLDRQRVKELLAETTEKLEKLNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEE KTQIEEYERSLKDKENQ ESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKKDCQQQLSQASTSSNSASQANDEFVKKLGSILQCQNSPIDIIETLEKIMKEYQNKIQLLEARESELKFRMQVIEGHLTNLRLENERMKKQLDSR NMMNSLDDENGTSEENSTEMLPTTSSSSGCHGVPAVARVAANVHPVVQKPQNIVPGSSSNQISPNSQPISSCTSTARQTAEIRPIPAVALHVAPSSSTVDSTTDSVSTASVTTSLPASVVQALAASSSSGPTVIFPAVSSFTPSSSSSSITLAATTGTVGNPISSSSAPPIINRLKRCFDKSIEPDSRTSLIEESANSTFDNSNAIKKCRIRVSD+P+D PVAAIGGQEALV+SQAQQISQQQQQSV+GGFIDFDHLEEDVHEEVVCEAGEVEIESEEVEEVEITEDEDENRSKNELEFMFTDMLDGRIHNFSDQENSVEEEDYDEEEEENEESDENEPEDDEDNLDEDNNDEDDDDDEDDENPDVIDLLSSDDVSEDNDDNNDNKYDDNENNEGDNQESSNYKDDKNESVVED KSSENELELAKKKIEPIVWNDHNQRRNNRKDNFTISPSKSTRYSGNAGFRRKMVTSRRNFPFTTTSGRVLSVGRRSGGPFKGSFTPR
Sbjct:    1 MDEPFDINRDFKSELEAFKVENDNLKRDYDKVTIDYELKIENLKKEMNLKTVNYENLMINFQELDGKYKNSCQEKITVNQNYFDLSQEKFNIVKKYDSLESEHTSLLELISRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLEFRRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYDFNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNIDNLLRTELNVQVSINELLKEKIEENELKEENFIGAIRELQESLKETVEESDKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSETEIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYMLSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKFDDNLSQLYSCQSELEESHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSINANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHLVTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAYKEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGVDSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEIDRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLEQNLINRQMEMADLQNDISELNQKLTKKSEENVSLASQLGSCQMRLREQETEIKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKPQIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDTLKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSVLNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGEIEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAVDRLNGEMSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQMSQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELKSQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAVLQRENDWNEVIQYLRQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLEEERRFRVVEAETQKQHAEIMLEMESKQMLMESNSKLRLDRQRVKELLAETTEKLEKLNESIEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQHQILIEEEKSRVNSELLEERKTQIEEYERSLKDKENQFESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKENKCKELQALKKEIVEIKQLLDESKKDCQQQLSQASTSSNSASQANDEFVKKLGSILQCQNSPIDIIETLEKIMKEYQNKIQLLEARESELKFRMQVIEGHLTNLRLENERMKKQLDSRPNMMNSLDDENGTSEENSTEMLPTTSSSSGCHGVPAVARVAANVHPVVQKPQNIVPGSSSNQISPNSQPISSCTSTARQTAEIRPIPAVALHVAPSSSTVDSTTDSVSTASVTTSLPASVVQALAASSSSGPTVIFPAVSSFTPSSSSSSITLAATTGTVGNPISSSSAPPIINRLKRCFDKSIEPDSRTSLIEESANSTFDNSNAIKKCRIRVSDLPEDAPVAAIGGQEALVVSQAQQISQQQQQSVSGGFIDFDHLEEDVHEEVVCEAGEVEIESEEVEEVEITEDEDENRSKNELEFMFTDMLDGRIHNFSDQENSVEEEDYDEEEEENEESDENEPEDDEDNLDEDNNDEDDDDDEDDENPDVIDLLSSDDVSEDNDDNNDNKYDDNENNEGDNQESSNYKDDKNESVVEDQKSSENELELAKKKIEPIVWNDHNQRRNNRKDNFTISPSKSTRYSGNAGFRRKMVTSRRNFPFTTTSGRVLSVGRRSGGPFKGSFTPR 2071          
BLAST of Translocated promoter region b, nuclear basket protein vs. Planmine SMEST
Match: SMESG000065719.1 (SMESG000065719.1)

HSP 1 Score: 58.151 bits (139), Expect = 8.966e-8
Identity = 38/117 (32.48%), Postives = 75/117 (64.10%), Query Frame = 2
Query: 3992 LENERDLWRKRCDNLIEKSKQVNPEEFKQICIEKDKLQH-----QILIEEEKSRVNSELLEELKTQIEEYERSLKDKENQLESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESE 4327
            LE+E++ W++RC  L+E+++Q++PE+++  C ++DK +      +I ++E K+    ++ E+L+ +I+  E+ L+  E     L+E+S+K     +    ++ QL+DIGRK+K ESE
Sbjct: 1095 LEDEKNRWKERCTKLVERAEQMDPEQYRLACNDRDKYRKLSQELEINLKETKNSDRVKMEEDLQ-KIKNLEKDLEKAELDRRKLEELSNKLTVGER----IVAQLKDIGRKHKGESE 1206          
The following BLAST results are available for this feature:
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
TPR2.144e-4124.26translocated promoter region, nuclear basket prote... [more]
TPR1.326e-2525.85translocated promoter region, nuclear basket prote... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Mtor4.859e-926.51gene:FBgn0013756 transcript:FBtr0088033[more]
Mtor4.859e-926.51gene:FBgn0013756 transcript:FBtr0332464[more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tprb8.206e-3025.62translocated promoter region b, nuclear basket pro... [more]
tpra1.002e-2523.64translocated promoter region a, nuclear basket pro... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
sos26.177e-4424.31SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos28.902e-4424.31SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos21.099e-4324.31SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos29.111e-4324.45SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
sos21.724e-4224.16SOS Ras/Rho guanine nucleotide exchange factor 2 [... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Tpr4.665e-3924.42translocated promoter region, nuclear basket prote... [more]
