Deoxyhypusine hydroxylase

Overview
NameDeoxyhypusine hydroxylase
Smed IDSMED30016080
Length (bp)1139
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Deoxyhypusine hydroxylase (SMED30016080) t-SNE clustered cells

Violin plots show distribution of expression levels for Deoxyhypusine hydroxylase (SMED30016080) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Deoxyhypusine hydroxylase (SMED30016080) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Deoxyhypusine hydroxylase (SMED30016080) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016080

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neoblastSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig24170newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig24170uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig42436newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig42436uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig22083newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig22083uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig22120newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016080SMESG000051726.1 SMESG000051721.1 Contig22120uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016080SMESG000051726.1 SMESG000051721.1 OX_Smed_1.0.22862ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
musculature systemSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx musculatureSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
glial cellSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v6_703_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
anterior pole progenitor cellSMED30016080SMESG000051726.1 SMESG000051721.1 SMED30016080smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016080SMESG000051726.1 SMESG000051721.1 dd_Smed_v4_703_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Human
Match: DOHH (deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:HGNC:28662])

HSP 1 Score: 224.942 bits (572), Expect = 1.436e-70
Identity = 124/295 (42.03%), Postives = 176/295 (59.66%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            TE ++ A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI +L D+L + ++ P+VRHEAGE L AIG  + L+ILK++S D   E+AETC L  +R+E+ Q H        + S+DPAP  E  E+ V  L E LL+    +F+RYRA+F LR   ++ G +A  AL    + L C  SALFRH+V +V+GQ+ ++ ++  L  A+    E  MVRHE  EALGAI    C   L  + +D E+VV+E+C VAL + ++     F
Sbjct:    3 TEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAE--ERDVGRLREALLDESRPLFERYRAMFALR---NAGGEEAALALA---EGLHC-GSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAF 288          

HSP 2 Score: 90.1225 bits (222), Expect = 1.013e-19
Identity = 50/132 (37.88%), Postives = 79/132 (59.85%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            + E+ V  + + L++PK  +  R+RALFTLR      G     A+  I +A     SAL +H++A+ +GQ+ +  +I +L + + +  +  MVRHE+GEALGAIGD +  EIL +Y +D    V ETC +A+
Sbjct:    2 VTEQEVDAIGQTLVDPKQPLQARFRALFTLR------GLGGPGAIAWISQAFD-DDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAV 126          

HSP 3 Score: 78.5666 bits (192), Expect = 1.113e-15
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETC 445
            A E D+    E L D S+PL ERY+A+  LR++  + A   + +     S L +H++ Y LGQ+ +E A+  L   L    E P+VRHE  E L AI     L  L+ H+ D  + + E+C
Sbjct:  153 AEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESC 273          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Human
Match: DOHH (deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:HGNC:28662])

HSP 1 Score: 224.942 bits (572), Expect = 1.436e-70
Identity = 124/295 (42.03%), Postives = 176/295 (59.66%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            TE ++ A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI +L D+L + ++ P+VRHEAGE L AIG  + L+ILK++S D   E+AETC L  +R+E+ Q H        + S+DPAP  E  E+ V  L E LL+    +F+RYRA+F LR   ++ G +A  AL    + L C  SALFRH+V +V+GQ+ ++ ++  L  A+    E  MVRHE  EALGAI    C   L  + +D E+VV+E+C VAL + ++     F
Sbjct:    3 TEQEVDAIGQTLVDPKQPLQARFRALFTLRGLGGPGAIAWISQAFDDDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAE--ERDVGRLREALLDESRPLFERYRAMFALR---NAGGEEAALALA---EGLHC-GSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESCEVALDMYEHETGRAF 288          

