DUF4371 domain-containing protein

Overview
NameDUF4371 domain-containing protein
Smed IDSMED30016081
Length (bp)3958
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DUF4371 domain-containing protein (SMED30016081) t-SNE clustered cells

Violin plots show distribution of expression levels for DUF4371 domain-containing protein (SMED30016081) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DUF4371 domain-containing protein (SMED30016081) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DUF4371 domain-containing protein (SMED30016081) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 108.997 bits (271), Expect = 3.139e-23
Identity = 87/337 (25.82%), Postives = 164/337 (48.66%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVN--EKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF----GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            R  +KS    F+ L   ++ +  FC+ C LF        +  +   G S+     E  +KHE+++ H+ ++   + +    G V  DL +          +++++  N+  LK +I+ + +L KQ    RG++++++S N+GN+LEL+ + +K        L  + +    S +IQ+DII  IK  ++ +I NE+ ++   +I+ DET + + K QLS+ +RY           ERFL F D   + +   L   ++  +   G + +K+  Q YD    +    N    + K   P A+++HC AH L+L +   + F K+ K   + +  ++S F
Sbjct:  454 RSIKKSCCADFECLENSKK-DVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSI----------HSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTE-EMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSI---IRFCKEVKELRSALKTLSSLF 775          
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 108.997 bits (271), Expect = 3.139e-23
Identity = 87/337 (25.82%), Postives = 164/337 (48.66%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVN--EKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF----GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            R  +KS    F+ L   ++ +  FC+ C LF        +  +   G S+     E  +KHE+++ H+ ++   + +    G V  DL +          +++++  N+  LK +I+ + +L KQ    RG++++++S N+GN+LEL+ + +K        L  + +    S +IQ+DII  IK  ++ +I NE+ ++   +I+ DET + + K QLS+ +RY           ERFL F D   + +   L   ++  +   G + +K+  Q YD    +    N    + K   P A+++HC AH L+L +   + F K+ K   + +  ++S F
Sbjct:  454 RSIKKSCCADFECLENSKK-DVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSI----------HSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTE-EMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSI---IRFCKEVKELRSALKTLSSLF 775          
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 108.997 bits (271), Expect = 3.139e-23
Identity = 87/337 (25.82%), Postives = 164/337 (48.66%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVN--EKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF----GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            R  +KS    F+ L   ++ +  FC+ C LF        +  +   G S+     E  +KHE+++ H+ ++   + +    G V  DL +          +++++  N+  LK +I+ + +L KQ    RG++++++S N+GN+LEL+ + +K        L  + +    S +IQ+DII  IK  ++ +I NE+ ++   +I+ DET + + K QLS+ +RY           ERFL F D   + +   L   ++  +   G + +K+  Q YD    +    N    + K   P A+++HC AH L+L +   + F K+ K   + +  ++S F
Sbjct:  454 RSIKKSCCADFECLENSKK-DVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSI----------HSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTE-EMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSI---IRFCKEVKELRSALKTLSSLF 775          
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: ZMYM1 (zinc finger MYM-type containing 1 [Source:HGNC Symbol;Acc:HGNC:26253])

HSP 1 Score: 108.997 bits (271), Expect = 3.139e-23
Identity = 87/337 (25.82%), Postives = 164/337 (48.66%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVN--EKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF----GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            R  +KS    F+ L   ++ +  FC+ C LF        +  +   G S+     E  +KHE+++ H+ ++   + +    G V  DL +          +++++  N+  LK +I+ + +L KQ    RG++++++S N+GN+LEL+ + +K        L  + +    S +IQ+DII  IK  ++ +I NE+ ++   +I+ DET + + K QLS+ +RY           ERFL F D   + +   L   ++  +   G + +K+  Q YD    +    N    + K   P A+++HC AH L+L +   + F K+ K   + +  ++S F
Sbjct:  454 RSIKKSCCADFECLENSKK-DVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSI----------HSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTE-EMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSI---IRFCKEVKELRSALKTLSSLF 775          
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Match: POFUT2 (protein O-fucosyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:14683])

HSP 1 Score: 76.6406 bits (187), Expect = 1.097e-13
Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+G  P TT++ FC D       +E+ C +PT W +
Sbjct:  365 GGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGD-------QEKACEQPTHWKI 427          
BLAST of DUF4371 domain-containing protein vs. Ensembl Celegans
Match: pad-2 (GDP-fucose protein O-fucosyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q8WR51])

HSP 1 Score: 74.3294 bits (181), Expect = 2.344e-13
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query: 3624 FYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            F     L+ G++AI+DQ++ +H   FIG+++STFTFRI E+R+IIGF  STT +  CPD        E  C +P  W +
Sbjct:  351 FTDTQKLNDGQIAIIDQYLCAHAAYFIGSYESTFTFRIQEDREIIGFPISTTFNRLCPD-------TEPTCEQPAKWKI 422          
BLAST of DUF4371 domain-containing protein vs. Ensembl Celegans
Match: pad-2 (GDP-fucose protein O-fucosyltransferase 2 [Source:UniProtKB/Swiss-Prot;Acc:Q8WR51])

HSP 1 Score: 73.9442 bits (180), Expect = 2.521e-13
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query: 3624 FYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            F     L+ G++AI+DQ++ +H   FIG+++STFTFRI E+R+IIGF  STT +  CPD        E  C +P  W +
Sbjct:  353 FTDTQKLNDGQIAIIDQYLCAHAAYFIGSYESTFTFRIQEDREIIGFPISTTFNRLCPD-------TEPTCEQPAKWKI 424          
BLAST of DUF4371 domain-containing protein vs. Ensembl Fly
Match: O-fut2 (gene:FBgn0027791 transcript:FBtr0070296)

HSP 1 Score: 73.1738 bits (178), Expect = 9.221e-13
Identity = 34/76 (44.74%), Postives = 50/76 (65.79%), Query Frame = 3
Query: 3639 NLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKW 3866
             L  G VA+VDQ + ++ R F+GT++STFT+RI EER+I+GF+ ++T + FC    K L      CS+  VWP+ W
Sbjct:  408 ELKDGGVAVVDQLVCAYARYFVGTYESTFTYRIYEEREILGFTQASTFNTFC----KALGG---SCSRNAVWPIVW 476          
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Match: CR762475.1 (pep chromosome:GRCz11:4:55494751:55498830:1 gene:ENSDARG00000098243.2 transcript:ENSDART00000172605.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR762475.1)

HSP 1 Score: 182.185 bits (461), Expect = 2.823e-46
Identity = 128/405 (31.60%), Postives = 207/405 (51.11%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKN--IWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHL-----RTATL----FSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFL---FFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFP--------KLAATHWNYSSLLVNTIKSERKGLSELFENIIEN--PE 1836
            R FQ+S Y    WL    + + ++C+ C +F+  EK KN   W   G +         K+H  T++H+ ++++   +    +    D            +  RNR IL RLID+  YLA+Q +AFRG +E+ +S N+GN++ELV  +++YD ++  HL     + A++     S  SNR QNDII S+   + S+I+NE+KE    +I+LDET+D+SHK Q+S V+RYV      ERFL     +  +G      + +++Q+  L       +  Q YDGAA M+G     Q +++    +A++VHC AH LNLVL +S         FF+ +  +  F + STKR+    +  +  +P        KL+ T W      +  +    K L +L  ++ E+  PE
Sbjct:  200 RSFQRSWYTDRPWLEYSPKNDAIYCFSCRIFLREEKFKNKTAWKTLGINTWRSATGKMKEHASTEAHMMSMVRWNIYSKKALQTAFDTSDIQGKAIRERERQRNREILTRLIDISLYLARQGQAFRGDDESSSSANQGNFIELVKTLAQYDSVMKLHLDAIQEKQASMKKPQVSLLSNRSQNDIIMSLGTFIRSKIQNEIKEAQIFSILLDETTDVSHKEQVSFVVRYVRDMEVKERFLQVCTLESTTGKELENVVISLLQDNGLDL---KNIRGQGYDGAANMSGMYKGLQSRIRAHNEKALYVHCQAHCLNLVLVESAKSSIHFVTFFSLVEKLYVFCTGSTKRHTAFLKCQQSLYPGQRVVELQKLSDTRWACRERSLKALNKVLKALIKLLTDLCESDPPE 601          
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Match: pofut2 (protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3595])

HSP 1 Score: 77.0258 bits (188), Expect = 4.703e-14
Identity = 38/73 (52.05%), Postives = 48/73 (65.75%), Query Frame = 3
Query: 3642 LHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            L  G VAI+DQWI +H R FIGT  STF+FRI EER+I+GF P TT++ FC D        E+ C +PT W +
Sbjct:  377 LKDGGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGFDPKTTYNRFCGD-------VEQECEQPTHWKI 442          
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-240b21.2 (si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526-125])

HSP 1 Score: 55.8398 bits (133), Expect = 4.350e-9
Identity = 30/80 (37.50%), Postives = 45/80 (56.25%), Query Frame = 3
Query: 2007 DFVKLTNELCVLYRSESYHEMNLA-KLIQHILVNDLTDALSEVNKLAHLICTIPFSTASVERSFSALKRVKNYARNTMSQ 2243
            D  KL  EL ++Y  + +     A  L+Q  + N+L +  SE   L  ++ T P +TA  ER FS LKR+K + RN+M+Q
Sbjct:  111 DGSKLKTELSLIYSKDEFRACCGALDLLQLFMENNLEEVFSETVTLVKILVTTPMTTAEAERCFSTLKRIKTFLRNSMTQ 190          

HSP 2 Score: 26.1794 bits (56), Expect = 4.350e-9
Identity = 22/73 (30.14%), Postives = 31/73 (42.47%), Query Frame = 1
Query: 1780 KSERKGLS-ELFENIIENPEGWDEIMDTIFCQLDIRFKKISSLKFFELLNFSFFKKYQSKFPDECLNSLKNAY 1995
            +  R+ LS E+ E I        E+ DTI      RF     L    LL    F++Y   FP++ L+    AY
Sbjct:   41 QKRRRSLSPEVHEQI------AAEVCDTILTHTLERFSFTDHLVSATLLQADRFEQYTVAFPEDALSRTLKAY 107          
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Match: thap12a (THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GENE-040426-2045])