Tpr1.286e-3824.37translocated promoter region, nuclear basket prote... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12270|TPR_HUMAN1.030e-4024.26Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR P... [more]
sp|F6ZDS4|TPR_MOUSE3.263e-3824.42Nucleoprotein TPR OS=Mus musculus OX=10090 GN=Tpr ... [more]
sp|Q5EE04|TPR_XENLA1.021e-3724.41Nucleoprotein TPR (Fragment) OS=Xenopus laevis OX=... [more]
sp|F1MA98|TPR_RAT2.198e-3723.87Nucleoprotein TPR OS=Rattus norvegicus OX=10116 GN... [more]
sp|A1Z8P9|TPR_DROME4.871e-826.51Nucleoprotein TPR OS=Drosophila melanogaster OX=72... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0V0J6Z32.832e-7428.56TPR_MLP1_2 domain-containing protein (Fragment) OS... [more]
A0A087VYJ13.893e-7226.27Nucleoprotein TPR OS=Echinococcus multilocularis O... [more]
A0A068WV051.967e-7026.79Nucleoprotein TPR OS=Echinococcus granulosus OX=62... [more]
A0A5K3FBY23.822e-7026.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A5K3FEG12.049e-6926.25Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tprb6.566e-4824.01translocated promoter region b, nuclear basket pro... [more]
tprb2.647e-4723.96translocated promoter region b, nuclear basket pro... [more]
tprb1.852e-4623.89translocated promoter region b, nuclear basket pro... [more]
tpra4.033e-1324.48translocated promoter region a, nuclear basket pro... [more]
lama54.333e-720.56laminin, alpha 5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
tprb2.507e-4124.53translocated promoter region, nuclear basket prote... [more]
tpra1.911e-1523.88nucleoprotein TPR [Source:NCBI gene;Acc:101165590][more]
back to top
BLAST of Translocated promoter region b, nuclear basket protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000025908.10.000e+099.23SMESG000025908.1[more]
SMESG000065719.18.966e-832.48SMESG000065719.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016090 ID=SMED30016090|Name=Translocated promoter region b, nuclear basket protein|organism=Schmidtea mediterranea sexual|type=transcript|length=6255bp
AAAATTTTGAATATTATAAATGGATGAACCTTTTGATATTAACAGGGATT
TTAAATCCGAGCTTGAAGCATTTAAAGTAGAAAATGATAACTTAAAACGA
GATTATGATAAAGTCACAATAGATTATGAATTAAAAATTGAAAACCTTAA
AAAAGAAATGAATTTAAAAACTGTAAATTATGAAAATCTTATGATCAATT
TTCAAGAGCTTGATGGGAAATATAAAAATAGCTGTCAAGAAAAAATAACC
GTTAACCAAAACTATTTTGACTTATCCCAGGAAAAATTTAATATTGTCAA
AAAATATGACAGCTTGGAATCTGAACACACTTCTCTTCTCGAATTAATTT
CTCGCCGAGAGAAAGAACTTCTTTATTCGAAAAATGAGATTCAAGAACTT
AGAACTCTTTTAACTGAATACAAAACTAAAGAAATTGAATCTAAGTTAAA
TATGAATGATTTAGAATTTCGAAGAAAAGATTTTGAACAGATGGAACAAA
TGTCATTATTAAGAAGTAAAAAACTTAGTACAGAAATTAAAAAGTTAGAA
GAGAAATTGGCAGAAAGTGCACAAGCAAACCACAACGAAAAGACCTTACA