HSP 2 Score: 90.1225 bits (222), Expect = 1.013e-19
Identity = 50/132 (37.88%), Postives = 79/132 (59.85%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            + E+ V  + + L++PK  +  R+RALFTLR      G     A+  I +A     SAL +H++A+ +GQ+ +  +I +L + + +  +  MVRHE+GEALGAIGD +  EIL +Y +D    V ETC +A+
Sbjct:    2 VTEQEVDAIGQTLVDPKQPLQARFRALFTLR------GLGGPGAIAWISQAFD-DDSALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAV 126          

HSP 3 Score: 78.5666 bits (192), Expect = 1.113e-15
Identity = 43/121 (35.54%), Postives = 64/121 (52.89%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETC 445
            A E D+    E L D S+PL ERY+A+  LR++  + A   + +     S L +H++ Y LGQ+ +E A+  L   L    E P+VRHE  E L AI     L  L+ H+ D  + + E+C
Sbjct:  153 AEERDVGRLREALLDESRPLFERYRAMFALRNAGGEEAALALAEGLHCGSALFRHEVGYVLGQLQHEAAVPQLAAALARCTENPMVRHECAEALGAIARPACLAALQAHADDPERVVRESC 273          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Human
Match: DOHH (deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:HGNC:28662])

HSP 1 Score: 134.035 bits (336), Expect = 6.753e-37
Identity = 69/150 (46.00%), Postives = 95/150 (63.33%), Query Frame = 2
Query:  230 SDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALT 679
            S LLKH+LAY LGQM +  AI +L D+L + ++ P+VRHEAGE L AIG  + L+ILK++S D   E+AETC L  +R+E+ Q H        + S+DPAP  E  E+ V  L E LL+    +F+RYRA+F LR   ++ G +A  AL 
Sbjct:    3 SALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAVRRLEWLQQHGGEPAAGPYLSVDPAPPAE--ERDVGRLREALLDESRPLFERYRAMFALR---NAGGEEAALALA 147          

HSP 2 Score: 68.9366 bits (167), Expect = 4.139e-13
Identity = 33/76 (43.42%), Postives = 52/76 (68.42%), Query Frame = 2
Query:  710 SALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            SAL +H++A+ +GQ+ +  +I +L + + +  +  MVRHE+GEALGAIGD +  EIL +Y +D    V ETC +A+
Sbjct:    3 SALLKHELAYCLGQMQDARAIPMLVDVLQDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSSDPVIEVAETCQLAV 78          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Celegans
Match: dohh-1 (Deoxyhypusine hydroxylase [Source:UniProtKB/Swiss-Prot;Acc:Q17949])

HSP 1 Score: 241.891 bits (616), Expect = 9.708e-78
Identity = 124/296 (41.89%), Postives = 191/296 (64.53%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQ-SHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ++ ++ ++GE LND  KPL  R++AL  LR+   D ++D I KC + +S LLKH+LAY LGQM N+HAI  L  +L++EK+ P+VRHEAGE L AI      D+L+K+++D   E++ETC +   R+E+ + S K    P  + S+DP P    ++  V +L+  L++    +FDRYRA+F+LR +   K      ++ A+ + L C  SALFRH+VA+V+GQ+ +  +   L++ +    E  MVRHE  EALGAI + +C EIL +Y+ND+E+VV+E+C VAL +A+Y  S+  
Sbjct:    8 SDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVDWIGKCLNDESALLKHELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPCPEVSETCQIALGRVEWVEKSGKDTNSP--YDSVDPTPSASTSD--VEELAATLIDASLPLFDRYRAMFSLRNIKTDK------SIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENSDDL 293          

HSP 2 Score: 90.1225 bits (222), Expect = 2.882e-20
Identity = 51/137 (37.23%), Postives = 75/137 (54.74%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
             ++  +    E L + K  +  R+RALF LR +   +  D       IGK L    SAL +H++A+ +GQ+ NK +I  L   + +  +  MVRHE+GEALGAI D   K++L KY  D    V ETC +ALG  ++
Sbjct:    7 FSDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVD------WIGKCLN-DESALLKHELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPCPEVSETCQIALGRVEW 136          

HSP 3 Score: 79.337 bits (194), Expect = 1.803e-16
Identity = 45/135 (33.33%), Postives = 75/135 (55.56%), Query Frame = 2
Query:   80 AATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITK-CFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQS 481
            +A+  D++     L D S PL +RY+A+  LR+ K+D +I  + +  +   S L +H++AY LGQ+ +  A + LKD L    E  +VRHE  E L AI + +  +ILK++  D  + + E+C +     E+  S
Sbjct:  156 SASTSDVEELAATLIDASLPLFDRYRAMFSLRNIKTDKSIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENS 290          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Fly
Match: nero (gene:FBgn0261479 transcript:FBtr0085863)

HSP 1 Score: 234.187 bits (596), Expect = 1.512e-74
Identity = 124/295 (42.03%), Postives = 185/295 (62.71%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ++  ++A G VLN+  +PL ER++AL  L++     AI+ I+K F   S LLKH+LAY LGQM +  A+ +L  +L +  + P+VRHEA E + AIGH D L IL+++ +D   E+AETC +   R+ + QS +     N + S+DP+P     +KSV +L  + L+ +  +FDRYRA+F+LR +   +      ++ AI + LK  SSALFRH+VAFV+GQ+    SI  L+E + +  E  MVRHE  EALGAI    C +IL++Y  D ++VVKE+CV+AL + +Y  S  F
Sbjct:    3 SQQQIEAIGGVLNNKERPLKERFRALFTLKNIGGGAAIEAISKAFDDDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIALDRVRWLQSGQKVDDSNPYASVDPSPP-TAGDKSVTELKAIYLDAQQSLFDRYRAMFSLRNLRTEE------SVLAIAEGLK-DSSALFRHEVAFVLGQLQEPCSIPFLQENLEDRLENEMVRHECAEALGAIATEDCIQILNRYAEDDKRVVKESCVIALDMCEYENSPEF 289          

HSP 2 Score: 83.5741 bits (205), Expect = 8.487e-18
Identity = 45/132 (34.09%), Postives = 78/132 (59.09%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            ++++ +  +  +L N +  + +R+RALFTL+ +        GAA+ AI KA     SAL +H++A+ +GQ+ + +++ +L + + +  +  MVRHE+ EA+GAIG      IL +Y  D    V ETC +AL
Sbjct:    2 VSQQQIEAIGGVLNNKERPLKERFRALFTLKNIG------GGAAIEAISKAFD-DDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIAL 126          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Zebrafish
Match: dohh (deoxyhypusine hydroxylase/monooxygenase [Source:NCBI gene;Acc:321732])

HSP 1 Score: 234.958 bits (598), Expect = 1.269e-74
Identity = 128/300 (42.67%), Postives = 185/300 (61.67%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFF----QSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            A + D+ A G +L +  + L  R++AL  LR+     A+  I++ F  +S LLKH+LAY LGQM +E AI  L+ +L +  + P+VRHEAGE L AIG+   L++LKK+++D   E+AETC L  KR+E+     +  K     N + S+DPAP  +   KSV +L   LL+    +FDRYRA+F LR +   +      A+ A+G  L+C SSALFRH++ +V+GQI +  SI  L+ A+  + E  MVRHE  EALG+IG   C +IL +Y  D+E+VVKE+C VAL + +Y  S  F
Sbjct:    2 ANDKDIAAVGSILVNTKQDLTTRFRALFTLRNLGGAEAVKWISEAFVDESALLKHELAYCLGQMQDESAIPTLEAVLKDTNQEPMVRHEAGEALGAIGNPKVLELLKKYAEDPVIEVAETCQLAVKRLEWLMNGGEQTKDGTDENPYCSVDPAPPAQ--RKSVPELRTQLLDETLPLFDRYRAMFALRNLGTEE------AVLALGDGLQC-SSALFRHEIGYVLGQIQHAASIPQLQAALEKMDENAMVRHECAEALGSIGKEPCVQILERYRKDQERVVKESCEVALDMLEYENSSQF 292          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Zebrafish
Match: dohh (deoxyhypusine hydroxylase/monooxygenase [Source:NCBI gene;Acc:321732])