HSP 1 Score: 51.6026 bits (122), Expect = 7.721e-6
Identity = 59/239 (24.69%), Postives = 108/239 (45.19%), Query Frame = 1
Query:  991 TRNRNILKRLIDVVCYLAKQEEAFRGHNEN---INSFNRGNYLELVTL-ISKYDDLLANHLRTAT--LFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV-ERFLFFKDVSGDRSAEALCN-VMQETILSWGCENKLI-AQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVS 1680
            T N+  LK L DVV  +  Q     GH++      SF   N+  L+   I+  D+ L      +   L   +S ++Q  I+  I+  +  E+  E KE    ++++D   +I  ++ + + +R+V+    + E F+ F    GD   EA+   ++ E     G + K    Q Y  + V A  +     K+ ++ P A+   C +  LN+ L+ ++ F     L  +T+  + +FFS S
Sbjct:  147 TLNKEYLKSLFDVVVMMGTQNIPLHGHSDKEPRSKSFTPSNFQALLEYRINAGDEFLRKKFEGSPVNLEHCSSTQLQQ-ILEVIEKCIREELLAEAKEGRCFSLVVDNLVEIEGENYVPLFVRFVDKANCLREEFVDFLLFEGD--VEAITERLVTELTEKCGLDMKYCRGQAYLCSGVSAMKVKAMVAKIAELHPLAVLTPCSSCSLNICLANTMTFT-GVHLVMSTLKKLDAFFSKS 381          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000043220.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:7:36411169:36451375:1 gene:ENSXETG00000018966.1 transcript:ENSXETT00000043220.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 138.272 bits (347), Expect = 1.146e-32
Identity = 96/326 (29.45%), Postives = 171/326 (52.45%), Query Frame = 1
Query:  823 QGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTV--RID-LMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRT-ATLFSGTSNRIQNDIIASIKNILISE----IRNEVKETPFVAIMLDETSDISHKSQLSVVLRYV-NYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCEN-KLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRK---FPKLAATHWNYSS 1761
            +GY+D  +      +HE ++ H +  ++++    +  RID L L++Q        N+++   RN+LKR++  V  L+ +   FRG +E   S   GNYL L+  I+++D  LA H++      +G+++ +   +     +I+ S     I NE K+  + +I +D T D+SH  QL+ ++ YV N G+P ERF+ F    G + AE L + + +T+  +  +      Q+YD A+ M+G  +  Q ++K + P A+++ C AH LNLV + +    ++   FF  +  +  FFS S+ R  +L   +KRK      L+ T W+  S
Sbjct:   97 EGYNDWKNASVRLNEHEESKFHKDCYLRMQNRAKISGRIDQLFLEKQ--------NQEMEYWRNVLKRVVTAVKTLSSRGLPFRGTDEKFGSLTNGNYLMLLEAIAEHDPFLAEHIKKYGNTGTGSTSYLSKTVCFEFIDIVASSVLEVIINEAKQAKYYSISVDSTPDVSHTDQLAFIICYVKNDGIPKERFIKFIPNVGHK-AENLFSAVMDTLKEYHIDILDCRGQSYDNASNMSGPYSGLQARIKQVNPLAVYIPCSAHSLNLVGTSAAESCREAVSFFCILQQLYHFFSASSTRWEMLISHLKRKATVVKNLSTTRWSARS 413          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: slc10a6 (solute carrier family 10 (sodium/bile acid cotransporter), member 6 [Source:Xenbase;Acc:XB-GENE-988401])

HSP 1 Score: 115.546 bits (288), Expect = 7.727e-26
Identity = 103/374 (27.54%), Postives = 169/374 (45.19%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFV--VNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYN----EKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTL-ISKYDDLLANHLRTATLFSG-TSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGV-PV---ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWN--YSSLLV 1770
            R F+    ++++W+     L    C  C++F   V+   +  +I   +     FH +A+KH  T  H  A      F  VR        + S + Q N     +V  NR  L  ++  + +    + A RG          GN   L    I   D++L NHL+ A + +  TS R++N++I      ++S            +++ DE++DIS   QLS+ +R+V+  + PV   E FL F  +     A ++ NV+ E  + +G   +KL  Q YDG + MAG     Q K+K+ +P A+FV+C +H LNLV++  +  + D +    +   I  FF  S KR  ++        P L  T W   Y S+ V
Sbjct:   24 RCFRHVWLKQYRWICYSPHLKGALCKYCVIFPQPVHRGFQGAFITAPFLKYRDFHNSARKHSLTTCHKQAYDDATNFINVR-----SHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRGKTST-----SGNVQALFDFCIESGDEILKNHLKNAPVNARYTSVRVENELI------VLSGF----------SVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKA-VDATSIANVIMEQCIKFGLNMDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVYCASHKLNLVVN-DLKAVPDIRNAIGSGKAIIKFFRESPKRRSLIPNV-----PLLCETRWTAKYKSIRV 364          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: tbx18 (T-box 18 [Source:Xenbase;Acc:XB-GENE-489907])

HSP 1 Score: 107.842 bits (268), Expect = 2.993e-23
Identity = 94/323 (29.10%), Postives = 149/323 (46.13%), Query Frame = 1
Query:  838 LNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYN----EKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTL-ISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGV-PV---ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWN--YSSLLV 1770
            L +FH +A+KH  T  H  A      F  VR        + S + Q N     +V  NR  L  ++  + +    + A RG      +   GN   L    I   D++L NHL+ A + +     I       ++  +IS   N V      +++ DE++DIS   QLS+ +R+V+  + PV   E FL F  +     A ++ NV+ E  + +G   +KL  Q YDG + MAG     Q K+K+ +P A+FVHC +H LNLV++ ++  + + +    ++  I  FF  S KR  ++        P L  T W   Y S+ V
Sbjct:   20 LYNFHNSARKHSLTMWHKQAYADATNFINVR-----SHPEQSIVCQVNSAVKHQVEENRKKLYSVLSTIVFCGTHDIALRG-----KTSTSGNVQALYDFRIESGDEILKNHLKNAPVNALLCEDI-------LRERIISAANNSVG----FSVIADESADISGHEQLSLGVRFVDLTITPVKIREEFLGFATLKA-FDATSIANVIMEQCIKFGLNIDKLYGQGYDGCSTMAGKEGGVQAKIKEKYPRAIFVHCASHKLNLVVN-NLNAVPEIRNAIGSVKAIIKFFRESPKRRSLIPNV-----PLLCETRWTAKYKSIRV 314          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: dbnl (drebrin like [Source:Xenbase;Acc:XB-GENE-494566])

HSP 1 Score: 77.7962 bits (190), Expect = 3.935e-14
Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+ F+P TT++ FC D+ KN       C +PT W +
Sbjct:  367 GGVAIIDQWICAHARYFIGTSVSTFSFRIHEEREILSFNPKTTYNRFCGDKEKN-------CEQPTHWKI 429          
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Match: dbnl (drebrin like [Source:Xenbase;Acc:XB-GENE-494566])

HSP 1 Score: 77.7962 bits (190), Expect = 4.122e-14
Identity = 37/70 (52.86%), Postives = 48/70 (68.57%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+ F+P TT++ FC D+ KN       C +PT W +
Sbjct:  360 GGVAIIDQWICAHARYFIGTSVSTFSFRIHEEREILSFNPKTTYNRFCGDKEKN-------CEQPTHWKI 422          
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 95.5153 bits (236), Expect = 2.697e-19
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 1
Query:  754 NKLFCWPCLLFVVNEKD--KNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFF---KDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            N  FC+ C LF   +    +  +  QG +D        +KHE +  H      LK+    R    LD     +   Y++++  N+  L+ +I+ + +L KQ    +G++++++  N+G++LEL+ L ++ D      L ++ +   +S  +Q +II  IK+ ++ +I +E+  +   +I+ +E +  + + QLSV +RY           ERFL F   ++V+G      +   +Q+  + +   NK+  Q YD A      LN    + K   P A++VHC AH L L +   + F K+ K     +  + S F
Sbjct:  315 NIAFCYSCYLFFQKKFSCRREAFATQGTADWEKMLGNFRKHEESDVH------LKSLQFWRQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR-DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDF---NKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAV---ISFCKEVKELREALHTLCSLF 616          
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 95.5153 bits (236), Expect = 2.697e-19
Identity = 81/315 (25.71%), Postives = 150/315 (47.62%), Query Frame = 1
Query:  754 NKLFCWPCLLFVVNEKD--KNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFF---KDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            N  FC+ C LF   +    +  +  QG +D        +KHE +  H      LK+    R    LD     +   Y++++  N+  L+ +I+ + +L KQ    +G++++++  N+G++LEL+ L ++ D      L ++ +   +S  +Q +II  IK+ ++ +I +E+  +   +I+ +E +  + + QLSV +RY           ERFL F   ++V+G      +   +Q+  + +   NK+  Q YD A      LN    + K   P A++VHC AH L L +   + F K+ K     +  + S F
Sbjct:  315 NIAFCYSCYLFFQKKFSCRREAFATQGTADWEKMLGNFRKHEESDVH------LKSLQFWRQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR-DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDF---NKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAV---ISFCKEVKELREALHTLCSLF 616          
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Match: Zmym1 (zinc finger, MYM domain containing 1 [Source:MGI Symbol;Acc:MGI:1915560])