TAATAAATTGGTTTATGATTTTAATCTTGAATTGGACGGAAAACGAAATG
AGATAAAAAATTTCAAAAAAACAATTGAAAAGCTGAAAGAGCAAATTTCT
CACTTAGAGCGTGGCAATGTAGAAAAAAATGAAAGTTTGCGATCCGCTGT
TGAGAGTCAGACGAATATTGATAATTTGCTGCGAACCGAATTAAATGTAC
AAGTGTCAATCAATGAATTATTAAAAGAAAAAATCGAAGAGAACGAATTG
AAGGAGGAAAATTTCATCGGTGCAATCAGAGAACTCCAGGAATCATTGAA
GGAAACCGTTGAAGAGAGTGATAAGATGAAATTGGAATTCGAAACAAAAC
TATCTGGATTTGCCCAGCAAGTTTCTGAATTGCGAATGGAAATCAATCGC
AAAGACAACGAATTGACTGAGGCTAACGCCTTATTCGAGAAATTCCGCGT
TAAAAGCCTATCGGAAACGGAGATAAAATCAATGAATCCCGCAACTGCGG
CTGCCATCAGTGCTTTAAAGCGCGGATATAGTATGACACAGATCTACAGC
GAATATCTGCAAGTCGTCAACGAGAAGGAGGAATTGCGAGTTGATCGGGA
TCGATTGAATGAGTACATGCTGTCGATCCTCGAGGAACTGGAACAGAAAG
CCCCGCTGTTGAAAAAGCAACAAGAAGAGCATTCATTCCTGGAGCTGTCG
GTTTCGACATTAGGCAAGAAATACGATGATAATCTCTCACAGTTGTACAG
CAGTCAATCGGAACTGGAGGAGTCACATAGGAAATGTGAGGAATTGTCGA
GGAAACTCAAGCGAGAAGAGCAAACAAGCTCTGATCTCAGCCGACAAGTC
TGCTGCCTGATTAGAGAAGTCGAAACCTACCGGGGCACAGTTATCAGATC
CGATGAGATGTCGATCAATGCAAATGAGCCGGAATTTATCACTCGACGCC
GCAGTTTCCATCAACGCAGCCTCAACAACTCGCAATCACATCTCAGTATC
AGCACCGGTACCTCAATGGAATCCAGTAATCGATTTATCACAGCCAATGA
TGTCATCACAACACATTTGGTGACGTTCAAGAACATTTGTGAGTTGCAGC
AGCAGAATATCCGATTAATTGAGCAATTCCGTGATCTCAGTGATCAACAA
GAAGCCACAGAAAATATGATCAATGAAAATAGCATGCTCGACATGGCAAA
GAAATTGGAGCAAGCCTATAAAGAAATGGATGATATCAAAGAAAAGCACA
AACAGAATAAACAATTACAGAAAACCGTTAATGCTCAAAAGCATATTATT
CAAGCGCTAACTATGGTTCATGGTAAATCCGATTTGCGCTCTCTACTCGC
TAGTGGAGCGATTGGTGTTGATTCACCGGATGGCAGTGCTCATTTATTGT
CACCAGTGCAAGACGGAACGGGGGATAATAATAACCAGACCAATTTGAAT
ACCATTTCTACATTGAATGGAAAAGTTGCCGAAAGTCAAGAGAAAATCGA
TAAATTGCAAAACGAGATCGATAGATTACGAGATGAAAAAGAAATTATGC
GAGAGAAACATTCAAGCTCCATTAAAGAACTCAATCAATCGCTGTCTGAA
ATAAAACTCGCAAATGCTAACCTCATGGCTAAAATAAGCTTCAATCAAGA
GAAAACAACGAGTCTGGAACAGAATCTAATCAACCGGCAAATGGAAATGG
CTGATTTACAAAACGATATTTCGGAATTGAATCAAAAACTCGCCAAAAAA
TCCGAGGAAAATGTATCGCTGGCCAGTCAGTTGGGCAGCTGTCAAATGCG
GCTGAGAGAGCAGGAAACCGAAACCAAGCAAATGCAGTTCAATAGGCAAC
ACATGGAGAGTTTAGAAGAGCAATTGAACTCGGAGAAAAATGAAAAATAT
CAACTGGTGTCAAGCATCAGTGAAATGGCAAATCAACTGAGCAGCATTCA
AATCTATCTCAATAAACCGCAAATAGAACAAGCGAATGAAGATCAGATTG
AATTGAAATCGAAAATCAAACAGTTGACATTAGAGCTGAAACAGGAAAAA
TCCAAATATCAAAGCTCATTGGAAATGTGGCAAGCTAAATTCAGCGAATC
AAACGCGGTTATTGACACTCTCAAATCGCAACTCAACAGTGAAAATCGAG
CAAGCTCATCGGCAAATTTGACAATTACCGAGTCTTGTACTGTTGGAGTT
ATCCAAACTGCTCCGGAAAAAATTGAAAAAACTGGCGATTTGGAAAGTCA
ATTGGAAGATTTGTCTGTATTGAATTACAGTTTAAAAAAACAAATTGAGG
CTTATCACGAACTAATGGCTAATTCCGAATCAAAGCTCATTAATAATTCT
CAATTAATTGAAGAAATGGAATCAAAATTCCAAGATAGAATAAATGAATT
AACCCAAGAAAAGGGTGAAATCGAGGAATTACTCGAAAATGCTCAGTTAG