HSP 1 Score: 234.958 bits (598), Expect = 1.269e-74
Identity = 128/300 (42.67%), Postives = 185/300 (61.67%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFF----QSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            A + D+ A G +L +  + L  R++AL  LR+     A+  I++ F  +S LLKH+LAY LGQM +E AI  L+ +L +  + P+VRHEAGE L AIG+   L++LKK+++D   E+AETC L  KR+E+     +  K     N + S+DPAP  +   KSV +L   LL+    +FDRYRA+F LR +   +      A+ A+G  L+C SSALFRH++ +V+GQI +  SI  L+ A+  + E  MVRHE  EALG+IG   C +IL +Y  D+E+VVKE+C VAL + +Y  S  F
Sbjct:    2 ANDKDIAAVGSILVNTKQDLTTRFRALFTLRNLGGAEAVKWISEAFVDESALLKHELAYCLGQMQDESAIPTLEAVLKDTNQEPMVRHEAGEALGAIGNPKVLELLKKYAEDPVIEVAETCQLAVKRLEWLMNGGEQTKDGTDENPYCSVDPAPPAQ--RKSVPELRTQLLDETLPLFDRYRAMFALRNLGTEE------AVLALGDGLQC-SSALFRHEIGYVLGQIQHAASIPQLQAALEKMDENAMVRHECAEALGSIGKEPCVQILERYRKDQERVVKESCEVALDMLEYENSSQF 292          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Xenopus
Match: plk3 (polo-like kinase 3 [Source:Xenbase;Acc:XB-GENE-5860546])

HSP 1 Score: 208.379 bits (529), Expect = 7.100e-64
Identity = 125/339 (36.87%), Postives = 183/339 (53.98%), Query Frame = 2
Query:   80 AATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGA-----------------------------ALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF*ILGLICTFCGFI 1009
            AA+   +++ G +L D  +PL  R++AL  LR+     AID I + F  +S LLKH+LAY LGQM +  A+ VL ++L + ++  +VRHEAGE L AIG  + L++LK++S+D   E+AETC L   RIE+ Q +      N + S+DPAP     EK +  L   LL+    +FDRYRA+F LR +   +   A A                             A+ A+   L+  S +LFRH++ +V+GQ+ +K +I  L  A+    E  MVRHE  EALG+I    C + L  ++ D EQVV+E+C VAL + +Y  S  F     +   CG I
Sbjct:    2 AASLSTVQSLGRLLIDSGQPLPLRFRALFTLRNLGGAEAIDYIGRGFQDESALLKHELAYCLGQMKDRRALPVLMEVLQDRQQEAMVRHEAGEALGAIGDPEVLELLKEYSRDPVIEVAETCQLAVCRIEWLQKNSDAPDSNPYLSVDPAP--PAKEKDIPKLRATLLDETCTLFDRYRAMFALRNIGGEEAVLALADGMPFLNLFPDFSLNLGDMFALRNIGGEEAVLALADGLQI-SGSLFRHEIGYVLGQMQHKAAIPGLSAALERFEENPMVRHECAEALGSIAHEDCLKALRAHVGDGEQVVRESCEVALDMYEYENSGDFQYANGLSQICGQI 337          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Match: Dohh (deoxyhypusine hydroxylase/monooxygenase [Source:MGI Symbol;Acc:MGI:1915964])