HSP 1 Score: 89.7373 bits (221), Expect = 1.437e-17
Identity = 75/296 (25.34%), Postives = 142/296 (47.97%), Query Frame = 1
Query:  805 KNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFF---KDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            +  +  QG +D        +KHE +  H      LK+    R    LD     +   Y++++  N+  L+ +I+ + +L KQ    +G++++++  N+G++LEL+ L ++ D      L ++ +   +S  +Q +II  IK+ ++ +I +E+  +   +I+ +E +  + + QLSV +RY           ERFL F   ++V+G      +   +Q+  + +   NK+  Q YD A      LN    + K   P A++VHC AH L L +   + F K+ K     +  + S F
Sbjct:  236 REAFATQGTADWEKMLGNFRKHEESDVH------LKSLQFWRQYQFLDAIPCDNSSVYSKQIEGNKKYLRLIIENILFLGKQCLLLKGNDQSVSPMNKGSFLELLELRAR-DRGEVFQLMSSHVDFYSSTLVQEEIIEMIKDEMLQDIVSEINASSAFSIICEEIAGSAAERQLSVCVRYPQKTPSAVLVKERFLGFVTAEEVTGVHVHGRIKAYLQQVGVDF---NKICGQAYDSATNFTVKLNEVVAEFKKEEPRALYVHCHAHFLELAV---ISFCKEVKELREALHTLCSLF 518          
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Match: Pofut2 (protein O-fucosyltransferase 2 [Source:MGI Symbol;Acc:MGI:1916863])

HSP 1 Score: 76.6406 bits (187), Expect = 6.597e-14
Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKW 3866
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+G  P TT++ FC D       +E+ C +PT W + +
Sbjct:  365 GGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGD-------QEKACEQPTHWKIAY 429          
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Match: Zbed5 (zinc finger, BED type containing 5 [Source:MGI Symbol;Acc:MGI:1919220])

HSP 1 Score: 58.151 bits (139), Expect = 7.712e-8
Identity = 43/157 (27.39%), Postives = 77/157 (49.04%), Query Frame = 1
Query: 1141 DLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSA----EALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVL 1599
            D     L   +L + T  R  +D+ A I + ++ EI++     P  +I LDE++D+++  QL V +RY+N G   + FL  K +    +A    EA+ + +++  +SW     +     DGA    G  +  Q+ V +  P+A+  HC  H+  L +
Sbjct:  291 DEFVTKLSAVSLSNDTVRRRIHDMSADILDQVVQEIKS--APLPICSIQLDESTDVANCLQLMVYVRYINDGDFKDEFLCCKPLERTATALDVFEAVDSFLRQHEISW---KSICGVCTDGAPATLGCQSGFQRLVLNESPKAIGAHCMLHLQTLAM 442          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q5SVZ6|ZMYM1_HUMAN (Zinc finger MYM-type protein 1 OS=Homo sapiens OX=9606 GN=ZMYM1 PE=1 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.507e-22
Identity = 87/337 (25.82%), Postives = 164/337 (48.66%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVN--EKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF----GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPV----ERFLFFKDVSGDRSAEALCNVMQETILSWGCE-NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFF 1671
            R  +KS    F+ L   ++ +  FC+ C LF        +  +   G S+     E  +KHE+++ H+ ++   + +    G V  DL +          +++++  N+  LK +I+ + +L KQ    RG++++++S N+GN+LEL+ + +K        L  + +    S +IQ+DII  IK  ++ +I NE+ ++   +I+ DET + + K QLS+ +RY           ERFL F D   + +   L   ++  +   G + +K+  Q YD    +    N    + K   P A+++HC AH L+L +   + F K+ K   + +  ++S F
Sbjct:  454 RSIKKSCCADFECLENSKK-DVAFCYSCQLFCQKYFSCGRESFATHGTSNWKKTLEKFRKHEKSEMHLKSLEFWREYQFCDGAVSDDLSI----------HSKQIEGNKKYLKLIIENILFLGKQCLPLRGNDQSVSSVNKGNFLELLEMRAKDKGEETFRLMNSQVDFYNSTQIQSDIIEIIKTEMLQDIVNEINDSSAFSIICDETINSAMKEQLSICVRYPQKSSKAILIKERFLGFVDTE-EMTGTHLHRTIKTYLQQIGVDMDKIHGQAYDSTTNLKIKFNKIAAEFKKEEPRALYIHCYAHFLDLSI---IRFCKEVKELRSALKTLSSLF 775          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8VHI3|OFUT2_MOUSE (GDP-fucose protein O-fucosyltransferase 2 OS=Mus musculus OX=10090 GN=Pofut2 PE=1 SV=1)

HSP 1 Score: 76.6406 bits (187), Expect = 4.615e-13
Identity = 36/72 (50.00%), Postives = 48/72 (66.67%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKW 3866
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+G  P TT++ FC D       +E+ C +PT W + +
Sbjct:  365 GGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGD-------QEKACEQPTHWKIAY 429          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Y2G5|OFUT2_HUMAN (GDP-fucose protein O-fucosyltransferase 2 OS=Homo sapiens OX=9606 GN=POFUT2 PE=1 SV=3)

HSP 1 Score: 76.6406 bits (187), Expect = 5.270e-13
Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+G  P TT++ FC D       +E+ C +PT W +
Sbjct:  365 GGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGD-------QEKACEQPTHWKI 427          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6EV56|OFUT2_PANTR (GDP-fucose protein O-fucosyltransferase 2 OS=Pan troglodytes OX=9598 GN=POFUT2 PE=2 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 5.861e-13
Identity = 36/70 (51.43%), Postives = 47/70 (67.14%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT  STF+FRI EER+I+G  P TT++ FC D       +E+ C +PT W +
Sbjct:  365 GGVAIIDQWICAHARFFIGTSVSTFSFRIHEEREILGLDPKTTYNRFCGD-------QEKACEQPTHWKI 427          
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8WR51|OFUT2_CAEEL (GDP-fucose protein O-fucosyltransferase 2 OS=Caenorhabditis elegans OX=6239 GN=pad-2 PE=1 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 2.982e-12
Identity = 34/79 (43.04%), Postives = 49/79 (62.03%), Query Frame = 3
Query: 3624 FYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            F     L+ G++AI+DQ++ +H   FIG+++STFTFRI E+R+IIGF  STT +  CPD        E  C +P  W +
Sbjct:  351 FTDTQKLNDGQIAIIDQYLCAHAAYFIGSYESTFTFRIQEDREIIGFPISTTFNRLCPD-------TEPTCEQPAKWKI 422          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A2S2NR69 (Zinc finger MYM-type protein 1 OS=Schizaphis graminum OX=13262 GN=ZMYM1_111 PE=4 SV=1)

HSP 1 Score: 441.425 bits (1134), Expect = 2.488e-135
Identity = 216/432 (50.00%), Postives = 302/432 (69.91%), Query Frame = 1
Query:  559 IIKDLLENPFSRRDVATKNKIVKLSRPVPDIF-LSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNY--GVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWD 1845
            +I+ LLEN F  ++   K  IVK  RP P+I  L+ N K K + Y+RHF  S Y    WLTG  +LNKLFCWPC+LF    ++KN+W   G+ +LN+     +KHER+Q+HI++V++LKTFG  RIDL LD+Q+ S ++++NE V +NR++LKR ID VC+L   E  FRGHNE +NSF++GN+L  + L+S YD +L  HL T+ +F GTSNRIQND+I S+ NI+ + I +E+K + FVAI+LDETSDI++ SQLS  LRYV++  G   ERF+ F DVS DRSA+ L   + + +  +  ++KL+AQTYDGAAVM+G +   Q KVK+++P A+FVHC +H LNLVLSQS   IKDCK+FF T++G+ SFF+ S+KR H L+   ++K PK A T WN+SS LVNT+        E F+++++N   WD
Sbjct:    9 LIEHLLENEFHLKNFGEKLTIVKNGRPCPEIPKLTSNHKEKNKVYIRHFNISNYLNTPWLTGSAKLNKLFCWPCVLFT---REKNVWSHSGFVNLNNLTNGIQKHERSQTHISSVLKLKTFGKPRIDLQLDEQRRSYVIRHNELVKKNRDVLKRFIDCVCFLVIHELPFRGHNERVNSFDQGNFLGCLNLLSSYDSILNVHLETSKIFRGTSNRIQNDLICSVSNIISTSIESEIKNSNFVAILLDETSDITNLSQLSTTLRYVHHETGEAHERFISFVDVSADRSADGLLKYVIDIVNRYELKHKLVAQTYDGAAVMSGHVGGLQVKVKELYPRALFVHCFSHSLNLVLSQSASNIKDCKIFFQTLTGMGSFFTKSSKRTHALSNFTRKKMPKNAPTRWNFSSRLVNTVHEYNSYFIEFFQHVLDNSNDWD 437          

HSP 2 Score: 85.5001 bits (210), Expect = 2.153e-22
Identity = 45/81 (55.56%), Postives = 58/81 (71.60%), Query Frame = 3
Query: 2004 FDFVKLTNELCVLYRSESYHEMNLA-KLIQHILVNDLTDALSEVNKLAHLICTIPFSTASVERSFSALKRVKNYARNTMSQ 2243
            FDF++L NEL VLY+SE +  +N    L++ I +NDL     EV KL+ LI TIP +TASVERSFSALKR+K+Y R+T  Q
Sbjct:  593 FDFIRLRNELIVLYKSEEF--LNTPYDLVKKIKMNDLISVFQEVFKLSQLILTIPITTASVERSFSALKRIKSYQRSTQGQ 671          