TCAATAGGCAATTGGAATCGAACTTCAATGACCGAGAAAAATCATTAGAA
GATCAAGTTAATGAATTGGAGAGATTATTGGGAGATAAGACAAATGCCTT
TGATATGTTGAATGGAGAAATGTCGCTTTTGAAAGCCAAAGAGTGCCAAT
TGATATCTGACCTTGAACGACAGAGACAAATGACCAAATCCGCAACGGAA
AATTATCAGCAAGAATTAATCTATCACGCTCAAGAATCGGACGCGTTAGA
CGAGTTGAATAAACAGATGAGTCAGATAAAAAACCAAGAAAGAAACCTAT
CGGAAAGATTGCAAGAAACCATTATCCTTCGCGATCAATACAAATCGGAC
CTTGAAAATCGAGATAGCATTTGGTTGGCGGAGAAAAGAGCTTTGGAAAA
TGAAACATCTGAGTTGAAATCGCAAAAGGAGTATTTGAATAACCGCCTGG
TGGATTTGAACGACCAATTAGTTAATCTGAAGAAGCTGCTGGATCCTTCC
ACTGTAAACAGTATCGATTTTGCTATTCTCCAACGGGAGAACGATTGGAA
TGAAGTTATTCAATATTTACGACAGGAGAAAGAAAATGTCGAAAGAGTTA
AAAACCAATTCGAACTCGATTTGAATCGATTAAGAGCTCAATATCGACAA
CAAGAAGAAACAATTGATCAGTTGAATAAAACACTGGAAGAAGAACGAAG
ATTCCGAGTGGTTGAAGCTGAAACTCAGAAACAACACGCAGAAATTATGT
TGGAAATGGAATCCAAACAAATGCTCATGGAAAGCAATTCTAAACTCAGA
CTCGATCGTCAGAGAGTAAAGGAACTGCTGGCTGAGACTACTGAGAAGTT
GGAAAAACTCAACGAATCTATTGAGCCTTTAAAAGCCGAATTGAAATCGA
AAAATAATGAAATCGAAAATGTTAAACTCGATGCAAGATCACTAGAGAAT
GAACGGGACTTATGGCGCAAAAGGTGCGACAATCTCATCGAGAAATCCAA
ACAAGTCAATCCCGAAGAATTCAAACAAATCTGCATAGAAAAAGATAAGT
TACAGCACCAAATTCTAATTGAAGAAGAGAAAAGTCGTGTCAATTCAGAA
CTACTAGAGGAGCTAAAAACCCAAATTGAAGAATACGAAAGATCTTTAAA
AGATAAAGAAAATCAATTAGAATCGCTGAAGGAAATTAGTGATAAAAATC
AAGCCGAAACCCAAAAAATGAGTAGCCTTATAACACAACTAAGAGATATC
GGCAGGAAATATAAAACCGAAAGTGAATCGTTGAGTAGCGAAATAGTGAA
AATAACCGACGAGAAAGAGAATAAATGCAAAGAACTGCAAGCATTGAAGA
AAGAAATAGTGGAAATCAAGCAATTATTGGACGAATCAAAGAAAGACTGT
CAGCAGCAATTGAGCCAAGCAAGCACGAGCTCCAACTCCGCGTCACAGGC
CAATGATGAGTTTGTGAAGAAACTGGGCTCGATCTTGCAATGCCAGAATA
GTCCAATCGATATAATCGAAACGCTGGAGAAAATAATGAAAGAATATCAA
AACAAAATCCAATTATTGGAAGCGAGAGAAAGCGAGCTGAAATTCCGAAT
GCAAGTGATTGAAGGCCACCTGACTAATTTGCGGCTGGAGAACGAGAGGA
TGAAGAAGCAGCTGGACAGCCGACTGAACATGATGAACAGCTTGGACGAT
GAAAATGGAACCAGCGAGGAAAACAGCACTGAAATGCTCCCGACAACCTC
CTCATCATCCGGCTGTCACGGTGTGCCGGCAGTTGCTCGAGTAGCAGCCA
ATGTCCACCCAGTTGTCCAGAAACCGCAAAATATCGTTCCGGGATCATCA
TCCAATCAAATCTCACCGAATTCTCAGCCGATTTCCAGCTGCACCTCAAC
AGCTCGGCAAACCGCAGAAATCCGCCCGATACCCGCCGTTGCTCTCCATG
TCGCTCCCTCGAGCTCCACAGTCGATAGCACTACCGACTCCGTGTCCACG
GCATCGGTAACCACATCGTTACCAGCCAGCGTTGTCCAGGCGCTGGCTGC
CTCCTCCTCCTCCGGTCCGACTGTTATATTCCCGGCGGTTTCCAGCTTTA
CCCCATCCAGCAGCAGCAGTAGCATCACATTGGCCGCCACCACTGGCACC
GTTGGCAACCCCATCAGCAGCAGCAGCGCTCCTCCTATTATCAATCGGTT
GAAACGGTGCTTCGATAAATCGATCGAACCCGACTCGAGAACTAGTCTGA
TCGAGGAGTCGGCAAATTCCACCTTTGACAACAGCAACGCAATCAAGAAA
TGCCGAATCCGGGTTTCCGATGTTCCCGATGATGTTCCAGTTGCTGCTAT
CGGGGGGCAGGAGGCGTTGGTTATCAGCCAGGCCCAGCAAATCTCGCAGC
AACAACAGCAGTCGGTTGCCGGGGGATTTATCGATTTTGACCATCTGGAG