HSP 1 Score: 226.868 bits (577), Expect = 1.578e-71
Identity = 126/296 (42.57%), Postives = 177/296 (59.80%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVP-PNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            TE +++A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI VL D+L +  + P+VRHEAGE L AIG+ + L +LK++S D   E+AETC L   R+E+ Q H         + S+DPAP     E+ V  L E LL+    +F+RYRA+F LR V    G +A  AL    + L+C  SALFRH+V +V+GQ+ ++ ++  L   +    E  MVRHE  EALGAI    C   L +++ D EQVV+E+C VAL + +Y +S+ F
Sbjct:    3 TEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEATCAGPYLSVDPAP--PAAEQDVGRLREALLDEARPLFERYRAMFALRNVG---GKEAALALA---EGLQC-GSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQVVRESCEVALDMYEYESSQDF 289          

HSP 2 Score: 89.7373 bits (221), Expect = 1.007e-19
Identity = 49/137 (35.77%), Postives = 84/137 (61.31%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
            + E+ +  + + L++PK  +  R+RALFTLR +    G D   A++ I +  +  SSAL +H++A+ +GQ+ +  +I VL + + +  +  MVRHE+GEALGAIG+ +   +L +Y  D    V ETC +A+G  ++
Sbjct:    2 VTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLG---GPD---AISWISRGFE-DSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEW 131          

HSP 3 Score: 80.8777 bits (198), Expect = 1.238e-16
Identity = 44/134 (32.84%), Postives = 68/134 (50.75%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSH 484
            A E D+    E L D ++PL ERY+A+  LR+     A   + +     S L +H++ Y LGQ+ +E A+  L   L    E+P+VRHE  E L AI     L  L++H +D  + + E+C +     E+  S 
Sbjct:  154 AAEQDVGRLREALLDEARPLFERYRAMFALRNVGGKEAALALAEGLQCGSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQVVRESCEVALDMYEYESSQ 287          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Match: Gm48551 (predicted gene, 48551 [Source:MGI Symbol;Acc:MGI:6098103])

HSP 1 Score: 154.451 bits (389), Expect = 6.140e-45
Identity = 86/198 (43.43%), Postives = 117/198 (59.09%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVP-PNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAAL 676
            TE +++A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI VL D+L +  + P+VRHEAGE L AIG+ + L +LK++S D   E+AETC L   R+E+ Q H         + S+DPAP     E+ V  L E LL+    +F+RYRA+F LR V    G +A  AL
Sbjct:    3 TEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEATCAGPYLSVDPAP--PAAEQDVGRLREALLDEARPLFERYRAMFALRNVG---GKEAALAL 195          

HSP 2 Score: 89.3521 bits (220), Expect = 1.729e-20
Identity = 49/137 (35.77%), Postives = 84/137 (61.31%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
            + E+ +  + + L++PK  +  R+RALFTLR +    G DA   ++ I +  +  SSAL +H++A+ +GQ+ +  +I VL + + +  +  MVRHE+GEALGAIG+ +   +L +Y  D    V ETC +A+G  ++
Sbjct:    2 VTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLG---GPDA---ISWISRGFE-DSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEW 131          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Match: Dohh (deoxyhypusine hydroxylase/monooxygenase [Source:MGI Symbol;Acc:MGI:1915964])

HSP 1 Score: 153.68 bits (387), Expect = 1.030e-44
Identity = 82/186 (44.09%), Postives = 112/186 (60.22%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVP-PNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRV 640
            TE +++A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI VL D+L +  + P+VRHEAGE L AIG+ + L +LK++S D   E+AETC L   R+E+ Q H         + S+DPAP     E+ V  L E LL+    +F+RYRA+F LR V
Sbjct:    3 TEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEATCAGPYLSVDPAP--PAAEQDVGRLREALLDEARPLFERYRAMFALRNV 186          