HSP 3 Score: 52.373 bits (124), Expect = 2.153e-22
Identity = 26/46 (56.52%), Postives = 38/46 (82.61%), Query Frame = 2
Query: 2243 DRLINLSVITIEKEMLHLLQSKTEFYDHVIDDFVKNTDRRMDFVYK 2380
            +RL +LS+I+IEKE+LH  ++  EFYD VI++F+K  +RR+DFVYK
Sbjct:  672 ERLSSLSLISIEKELLHKEKNHPEFYDKVINEFIKQ-ERRIDFVYK 716          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: X1WND4 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 414.461 bits (1064), Expect = 4.136e-125
Identity = 210/441 (47.62%), Postives = 287/441 (65.08%), Query Frame = 1
Query:  559 IIKDLLENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALC----NVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWDEIMDTIFC 1869
            II+ LL+  F     + K  I+   RP P +   QN+K K ++  R+F  S Y+  KWL+GC +  KL+CWPC+LF    ++ N+W K G+ DLN++H    +HE  +SHI  +I LK FG +RI+  L +    SI ++NE +  NR ++ RLID  CYLAKQE  FRGH+E I S NRGNY+EL+ L+   D  L+ HL TAT+FSG S  IQND+I SI N+L+ ++  E+K   FV+I++DET+D+  KSQLS++ RY+      ERFL F DVS DRSA+ L     N++QE    + CENKLIAQTYDGAAVM+G  N  Q  V+     AMFVHC AH LNL+L QSV  IK+CK+FF T+SG++SFFS STKR + L + +K++FP +A T WNY+S LV  +   ++ +  L + IIEN E WD   +T+ C
Sbjct:   21 IIEQLLQKSFGTYSFSEKQNIINKGRPTPKL---QNLKSKNKKTFRYFNSSYYDSNKWLSGCEKTQKLYCWPCILF---SRESNVWSKFGFVDLNNYHNLKHRHETNRSHIECLITLKKFGNIRIETCLSEAYKISIEKHNETIKNNRYVVSRLIDATCYLAKQELPFRGHDEQITSTNRGNYVELINLMGTLDLKLSGHLSTATVFSGLSGDIQNDLIQSISNVLMKKVTLEIKNVDFVSIIMDETTDVVSKSQLSIIFRYITQEGVQERFLGFVDVSQDRSAKCLAEHTFNILQE----YNCENKLIAQTYDGAAVMSGQHNGLQALVRLKCKNAMFVHCYAHKLNLILKQSVDHIKECKVFFLTLSGLSSFFSKSTKRIYALEQEVKKRFPSVAPTRWNYNSRLVEMMSEYKQEVLNLMDTIIENGEKWDS--ETLSC 449          

HSP 2 Score: 75.0998 bits (183), Expect = 2.123e-25
Identity = 36/88 (40.91%), Postives = 58/88 (65.91%), Query Frame = 3
Query: 1980 VKERVCKHFDFVKLTNELCVLYRSESYHEMNLAKLIQHILVNDLTDALSEVNKLAHLICTIPFSTASVERSFSALKRVKNYARNTMSQ 2243
            +K    ++FDF  L +EL ++Y S  +H+ N+ +L  ++   +L+++L +V KL+ LI TIP ++A  ERSFS LKR+  Y RN+ SQ
Sbjct:  597 LKNSYGEYFDFSILKSELTIVYSSTEFHKRNINELWLYLKSTELSESLPQVTKLSSLILTIPATSAGAERSFSTLKRIHTYLRNSQSQ 684          

HSP 3 Score: 52.7582 bits (125), Expect = 2.123e-25
Identity = 31/88 (35.23%), Postives = 56/88 (63.64%), Query Frame = 1
Query: 1747 WNYSSLLVNT---IKSERKGLSELFENIIENPEG-WDEIMDTIFCQLDIRFKKISSLKFFELLNFSFFKKYQSKFPDECLNSLKNAYA 1998
            W+ S   +NT   ++S+R  ++E+ E+   N    + EI+D +  +++ RF +IS L+FF LL+FS F ++ ++FP   ++SLKN+Y 
Sbjct:  515 WSKSEQYLNTEMPLRSKRLRITEVSEDKKTNYRRLFFEIIDVLVTKINERFSEISKLQFFSLLDFSKFDQFVNQFPTSSMDSLKNSYG 602          

HSP 4 Score: 40.4318 bits (93), Expect = 2.123e-25
Identity = 19/46 (41.30%), Postives = 32/46 (69.57%), Query Frame = 2
Query: 2243 DRLINLSVITIEKEMLHLLQSKTEFYDHVIDDFVKNTDRRMDFVYK 2380
            +RL  LS+++IEK++L  +Q +  FYD VI+D+ K   RR++  +K
Sbjct:  685 NRLSALSILSIEKQLLTQIQKENSFYDEVIEDYSKK-PRRINLCFK 729          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: H3B204 (DUF4371 domain-containing protein OS=Latimeria chalumnae OX=7897 PE=4 SV=1)

HSP 1 Score: 398.282 bits (1022), Expect = 2.385e-119
Identity = 206/436 (47.25%), Postives = 285/436 (65.37%), Query Frame = 1
Query:  556 SIIKDLLENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQ--YVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTAT-LFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNY-GVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWDEI 1851
            +++  LLE PFSR   A K + VK   P P     QN  I  Q   +++HFQ SIY K  W+T C +  KLFCWP LLF    K+KN+W   G+ DLN+  +A ++HER+  H+  V+QL  FG   ID MLD Q    I ++N +V + R++LKR ID+VC L +QE +FR H+E+  S NRGNY+E+   + +YDD L  H  TA+ +F+G SN IQNDI+ S+  ++++ I+ E+   PFVAIM+DETSD S  SQ SVV RYV+  G   E F+ FKDVS DRS +AL +++ E +  + C NKL+A+TYDGAA M+G ++  Q +V++ +P+ +FVHC  HVLNLVLSQSV  IK  + FF     I SFFS STK+   L++ ++++ P +A T WN+SS LVNT++   K L ELF  I+ENPEGWD +
Sbjct:   13 NMVTHLLEKPFSRHLRADKKETVKQGCPRP-----QNFSITSQAKGFIQHFQNSIYSKHPWITACAQRQKLFCWPSLLFCT-VKEKNVWTTTGHLDLNNLFKAMQRHERSLVHMQTVVQLDFFGDKMIDEMLDDQ----ISKHNAQVEKKRDVLKRFIDIVCLLGRQELSFRTHDESATSLNRGNYVEMAHFLIRYDDRLVTHFSTASNVFTGLSNHIQNDIVQSVSTVILNFIKKELLAAPFVAIMVDETSDFSLHSQASVVFRYVDEDGKAQEWFVGFKDVSADRSVKALADMVFEYLEVFQCGNKLVAETYDGAAGMSGEVSGLQTRVRERYPKPLFVHCYTHVLNLVLSQSVCSIKSAR-FFCYSFWIFSFFSHSTKQTQELDKVVRKRLPSVAPTRWNFSSRLVNTVEEHHKDLLELFGGIVENPEGWDHL 437          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: J9K5B1 (Uncharacterized protein OS=Acyrthosiphon pisum OX=7029 PE=4 SV=1)

HSP 1 Score: 367.081 bits (941), Expect = 7.620e-118
Identity = 204/481 (42.41%), Postives = 277/481 (57.59%), Query Frame = 1
Query:  559 IIKDLLENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYV-NYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWDEIMDTIFCQLDIRFKKISSLKFFELLNFSFFKKYQSKFPDECLNSLKNAYA 1998
            II+ LL   F       K  I+   RP P +   Q++K K +   R F  S Y   KWL+GC++  KL+CWPC+LF     + N W K G SDLN++H    +HE  +SHI ++I LK FG +RI+  L      SI ++NE V  NR +L RLID  C+LAKQE +FRG +E + S NRGNY+EL+ L+   D  L+ HL T+T                            ++ T FV+I++DET+DI  KSQLS +LRYV N GV  ERFL F DVS DRSA+ L   +   +  + C +KL+AQTYDGAAVM+G  N  Q  V+     A+FVHC AH LNL+L QSV +IK+CK+FF T+SG++SFFS STKR H L++ +K++FP +A T WNY+S L+  I   R+ +  L  +I+EN E WD                          NFS F++Y +KFP   ++SLK+ Y 
Sbjct:   16 IIEKLLLKSFGSNTFIEKQNIINNGRPTPTL---QDLKSKCKNNFRFFNPSYYNTNKWLSGCQKSQKLYCWPCILF---SHESNTWSKYGCSDLNNYHNLKHRHEINRSHIESLITLKKFGNIRIETCLSDAYKLSIEKHNESVKNNRYVLSRLIDATCFLAKQELSFRGRDEQVTSINRGNYVELIHLMGTLDPKLSEHLSTST----------------------------IEHTNFVSIIMDETTDIMSKSQLSTILRYVTNEGVE-ERFLGFVDVSHDRSAKCLAEHVFRLLNEYKCIDKLVAQTYDGAAVMSGQHNGLQTLVRSKCKNAIFVHCYAHKLNLILKQSVDYIKECKIFFTTLSGLSSFFSKSTKRIHALDQEVKKRFPSVAPTRWNYNSRLIEMISEYREEVLNLMNSIVENGEKWD--------------------------NFSKFEQYINKFPTNSMDSLKDKYG 435          

HSP 2 Score: 63.1586 bits (152), Expect = 7.620e-118
Identity = 37/101 (36.63%), Postives = 59/101 (58.42%), Query Frame = 3
Query: 1980 VKERVCKHFDFVKLTNELCVLYRSESYHEMNLAKL-----------IQHILVNDLTDA--LSEVNKLAHLICTIPFSTASVERSFSALKRVKNYARNTMSQ 2243
            +K++  ++FDF  L +EL ++Y S  +H++N+ +L           I+ I   ++T    L +V KL  LI TIP ++A  E SFS LKR+K + RN+ SQ
Sbjct:  430 LKDKYGEYFDFAILRSELSIIYSSTEFHKVNIHELWILRSYTMDRVIRTIYEANITVGPHLPQVTKLTSLIVTIPATSAGTEHSFSCLKRIKTHLRNSQSQ 530          

HSP 3 Score: 48.521 bits (114), Expect = 7.620e-118
Identity = 24/46 (52.17%), Postives = 35/46 (76.09%), Query Frame = 2
Query: 2243 DRLINLSVITIEKEMLHLLQSKTEFYDHVIDDFVKNTDRRMDFVYK 2380
            +RL +LS++ IEK +L  +Q++  FYD+VIDDF K T RR+D +YK
Sbjct:  531 NRLSDLSLLAIEKRLLTTVQNQNLFYDNVIDDFTKKT-RRIDLLYK 575          
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Match: A0A2J7PVF6 (DUF4371 domain-containing protein (Fragment) OS=Cryptotermes secundus OX=105785 GN=B7P43_G13205 PE=4 SV=1)