GAGGATGTTCACGAGGAGGTGGTGTGTGAGGCGGGAGAAGTAGAGATCGA
GTCCGAGGAGGTCGAGGAGGTCGAGATAACCGAAGATGAAGATGAAAATC
GATCGAAAAATGAATTGGAATTTATGTTCACGGATATGCTCGATGGGAGA
ATTCACAATTTCTCAGACCAGGAGAATAGTGTCGAGGAAGAAGACTACGA
TGAGGAAGAGGAGGAAAATGAGGAGAGCGATGAAAACGAACCTGAAGACG
ACGAAGACAATTTGGATGAGGATAATAACGACGAGGACGACGACGATGAT
GAGGACGATGAGAATCCTGATGTTATCGATCTTTTGAGTTCCGATGACGT
CAGTGAAGACAACGATGACAATAACGACAATAAATACGATGACAACGAGA
ATAATGAGGGCGATAATCAGGAATCTTCAAATTATAAGGACGACAAGAAT
GAGTCAGTTGTCGAGGACCTGAAGTCATCAGAAAACGAATTGGAGCTAGC
GAAGAAGAAAATTGAACCGATCGTATGGAATGACCATAATCAACGTAGAA
ATAATAGAAAAGACAATTTTACGATATCACCGAGTAAATCGACACGCTAT
TCCGGCAATGCTGGATTTAGAAGGAAAATGGTTACTTCTCGAAGAAATTT
CCCGTTTACTACTACAAGTGGCCGAGTTTTGTCTGTTGGGCGCAGATCCG
GTGGTCCTTTTAAAGGATCTTTTACTCCTCGTTAAATATTTTTATTGAAT
TTTAC
back to top

protein sequence of SMED30016090-orf-1

>SMED30016090-orf-1 ID=SMED30016090-orf-1|Name=SMED30016090-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=2072bp
MDEPFDINRDFKSELEAFKVENDNLKRDYDKVTIDYELKIENLKKEMNLK
TVNYENLMINFQELDGKYKNSCQEKITVNQNYFDLSQEKFNIVKKYDSLE
SEHTSLLELISRREKELLYSKNEIQELRTLLTEYKTKEIESKLNMNDLEF
RRKDFEQMEQMSLLRSKKLSTEIKKLEEKLAESAQANHNEKTLHNKLVYD
FNLELDGKRNEIKNFKKTIEKLKEQISHLERGNVEKNESLRSAVESQTNI
DNLLRTELNVQVSINELLKEKIEENELKEENFIGAIRELQESLKETVEES
DKMKLEFETKLSGFAQQVSELRMEINRKDNELTEANALFEKFRVKSLSET
EIKSMNPATAAAISALKRGYSMTQIYSEYLQVVNEKEELRVDRDRLNEYM
LSILEELEQKAPLLKKQQEEHSFLELSVSTLGKKYDDNLSQLYSSQSELE
ESHRKCEELSRKLKREEQTSSDLSRQVCCLIREVETYRGTVIRSDEMSIN
ANEPEFITRRRSFHQRSLNNSQSHLSISTGTSMESSNRFITANDVITTHL
VTFKNICELQQQNIRLIEQFRDLSDQQEATENMINENSMLDMAKKLEQAY
KEMDDIKEKHKQNKQLQKTVNAQKHIIQALTMVHGKSDLRSLLASGAIGV
DSPDGSAHLLSPVQDGTGDNNNQTNLNTISTLNGKVAESQEKIDKLQNEI
DRLRDEKEIMREKHSSSIKELNQSLSEIKLANANLMAKISFNQEKTTSLE
QNLINRQMEMADLQNDISELNQKLAKKSEENVSLASQLGSCQMRLREQET
ETKQMQFNRQHMESLEEQLNSEKNEKYQLVSSISEMANQLSSIQIYLNKP
QIEQANEDQIELKSKIKQLTLELKQEKSKYQSSLEMWQAKFSESNAVIDT
LKSQLNSENRASSSANLTITESCTVGVIQTAPEKIEKTGDLESQLEDLSV
LNYSLKKQIEAYHELMANSESKLINNSQLIEEMESKFQDRINELTQEKGE
IEELLENAQLVNRQLESNFNDREKSLEDQVNELERLLGDKTNAFDMLNGE
MSLLKAKECQLISDLERQRQMTKSATENYQQELIYHAQESDALDELNKQM
SQIKNQERNLSERLQETIILRDQYKSDLENRDSIWLAEKRALENETSELK
SQKEYLNNRLVDLNDQLVNLKKLLDPSTVNSIDFAILQRENDWNEVIQYL
RQEKENVERVKNQFELDLNRLRAQYRQQEETIDQLNKTLEEERRFRVVEA
ETQKQHAEIMLEMESKQMLMESNSKLRLDRQRVKELLAETTEKLEKLNES
IEPLKAELKSKNNEIENVKLDARSLENERDLWRKRCDNLIEKSKQVNPEE
FKQICIEKDKLQHQILIEEEKSRVNSELLEELKTQIEEYERSLKDKENQL
ESLKEISDKNQAETQKMSSLITQLRDIGRKYKTESESLSSEIVKITDEKE
NKCKELQALKKEIVEIKQLLDESKKDCQQQLSQASTSSNSASQANDEFVK
KLGSILQCQNSPIDIIETLEKIMKEYQNKIQLLEARESELKFRMQVIEGH