HSP 1 Score: 386.341 bits (991), Expect = 1.621e-117
Identity = 194/431 (45.01%), Postives = 278/431 (64.50%), Query Frame = 1
Query:  559 IIKDLLENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFG-TVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNY-GVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWD 1845
            +I+ LL+ PFS      K KI++   P P++ L   VK       RHF  S+YE   WL GC +L KLFCWPCLLF    K+K+++   GY+D+N+ +++ K+H  + +HI  + ++  FG   RI+  L  Q   SI ++NE V +NR  + +LI  VC+L  Q  AFRGH+E++ S NRGNY+E++ ++++YD  L NHL ++T F G+S  IQN++I S+  ++  EI+ E+ +  +V+++LDETSD+ +K QL+ VLRYV   G   ERFL F DVS DRSA +L N   E +  + C  KLIAQTYDGAAVMA      Q K+++ +P A+FVHC AH LNLVL+QS  FIK+ K+FFAT+SG  +FF+ STKR   L+  ++++FP +A T W Y S L  T+   R+G+  L  +IIE PE WD
Sbjct:   10 VIEKLLQTPFSSLSYNEKLKIIEEGAPKPNLTLHTKVK----SCTRHFNTSLYEAIPWLCGCDKLKKLFCWPCLLF---SKEKHVFNSAGYNDINNIYKSGKRHGHSVNHIACLKEITLFGKNRRIEFSLSSQYKQSIEKHNEAVKQNRKFVGQLITAVCFLGSQGLAFRGHDESVASVNRGNYIEVLNMLARYDSDLHNHLESSTAFRGSSPDIQNELIHSVSELMTMEIKKEISKANYVSLILDETSDVMNKCQLASVLRYVTADGNVEERFLRFTDVSSDRSANSLFNHALEILNDFECGPKLIAQTYDGAAVMASQHAGVQAKIREQYPNAIFVHCYAHRLNLVLAQSASFIKEVKVFFATLSGFRTFFAKSTKRTEALDSHLRKRFPSIAPTRWQYHSRLAETVHEYREGIENLLVSIIEEPEEWD 433          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000034915.1 (pep primary_assembly:Astyanax_mexicanus-2.0:4:24766423:24768072:-1 gene:ENSAMXG00000029140.1 transcript:ENSAMXT00000034915.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 379.407 bits (973), Expect = 8.530e-118
Identity = 194/437 (44.39%), Postives = 289/437 (66.13%), Query Frame = 1
Query:  538 MENPDVSIIKDLLENPFSRRDVATKNKIVKLSRPVPDI-FLSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWD 1845
            ME+ D  I+ +LL  PFSRR    K  IV+  RP P +  L+Q  K     YVRHFQ S +E++ WLTG  +  KL+ W CLLF  ++   ++W   G+ +L+   +AA+KH+ + +H+ AV+  KTFG VRIDL L++Q+      +NE+V +NR ILKRLID V +L KQE  FRGH+E   S N GNYLEL++ +++YD  L  HL T+ +F+GTS  IQND+I  +  ++   I++E+K+  F A+M+DET+DIS+ +QLS+VLRYV      ERF+ F+DV+  + A  +  ++ + +  + C  K++AQ YDGAAVMA  LN  Q KVK+  P+A+F+HC AH LNLV+SQ V  I++CK+FF+  +G+A+FFS S KR  +L+E  +++ P++A T WN +S LV T+  ++  L ++F  I+E+ E +D
Sbjct:    1 MESQD--IVSELLTTPFSRRTFNEKVDIVRKGRPTPHLQILTQAGK----GYVRHFQASNWERYPWLTGSVQRKKLYYWDCLLFSSSDS--SVWSNTGFDNLSCLTKAAQKHQNSAAHLRAVVLSKTFGDVRIDLQLNEQRRRETEMHNERVRKNREILKRLIDCVIFLGKQELPFRGHDEGRVSANLGNYLELLSFLAEYDKDLHYHLSTSKVFTGTSGTIQNDLINVVAEVIGKSIKDEIKDAAFTAVMVDETTDISNTTQLSLVLRYVTEDGIKERFVKFEDVTKSKRAHDIAELVMKCLEDFECVGKVVAQCYDGAAVMASGLNGVQAKVKEKIPQALFIHCYAHTLNLVMSQGVAKIRECKIFFSHPTGLAAFFSKSPKRTQLLDEICQKRLPRVAPTRWNLASRLVCTVFEKKDALKDVFNYIVEHHEDFD 429          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040801.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000046.1:3031619:3038346:1 gene:ENSAMXG00000043357.1 transcript:ENSAMXT00000040801.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 181.03 bits (458), Expect = 1.138e-46
Identity = 131/415 (31.57%), Postives = 210/415 (50.60%), Query Frame = 1
Query:  577 ENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSD----LNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANH---LRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCEN-KLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKR------KFPKLAATHWNYSSLLVNTI 1779
            E      D  T  K VKL++    +F +Q          R FQ + ++ F WL    + +  FC+ C +F  N K +++++  G       L+ +H    KHE +QSH ++VI+ +++ +  +   + QQ  S+    + +V   R  LKR++ V   L KQ   FRGH+E+  S ++G + E   L+ K+D  L ++   L T  L S +    QN+++      + + I  E++E    AIM DE  D   + QLS+ +RYV  G+  ERFL   ++ G   AE++ N  ++ +   G  + K +AQTYDGAAVM+GA+   Q   +   PEA++VHC AH LNLVL  +   I + + FF  +  + SFFS S   +H   ET  R      +  +L++T W      VN +
Sbjct:   29 ETALDLGDRNTGPKQVKLAQYPQSVFGTQK---------RAFQFNWFQSFNWLEYSCKRDAAFCYACRVFGRNLK-QDVFVSGGVKTWRKALSFYH----KHESSQSHKDSVIRWQSYKSSLLKGSVVQQIESAT---STEVQERREYLKRIVAVTSLLGKQGIPFRGHDESCESHDKGMFAECFKLLQKFDPFLKSYTPPLNTTYLSSCS----QNEMVQCCAEEVTATIVKEMREAQMFAIMADEARD-GKREQLSLCVRYVTGGMIKERFLALTELMG-FDAESIANTTEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSFFSSSLVNHHKFVETQTRLGLQQTELVQLSSTRWACQLRSVNCV 420          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000042930.1 (pep primary_assembly:Astyanax_mexicanus-2.0:12:25471427:25473738:-1 gene:ENSAMXG00000037442.1 transcript:ENSAMXT00000042930.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.622 bits (418), Expect = 4.309e-42
Identity = 111/321 (34.58%), Postives = 172/321 (53.58%), Query Frame = 1
Query:  826 GYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYV-------NYGVPV---ERFLFFKDVSGDRSAEALCNVMQETILSWG-CENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRK--FPKLAATHW 1749
            G +D        KKHE +++H+ A +    F T + DL +D Q  S   +Y  +V    ++L R+ DV   LA    AFRGH E +   N GN+L ++ L+++YD +L   L   +  +  S  IQN++IA +   +  EI +E+KE  F ++++D T D+S   QLS V RYV       +  + V   E FL F+++S D++A+ L   + E I S G   +K   Q YDGA+ M+G  +  QK++ D  P A++VHC AH LNLVL+ +   I + K ++  +  +  FFS S KR  +L   +K K    +L  T W
Sbjct:   21 GINDWRGLSAKIKKHESSRAHLAACV---VFDTWKNDLTVDAQLDS---EYKSQVRFWTDVLMRITDVTLTLASCNLAFRGHREKVGELNSGNFLSVIDLLARYDPVLRELLDKKSNVNYLSPSIQNELIALLSQRVHDEIVSEIKEAEFYSVIMDTTQDLSKVDQLSQVFRYVTVRKDEADNAIAVDINESFLGFQNIS-DQTAQGLETKITELIQSNGLLLHKCRGQGYDGASTMSGIYSGVQKRILDKEPNAVYVHCAAHNLNLVLNDACQHITEIKEYYDILQRLYVFFSQSIKRWELLENHLKSKPTLKRLCPTRW 334          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000047860.1 (pep primary_assembly:Astyanax_mexicanus-2.0:1:6357378:6364849:-1 gene:ENSAMXG00000040443.1 transcript:ENSAMXT00000047860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 165.236 bits (417), Expect = 6.414e-42
Identity = 106/309 (34.30%), Postives = 170/309 (55.02%), Query Frame = 1
Query:  865 KHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANH---LRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCEN-KLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTI 1779
            KHE +QSH ++VI+ +++ +  +   + QQ  S+    + +V   R  LKR++ V   L KQ   FRGH+E+  S ++G + E   L+ K+D  L ++   L T  L S +    QN+++      + + I  E++E    AIM DE  D   + QLS+ +RYV  G+  ERFL   ++ G   AE++ N++++ +   G  + K +AQTYDGAAVM+GA+   Q   +   PEA++VHC AH LNLVL  +   I + + FF  +  + SFFS S   +H   ET + +  +L++T W      VN +
Sbjct:   61 KHESSQSHKDSVIRWQSYKSSLLKGSVVQQIESAT---STEVQERREYLKRIVAVTSLLGKQGIPFRGHDESCESHDKGMFAECFKLVQKFDPFLKSYTPPLNTTYLSSCS----QNEMVQCCAEEVTATIVKEMREAQMFAIMADEARD-GKREQLSLCVRYVTGGMIKERFLALTELMG-FDAESIANIIEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQVHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSFFSSSLVNHHKFVET-QTELVQLSSTRWACQLCSVNCV 359          
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000040045.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001233.1:775353:781174:-1 gene:ENSAMXG00000039134.1 transcript:ENSAMXT00000040045.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 158.303 bits (399), Expect = 1.057e-39
Identity = 102/289 (35.29%), Postives = 157/289 (54.33%), Query Frame = 1
Query:  865 KHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANH---LRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCEN-KLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKR 1719
            KHE +QSH ++VI+ +++ +  +   + QQ  S+    + +V   R  LKR++ V   L KQ   FRGH+E+  S  +G + E   L+ K+D  L ++   L T  L S +    QN+++      + + I  E++E    AIM DE  D   + QLS+ +RYV  G+  ERFL    + G   AE++ N +++ +   G  + K +AQTYDGAAVM+GA+   Q   +   PEA++VHC AH LNLVL  +   I + + FF  +  + SFFS S   +H   ET  R
Sbjct:   32 KHESSQSHKDSVIRWQSYKSSLLKGSVVQQIESAT---STEVQERREYLKRIVAVTSLLGKQGIPFRGHDESCESHGKGMFAECFKLVQKFDPFLKSYTPPLNTTYLSSCS----QNEMVQCCAEEVTATIVKEMREAQMFAIMADEARD-GKREQLSLCVRYVTGGMIKERFLALTVLMG-FDAESIANTIEQQLALNGIGDLKCVAQTYDGAAVMSGAVGGVQAHFRKKHPEAVYVHCYAHELNLVLCHTCRAISEAREFFEILESVYSFFSSSLVNHHKFVETQTR 311          
BLAST of DUF4371 domain-containing protein vs. Ensembl Sea Lamprey
Match: pofut2 (protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3595])

HSP 1 Score: 76.2554 bits (186), Expect = 5.163e-15
Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query: 3630 SNTNLH---PGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            S   LH    G VAI+DQWI +H R FIGT  STF+FRI EER+I+GF P +T++ FC D   N       C +PT W V
Sbjct:  228 SQAELHRFLDGGVAIIDQWICAHARYFIGTSVSTFSFRIHEEREILGFDPRSTYNRFCGDAEVN-------CEQPTRWKV 300          
BLAST of DUF4371 domain-containing protein vs. Ensembl Sea Lamprey
Match: pofut2 (protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZDB-GENE-030131-3595])

HSP 1 Score: 76.2554 bits (186), Expect = 7.039e-15
Identity = 40/80 (50.00%), Postives = 49/80 (61.25%), Query Frame = 3
Query: 3630 SNTNLH---PGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            S   LH    G VAI+DQWI +H R FIGT  STF+FRI EER+I+GF P +T++ FC D   N       C +PT W V
Sbjct:  260 SQAELHRFLDGGVAIIDQWICAHARYFIGTSVSTFSFRIHEEREILGFDPRSTYNRFCGDAEVN-------CEQPTRWKV 332          
BLAST of DUF4371 domain-containing protein vs. Ensembl Nematostella
Match: EDO42964 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S065])

HSP 1 Score: 68.9366 bits (167), Expect = 4.418e-12
Identity = 34/70 (48.57%), Postives = 43/70 (61.43%), Query Frame = 3
Query: 3651 GEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPV 3860
            G VAI+DQWI +H R FIGT +STF+FRI EER I+GF    T +  C D+      E   C +PT W +
Sbjct:  323 GGVAIIDQWICAHARFFIGTCESTFSFRIYEERDILGFHGDQTFNCLCGDK------EIGKCEQPTKWRI 386          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000041223.1 (zinc finger MYM-type protein 1 [Source:NCBI gene;Acc:101155882])

HSP 1 Score: 368.622 bits (945), Expect = 9.015e-112
Identity = 187/444 (42.12%), Postives = 283/444 (63.74%), Query Frame = 1
Query:  541 ENPDVSIIKDLLENPFSRRDVATKNKIVKLSRPVPDIF-LSQNVKIKRQQYVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWDEIMDTIFC 1869
            E  +V ++ DL+  PFSRR +  K  IVK  R  P +  LSQ        +VRHFQ + YE++ WLTG     KL+CW CLLF ++     +W   G+ +L    +AAKKH+ T  H+ +++  KTFG  R++L L++        +NEKV +NR ILKRLID V +L KQE +FRG +E+  S NRGNY EL+++I++ +  L  HL T   FSGTS +IQ+D+I++I  ++  EIR EVK  PFV++M++ET+D S+ +QL++ LRYV      ERF+ F+DV+  + A+ +  ++ + +L   C +K++AQ ++GA V +  LN  Q KVK+  P A+F+HC AH L+LVLSQ    +K+CK+FFA ++G+ +FFS S  R  +L+E  +R+ P +  T W  +S +VNT+  +R+ L ELF +I+EN   +DE  D++ C
Sbjct:    4 EGKEVDLVADLISRPFSRRTLQEKLDIVKKGRVTPALTSLSQ----PGGGFVRHFQVTNYERYPWLTGSEVHCKLYCWECLLFALDRH--GVWSHTGFGNLTCLTKAAKKHQNTAGHLQSIVLSKTFGESRVELQLNEHARRETELHNEKVKKNREILKRLIDCVLFLGKQELSFRGRDESGGSSNRGNYCELLSVIAESNTDLHYHLSTNEAFSGTSGKIQDDLISAIDEVIRDEIRREVKNAPFVSVMVEETTDASNAAQLALALRYVTRSGVKERFVRFEDVTSGKRADDIAGLVIKFLLENECLDKVVAQCFEGATVTSSGLNGVQAKVKESAPLALFIHCYAHQLSLVLSQGASKLKECKIFFAHLNGLVAFFSRSPWRTQLLDEICQRRLPGVTPTPWQSTSRVVNTVFEKREALKELFGHILENHSEYDE--DSVRC 439          

HSP 2 Score: 62.003 bits (149), Expect = 1.643e-17
Identity = 29/80 (36.25%), Postives = 52/80 (65.00%), Query Frame = 3
Query: 2004 FDFVKLTNELCVLYRSESYHEMNLAKLIQHILVNDLTDALSEVNKLAHLICTIPFSTASVERSFSALKRVKNYARNTMSQ 2243
            FDF +L  EL V+Y  + ++  + + ++  I  N+L++ + ++ +   L  TIP S ASV+R+FSAL+R++ +A+NT  Q
Sbjct:  588 FDFSQLKTELTVMYTMDDFYGKSPSDILHFIHQNNLSEVMKQLYRFVCLALTIPASPASVKRTFSALERIQTHAKNTTGQ 667          

HSP 3 Score: 35.8094 bits (81), Expect = 1.643e-17
Identity = 17/52 (32.69%), Postives = 27/52 (51.92%), Query Frame = 1
Query: 1849 IMDTIFCQLDIRFKKISSLKFFELLNFSFFKKYQSKFPDECLNSLKNAYANI 2004
            I+D I CQ   RF+    + F  LL+   F +Y+  FP   L+SL  ++  +
Sbjct:  536 ILDNIICQTQTRFQDHEKMMFVTLLDPLRFLEYRRSFPHAGLSSLARSHGAL 587          

HSP 4 Score: 32.3426 bits (72), Expect = 1.643e-17
Identity = 18/45 (40.00%), Postives = 30/45 (66.67%), Query Frame = 2
Query: 2246 RLINLSVITIEKEMLHLLQSKTEFYDHVIDDFVKNTDRRMDFVYK 2380
            RL  L+++ IEK+ L  L+     ++ VI+ F++  +RRMDFV+K
Sbjct:  669 RLSALALMAIEKDFLMELKC-VNLHERVIEQFLRK-ERRMDFVFK 711          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000028133.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948955])

HSP 1 Score: 150.984 bits (380), Expect = 1.355e-36
Identity = 117/413 (28.33%), Postives = 201/413 (48.67%), Query Frame = 1
Query:  643 PDIFLSQNVKIKRQQYVRHFQKSIYEKFK----WLTGCRELNKLFCWPCLLFVVNEKDKNI-WIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF-GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLR-----TATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVN-YGVPVER-----FLFFKDVSGDRSAEALCNVMQETILSW-GCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIE 1827
            PD    +N    R  +  +F+K++    K    WL   +  N LFC+ C LF     +KNI     G ++  H       HE++  H+N +   K   G +R    +D+Q+   +    E+  R R +L RLI +V  LA +  A RGH E + + + GN+L+ V L++++D ++ +HL      TA+  S   + +QN++I  + + ++S I +++K+  + +I+LD T DISH  QLSV++R V+    P  R     FL  ++ +G   A  + N ++E  +S+  C      Q+YD  A M G     Q ++ +  P A+F+ C AH LNLV+  +     D   +F  +  + + FS S +R  +L   +         T W      + +I+  R   + + E +IE
Sbjct:  150 PDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLF----SNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQE---MALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCR----GQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESK---IKSIEPMRYQGAAVREALIE 548          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042294.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:110016639])

HSP 1 Score: 150.984 bits (380), Expect = 1.355e-36
Identity = 117/413 (28.33%), Postives = 201/413 (48.67%), Query Frame = 1
Query:  643 PDIFLSQNVKIKRQQYVRHFQKSIYEKFK----WLTGCRELNKLFCWPCLLFVVNEKDKNI-WIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF-GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLR-----TATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVN-YGVPVER-----FLFFKDVSGDRSAEALCNVMQETILSW-GCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIE 1827
            PD    +N    R  +  +F+K++    K    WL   +  N LFC+ C LF     +KNI     G ++  H       HE++  H+N +   K   G +R    +D+Q+   +    E+  R R +L RLI +V  LA +  A RGH E + + + GN+L+ V L++++D ++ +HL      TA+  S   + +QN++I  + + ++S I +++K+  + +I+LD T DISH  QLSV++R V+    P  R     FL  ++ +G   A  + N ++E  +S+  C      Q+YD  A M G     Q ++ +  P A+F+ C AH LNLV+  +     D   +F  +  + + FS S +R  +L   +         T W      + +I+  R   + + E +IE
Sbjct:  150 PDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLF----SNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQE---MALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCR----GQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESK---IKSIEPMRYQGAAVREALIE 548          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000045044.1 (zinc finger MYM-type protein 1-like [Source:NCBI gene;Acc:111948193])