LTNLRLENERMKKQLDSRLNMMNSLDDENGTSEENSTEMLPTTSSSSGCH
GVPAVARVAANVHPVVQKPQNIVPGSSSNQISPNSQPISSCTSTARQTAE
IRPIPAVALHVAPSSSTVDSTTDSVSTASVTTSLPASVVQALAASSSSGP
TVIFPAVSSFTPSSSSSSITLAATTGTVGNPISSSSAPPIINRLKRCFDK
SIEPDSRTSLIEESANSTFDNSNAIKKCRIRVSDVPDDVPVAAIGGQEAL
VISQAQQISQQQQQSVAGGFIDFDHLEEDVHEEVVCEAGEVEIESEEVEE
VEITEDEDENRSKNELEFMFTDMLDGRIHNFSDQENSVEEEDYDEEEEEN
EESDENEPEDDEDNLDEDNNDEDDDDDEDDENPDVIDLLSSDDVSEDNDD
NNDNKYDDNENNEGDNQESSNYKDDKNESVVEDLKSSENELELAKKKIEP
IVWNDHNQRRNNRKDNFTISPSKSTRYSGNAGFRRKMVTSRRNFPFTTTS
GRVLSVGRRSGGPFKGSFTPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR012929TPR/MLP1
IPR014010REJ_dom
Vocabulary: biological process
TermDefinition
GO:0006606protein import into nucleus
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0019013viral nucleocapsid
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1197..1245
NoneNo IPR availableCOILSCoilCoilcoord: 8..35
NoneNo IPR availableCOILSCoilCoilcoord: 1886..1906
NoneNo IPR availableCOILSCoilCoilcoord: 446..476
NoneNo IPR availableCOILSCoilCoilcoord: 286..306
NoneNo IPR availableCOILSCoilCoilcoord: 318..338
NoneNo IPR availableCOILSCoilCoilcoord: 589..616
NoneNo IPR availableCOILSCoilCoilcoord: 1442..1476
NoneNo IPR availableCOILSCoilCoilcoord: 984..1050
NoneNo IPR availableCOILSCoilCoilcoord: 753..787
NoneNo IPR availableCOILSCoilCoilcoord: 852..886
NoneNo IPR availableCOILSCoilCoilcoord: 205..239
NoneNo IPR availableCOILSCoilCoilcoord: 679..738
NoneNo IPR availableCOILSCoilCoilcoord: 1086..1116
NoneNo IPR availableCOILSCoilCoilcoord: 166..193
NoneNo IPR availableCOILSCoilCoilcoord: 40..60
NoneNo IPR availableCOILSCoilCoilcoord: 1379..1413
NoneNo IPR availableCOILSCoilCoilcoord: 795..832
NoneNo IPR availableCOILSCoilCoilcoord: 1062..1082
NoneNo IPR availableCOILSCoilCoilcoord: 1273..1342
NoneNo IPR availableCOILSCoilCoilcoord: 1516..1564
NoneNo IPR availableCOILSCoilCoilcoord: 1139..1173
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 2014..2029
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1844..1863
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1567..1598
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1887..1954
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1955..2013
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1564..1598
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1879..2032
NoneNo IPR availablePANTHERPTHR18898NUCLEOPROTEIN TPR-RELATEDcoord: 12..1990
IPR012929Nucleoprotein TPR/MLP1PFAMPF07926TPR_MLP1_2coord: 1044..1159
e-value: 1.2E-8
score: 35.0