HSP 1 Score: 150.984 bits (380), Expect = 1.355e-36
Identity = 117/413 (28.33%), Postives = 201/413 (48.67%), Query Frame = 1
Query:  643 PDIFLSQNVKIKRQQYVRHFQKSIYEKFK----WLTGCRELNKLFCWPCLLFVVNEKDKNI-WIKQGYSDLNHFHEAAKKHERTQSHINAVIQLKTF-GTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKYDDLLANHLR-----TATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVN-YGVPVER-----FLFFKDVSGDRSAEALCNVMQETILSW-GCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLAATHWNYSSLLVNTIKSERKGLSELFENIIE 1827
            PD    +N    R  +  +F+K++    K    WL   +  N LFC+ C LF     +KNI     G ++  H       HE++  H+N +   K   G +R    +D+Q+   +    E+  R R +L RLI +V  LA +  A RGH E + + + GN+L+ V L++++D ++ +HL      TA+  S   + +QN++I  + + ++S I +++K+  + +I+LD T DISH  QLSV++R V+    P  R     FL  ++ +G   A  + N ++E  +S+  C      Q+YD  A M G     Q ++ +  P A+F+ C AH LNLV+  +     D   +F  +  + + FS S +R  +L   +         T W      + +I+  R   + + E +IE
Sbjct:  150 PDFVFPRNDSDGRSCHHHYFRKTLVSGEKIARTWLMYSKVKNSLFCFCCKLF----SNKNINLTTSGTANWKHASTYLTAHEKSPEHLNCMKAWKELSGRIRSGKTIDKQE---MALLEEERVRWRAVLTRLIAIVQSLAVRNLALRGHTETLFTSSNGNFLKEVELMARFDPIMKDHLNRVLRGTASHNSYIGHHVQNELIDLLSSKILSAIVDDIKKAKYFSIILDCTLDISHTEQLSVIIRVVSLMEKPQIREHFMGFLEAEESTGQHLASMILNRLEELGISFEDCR----GQSYDNGANMKGKNKGVQARLLEKNPRALFLPCGAHTLNLVVCDAAKRSVDAMSYFGVLQKLYTLFSASAQRWAILKSQVSITLKSWTETRWESK---IKSIEPMRYQGAAVREALIE 548          
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000027735.1 (pep primary_assembly:ASM223467v1:9:30712608:30715295:1 gene:ENSORLG00000030268.1 transcript:ENSORLT00000027735.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.132 bits (370), Expect = 5.669e-36
Identity = 104/346 (30.06%), Postives = 169/346 (48.84%), Query Frame = 1
Query:  694 RHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNI---------WIKQGYSDLNHFHEAAKKHERTQSHINAVI-----QLKTFGTVRIDLMLDQQKASSIVQYNEKVTRNRNILKRLIDVVCYLAKQEEAFRGHNEN-INSFNRGNYLELVTLISKYDDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIMLDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQETILSWGCE--NKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVLNLVLSQSVLFIKDCKLFFATISGIASFFSVS 1680
            R F K  Y   KWL   +  +  FC+ C  F +    +++         W K  + D          H R+++H  A++     +  T GT  +   LD        +Y++ V  NR  +K + + +   A Q  A RGH E+ ++S  +GN+L ++ L++K + ++   +      +   +  QN++I  +  ++ S I  EV E+   +I++DET D+S K Q+S V+RY   G   E FL F + +   +A AL   + E +   G +  N L+ Q YDGA+VM+G     Q ++K   P A +VHC AH LNLVL  SV FI +   FF+ +  +  F S S
Sbjct:  118 RCFSKDWYNAHKWLEYSQSKDSAFCYACRHFGLPASGESVLTSEEGFKNWKKATFKDGGLL-----GHARSEAHTTAMLAWAEYEKSTSGTASLSASLD-------AEYSKLVKENREYIKVVGETLLLTATQNIAQRGHKESEVDS--KGNFLAIMELLAKNNPIVKRKMAGQRNATCLGHDTQNEMIDCLAEMVRSSITGEVAESEAFSILVDETKDMSKKEQMSFVIRYYYNGSVCECFLAF-EAAQRLNAAALSQKIIEILQKHGLDYKNHLVGQAYDGASVMSGKNTGVQARIKSEAPLAFYVHCNAHCLNLVLVDSVKFIPEANCFFSLLQKLYVFVSGS 448          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000028854.1 (SMESG000028854.1)

HSP 1 Score: 224.172 bits (570), Expect = 7.269e-64
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query: 3594 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 3911
            RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL
Sbjct:  315 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 420          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000028854.1 (SMESG000028854.1)

HSP 1 Score: 224.172 bits (570), Expect = 8.258e-64
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query: 3594 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 3911
            RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL
Sbjct:  318 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 423          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000028854.1 (SMESG000028854.1)

HSP 1 Score: 224.172 bits (570), Expect = 1.534e-63
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query: 3594 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 3911
            RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL
Sbjct:  338 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 443          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000028854.1 (SMESG000028854.1)

HSP 1 Score: 223.787 bits (569), Expect = 2.942e-63
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query: 3594 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 3911
            RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL
Sbjct:  361 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 466          
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Match: SMESG000028854.1 (SMESG000028854.1)

HSP 1 Score: 223.787 bits (569), Expect = 3.003e-63
Identity = 106/106 (100.00%), Postives = 106/106 (100.00%), Query Frame = 3
Query: 3594 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 3911
            RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL
Sbjct:  358 RALDFNITILFYSNTNLHPGEVAIVDQWIASHGRAFIGTFQSTFTFRIIEERQIIGFSPSTTHHLFCPDRLKNLNSEEECCSKPTVWPVKWESQFTFHEFSSKSEL 463          
The following BLAST results are available for this feature:
BLAST of DUF4371 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZMYM13.139e-2325.82zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM13.139e-2325.82zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM13.139e-2325.82zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
ZMYM13.139e-2325.82zinc finger MYM-type containing 1 [Source:HGNC Sym... [more]
POFUT21.097e-1351.43protein O-fucosyltransferase 2 [Source:HGNC Symbol... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pad-22.344e-1343.04GDP-fucose protein O-fucosyltransferase 2 [Source... [more]
pad-22.521e-1343.04GDP-fucose protein O-fucosyltransferase 2 [Source... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
O-fut29.221e-1344.74gene:FBgn0027791 transcript:FBtr0070296[more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CR762475.12.823e-4631.60pep chromosome:GRCz11:4:55494751:55498830:1 gene:E... [more]
pofut24.703e-1452.05protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZD... [more]
si:ch211-240b21.24.350e-937.50si:ch211-240b21.2 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
thap12a7.721e-624.69THAP domain containing 12a [Source:ZFIN;Acc:ZDB-GE... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000043220.11.146e-3229.45pep primary_assembly:Xenopus_tropicalis_v9.1:7:364... [more]
slc10a67.727e-2627.54solute carrier family 10 (sodium/bile acid cotrans... [more]
tbx182.993e-2329.10T-box 18 [Source:Xenbase;Acc:XB-GENE-489907][more]
dbnl3.935e-1452.86drebrin like [Source:Xenbase;Acc:XB-GENE-494566][more]
dbnl4.122e-1452.86drebrin like [Source:Xenbase;Acc:XB-GENE-494566][more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zmym12.697e-1925.71zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym12.697e-1925.71zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Zmym11.437e-1725.34zinc finger, MYM domain containing 1 [Source:MGI S... [more]
Pofut26.597e-1450.00protein O-fucosyltransferase 2 [Source:MGI Symbol;... [more]
Zbed57.712e-827.39zinc finger, BED type containing 5 [Source:MGI Sym... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5SVZ6|ZMYM1_HUMAN1.507e-2225.82Zinc finger MYM-type protein 1 OS=Homo sapiens OX=... [more]
sp|Q8VHI3|OFUT2_MOUSE4.615e-1350.00GDP-fucose protein O-fucosyltransferase 2 OS=Mus m... [more]
sp|Q9Y2G5|OFUT2_HUMAN5.270e-1351.43GDP-fucose protein O-fucosyltransferase 2 OS=Homo ... [more]
sp|Q6EV56|OFUT2_PANTR5.861e-1351.43GDP-fucose protein O-fucosyltransferase 2 OS=Pan t... [more]
sp|Q8WR51|OFUT2_CAEEL2.982e-1243.04GDP-fucose protein O-fucosyltransferase 2 OS=Caeno... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2S2NR692.488e-13550.00Zinc finger MYM-type protein 1 OS=Schizaphis grami... [more]
X1WND44.136e-12547.62Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
H3B2042.385e-11947.25DUF4371 domain-containing protein OS=Latimeria cha... [more]
J9K5B17.620e-11842.41Uncharacterized protein OS=Acyrthosiphon pisum OX=... [more]
A0A2J7PVF61.621e-11745.01DUF4371 domain-containing protein (Fragment) OS=Cr... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000034915.18.530e-11844.39pep primary_assembly:Astyanax_mexicanus-2.0:4:2476... [more]
ENSAMXT00000040801.11.138e-4631.57pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000042930.14.309e-4234.58pep primary_assembly:Astyanax_mexicanus-2.0:12:254... [more]
ENSAMXT00000047860.16.414e-4234.30pep primary_assembly:Astyanax_mexicanus-2.0:1:6357... [more]
ENSAMXT00000040045.11.057e-3935.29pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pofut25.163e-1550.00protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZD... [more]
pofut27.039e-1550.00protein O-fucosyltransferase 2 [Source:ZFIN;Acc:ZD... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO429644.418e-1248.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000041223.19.015e-11242.12zinc finger MYM-type protein 1 [Source:NCBI gene;A... [more]
ENSORLT00000028133.11.355e-3628.33zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000042294.11.355e-3628.33zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000045044.11.355e-3628.33zinc finger MYM-type protein 1-like [Source:NCBI g... [more]
ENSORLT00000027735.15.669e-3630.06pep primary_assembly:ASM223467v1:9:30712608:307152... [more]
back to top
BLAST of DUF4371 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000028854.17.269e-64100.00SMESG000028854.1[more]
SMESG000028854.18.258e-64100.00SMESG000028854.1[more]
SMESG000028854.11.534e-63100.00SMESG000028854.1[more]
SMESG000028854.12.942e-63100.00SMESG000028854.1[more]
SMESG000028854.13.003e-63100.00SMESG000028854.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016081 ID=SMED30016081|Name=DUF4371 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3958bp
TTTAAATTTTACCATTCATTGTATCTTACAGAGAAAGAGAATTTATAAAT
TATATCTGTAATTTGTATTACCACATACCTGGTTTTGGTTTGAAAAATAG
TCAAGATTTTTTTCGCAGTATATATGATTTCCAAATGTTAAAGAAAAATT
AATAAATAAATATAATTTAATTCACTGACCGAACAACGAACAAGAAACAG
TTCGTTCTTCGTTCTATTGCGCCAGCGTGCAGTGAAATCCTCTGCACATG
CAATAGACGTTCGGTTTGTTAGCAAGATGCGACGACGCACACACATATAA
TCATACACCACACAACACAATATATCAGTTTTGCTAGTGCTGGTGCCTCT
AGTACTTTTCTCAAGTTTCGCTGGTTTAAATGAAAATAATAACATTAAAA
ATTTTTTTAAAATTATAGTTATTATATCTTGATTGATAAATTGATTTAAT
TTGATACATTTGATACATCATTTCACGTATAAATTTTATTTATTGTATTC
TTTAAATTTAAATTCAAAATAAATAATCCATTATAGAATGGAGAACCCAG
ATGTCTCAATAATTAAAGATTTATTGGAAAATCCATTTTCAAGACGAGAT
GTTGCTACAAAAAACAAAATAGTTAAATTAAGTAGACCGGTGCCTGATAT
TTTTCTATCGCAAAACGTTAAGATTAAAAGACAACAGTATGTGCGGCATT
TTCAAAAATCTATCTATGAAAAATTTAAATGGTTAACCGGTTGTAGGGAA
TTAAATAAGTTGTTCTGTTGGCCATGTTTACTTTTTGTTGTAAATGAAAA
AGATAAGAACATTTGGATAAAACAAGGCTACAGTGATTTAAATCATTTTC
ACGAAGCTGCAAAGAAACATGAAAGGACGCAATCTCACATAAATGCCGTA
ATACAATTAAAAACATTTGGTACTGTCAGGATAGATTTAATGTTAGATCA
ACAAAAGGCTTCGTCGATTGTTCAATACAATGAAAAAGTAACAAGAAATA
GAAATATTCTTAAGAGATTAATAGATGTAGTTTGTTACTTAGCAAAACAA
GAAGAGGCATTTCGTGGACACAATGAGAATATAAATTCCTTTAATCGAGG
AAATTATCTAGAATTAGTAACTTTAATTAGTAAATATGATGACCTTTTAG
CAAATCATCTAAGAACCGCGACTTTATTTTCTGGAACCTCTAATAGAATA
CAAAATGATATTATTGCATCGATTAAAAATATTTTGATTTCCGAAATTAG
AAATGAGGTAAAAGAAACGCCATTCGTTGCTATTATGCTGGATGAAACGT
CTGACATATCTCACAAATCGCAATTATCGGTTGTGCTACGATATGTTAAT
TATGGTGTACCAGTGGAAAGGTTTTTGTTTTTCAAAGATGTTAGTGGTGA
CCGTTCAGCAGAAGCTTTGTGTAATGTTATGCAAGAAACGATTTTGAGTT
GGGGATGTGAGAATAAACTGATTGCTCAAACGTACGATGGAGCGGCAGTC
ATGGCAGGAGCTTTGAATTGGACGCAGAAAAAAGTCAAAGACATTTTTCC
AGAAGCTATGTTCGTGCATTGTTGCGCACATGTACTTAATTTAGTTCTGT
CACAATCTGTATTGTTTATAAAAGATTGTAAATTATTTTTTGCAACAATT
TCTGGCATAGCGTCATTTTTTTCGGTGTCAACAAAAAGAAATCATGTTTT
AAATGAAACTATTAAAAGAAAATTTCCAAAATTAGCTGCAACACATTGGA
ATTATTCATCTCTCTTGGTAAATACCATAAAAAGTGAAAGGAAAGGCCTA
TCGGAATTATTTGAAAATATTATTGAGAATCCAGAAGGCTGGGACGAAAT
AATGGACACTATTTTTTGTCAGTTAGATATTCGTTTTAAAAAAATAAGTT
CGCTCAAATTTTTTGAATTATTGAATTTCAGCTTTTTTAAGAAATATCAA
AGTAAATTTCCGGATGAATGTCTTAATTCGTTAAAGAACGCGTATGCAAA
CATTTCGATTTTGTAAAGCTAACAAATGAATTATGCGTTCTGTATCGTAG
TGAATCATATCATGAAATGAATTTAGCGAAACTTATTCAGCATATACTGG
TAAATGATTTGACAGATGCCCTAAGCGAAGTAAATAAATTGGCGCACTTA
ATTTGTACTATTCCATTTTCAACTGCTTCAGTGGAGAGATCATTTTCAGC
ATTGAAAAGAGTAAAAAATTATGCACGGAATACAATGAGCCAGATAGATT
AATCAATTTATCTGTAATAACAATAGAAAAAGAAATGTTACACTTATTAC
AATCAAAAACAGAGTTTTATGATCATGTAATTGATGATTTTGTTAAAAAT
ACAGATAGGCGTATGGATTTTGTGTACAAATAAAAAATTTATAGTAAAAA
CGTTTTTAATGTATATTTTTATGGTTTTATTATTATGCTTACTATTATCG
TTGCTCTCTGCACACCCTGCATGGAAACCCACCGCACGCCACTGCTTTCT
AGAATCATTTGATGAAGTACTTTCAAGATTTTCTACATCCGAATTTTCTA
CATAGACAACTGCTAACATACGGCTTAACTTCAAATGTGGTCATTTTTAT
ATTGAATTTTATATATGTAAATTAAAATTTCAAAAGTTAATTTTAAAACA
ACAACAGCAGTTTATATACTGTTCAAACAAAGAAATAAATGTATCTCAAA
AAATATAAATCACATTTCAAATTTATATTTTATTAATTTACTAATTCAAA
TATTAAATTAACATCTCATTTAATAAATTTATTTTTAATTCGATAAATTT
ATTAATTTTACTTTTGCACCCTATCAATTTTTGCGTTTCCTAATTTCCTT
CTGTCAGCCGGAATTGAACTTTAATAATAATACATCTTATAAAATTAAGG
CATTTAAATAATATTTATTGAAATATTCTATTAAAATACTAAGATATCAG
AGTTTTTATAGATTATTATAGATGCTAGTCACGTAAAATTATAGCACCGT
CTTCCGTCGAAAACAACGTCTGGGCATGTATCAGAGATAAATAAAATAGA
ATGATTTAGAAAAAATCAATTCTAAATTATCGAGTTTAATGCCTATTTGA
ATATAACTCAAAGGTGTTATATTCGAGATTTTCGGTATGGAATTAAAATA
TTAAATTTCATTATTCAATAATAACATTTACAAATCATTGAAATTGAAAT
TTCATGCCAACAAATTTAATTTAAATTTAAATGACATTTTTAAATTAAAA
AATTTAAAATCCTAAATCTGATGATATACTTGTCTTATTTTTTAATTTGT
TTTTAAGCATCCTTCTTTGCTTTCAAAGTACATAAATATAAATGCCCATT
TTTCCAAAATAATTAAAAATCATCGTGAGTGAGTTATTTGAATATAACGT
TATTTATGGGGAAGATTGTAGTAAAAACCAAAATATTTACCAAATTTAGC
GGCGCATTAACAAACATTTTGCGGTATTAATGTTAAGTAGAAATGTTCTA
AAATCTATCTAGACATTCAAGCATTTTTATGAATACTGAAATGATTTTAC
TGAATTTGAAATTAGTCTTAAAAAAAAGGAAATTATTAAATTAAGAGCTT
TAGATTTTAATATAACAATTTTGTTTTATTCCAATACTAATCTTCACCCC
GGAGAAGTAGCTATCGTTGACCAATGGATTGCATCACATGGACGAGCGTT
TATTGGAACTTTTCAAAGTACTTTTACGTTCAGAATAATTGAAGAAAGAC
AAATAATTGGTTTTTCACCATCTACAACTCATCATTTGTTTTGTCCCGAT
AGGTTAAAAAATTTGAATTCCGAAGAGGAATGTTGTTCAAAACCAACAGT
ATGGCCTGTGAAATGGGAATCTCAATTTACATTTCATGAATTTAGTTCTA
AATCTGAATTATAAATACACTTGCTTTTTAAATGTATTTTAAATTGATAA
TAAAACTG
back to top

protein sequence of SMED30016081-orf-1

>SMED30016081-orf-1 ID=SMED30016081-orf-1|Name=SMED30016081-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=493bp
MENPDVSIIKDLLENPFSRRDVATKNKIVKLSRPVPDIFLSQNVKIKRQQ
YVRHFQKSIYEKFKWLTGCRELNKLFCWPCLLFVVNEKDKNIWIKQGYSD
LNHFHEAAKKHERTQSHINAVIQLKTFGTVRIDLMLDQQKASSIVQYNEK
VTRNRNILKRLIDVVCYLAKQEEAFRGHNENINSFNRGNYLELVTLISKY
DDLLANHLRTATLFSGTSNRIQNDIIASIKNILISEIRNEVKETPFVAIM
LDETSDISHKSQLSVVLRYVNYGVPVERFLFFKDVSGDRSAEALCNVMQE
TILSWGCENKLIAQTYDGAAVMAGALNWTQKKVKDIFPEAMFVHCCAHVL
NLVLSQSVLFIKDCKLFFATISGIASFFSVSTKRNHVLNETIKRKFPKLA
ATHWNYSSLLVNTIKSERKGLSELFENIIENPEGWDEIMDTIFCQLDIRF
KKISSLKFFELLNFSFFKKYQSKFPDECLNSLKNAYANISIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000070intestinal phagocyte
PLANA:0000074oocyte
PLANA:0000231vitelline gland
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR025398DUF4371
IPR012337RNaseH-like_sf
IPR008906HATC_C_dom
IPR019378GDP-Fuc_O-FucTrfase
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046983protein dimerization activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025398Domain of unknown function DUF4371PFAMPF14291DUF4371coord: 106..327
e-value: 1.5E-30
score: 106.6
NoneNo IPR availablePANTHERPTHR45749FAMILY NOT NAMEDcoord: 42..428
IPR012337Ribonuclease H-like superfamilySUPERFAMILYSSF53098Ribonuclease H-likecoord: 241..472