HSP 2 Score: 89.7373 bits (221), Expect = 1.175e-20
Identity = 49/137 (35.77%), Postives = 84/137 (61.31%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
            + E+ +  + + L++PK  +  R+RALFTLR +    G DA   ++ I +  +  SSAL +H++A+ +GQ+ +  +I VL + + +  +  MVRHE+GEALGAIG+ +   +L +Y  D    V ETC +A+G  ++
Sbjct:    2 VTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLG---GPDA---ISWISRGFE-DSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEW 131          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Match: Dohh (deoxyhypusine hydroxylase/monooxygenase [Source:MGI Symbol;Acc:MGI:1915964])

HSP 1 Score: 153.68 bits (387), Expect = 1.933e-44
Identity = 82/186 (44.09%), Postives = 112/186 (60.22%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVP-PNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRV 640
            TE +++A G+ L D  +PL  R++AL  LR      AI  I++ F   S LLKH+LAY LGQM +  AI VL D+L +  + P+VRHEAGE L AIG+ + L +LK++S D   E+AETC L   R+E+ Q H         + S+DPAP     E+ V  L E LL+    +F+RYRA+F LR V
Sbjct:    3 TEQEIEAIGKTLVDPKQPLQARFRALFTLRGLGGPDAISWISRGFEDSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEWLQQHPGEATCAGPYLSVDPAP--PAAEQDVGRLREALLDEARPLFERYRAMFALRNV 186          

HSP 2 Score: 89.7373 bits (221), Expect = 1.666e-20
Identity = 49/137 (35.77%), Postives = 84/137 (61.31%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
            + E+ +  + + L++PK  +  R+RALFTLR +    G DA   ++ I +  +  SSAL +H++A+ +GQ+ +  +I VL + + +  +  MVRHE+GEALGAIG+ +   +L +Y  D    V ETC +A+G  ++
Sbjct:    2 VTEQEIEAIGKTLVDPKQPLQARFRALFTLRGLG---GPDA---ISWISRGFE-DSSALLKHELAYCLGQMRDARAIPVLADVLQDTSQEPMVRHEAGEALGAIGNPEVLGLLKQYSTDPVVEVAETCQLAVGRLEW 131          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Match: Gm48551 (predicted gene, 48551 [Source:MGI Symbol;Acc:MGI:6098103])

HSP 1 Score: 95.5153 bits (236), Expect = 1.892e-22
Identity = 58/154 (37.66%), Postives = 82/154 (53.25%), Query Frame = 2
Query:  509 FHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            + S+DPAP     E+ V  L E LL+    +F+RYRA+F LR V    G +A  AL    + L+C  SALFRH+V +V+GQ+ ++ ++  L   +    E  MVRHE  EALGAI    C   L +++ D EQ   E      G  D   +E +
Sbjct:    3 YLSVDPAPP--AAEQDVGRLREALLDEARPLFERYRAMFALRNVG---GKEAALALA---EGLQC-GSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQAPAEGVSAMAGSVDEKEAEDW 147          

HSP 2 Score: 75.0998 bits (183), Expect = 3.322e-15
Identity = 42/119 (35.29%), Postives = 62/119 (52.10%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAE 439
            A E D+    E L D ++PL ERY+A+  LR+     A   + +     S L +H++ Y LGQ+ +E A+  L   L    E+P+VRHE  E L AI     L  L++H +D  +  AE
Sbjct:   12 AAEQDVGRLREALLDEARPLFERYRAMFALRNVGGKEAALALAEGLQCGSALFRHEVGYVLGQLQHEAAVPGLAATLARTTESPMVRHECAEALGAIARPACLAALREHIEDPEQAPAE 130          
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Match: sp|Q17949|DOHH_CAEEL (Deoxyhypusine hydroxylase OS=Caenorhabditis elegans OX=6239 GN=dohh-1 PE=3 SV=1)

HSP 1 Score: 241.891 bits (616), Expect = 1.235e-76
Identity = 124/296 (41.89%), Postives = 191/296 (64.53%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQ-SHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ++ ++ ++GE LND  KPL  R++AL  LR+   D ++D I KC + +S LLKH+LAY LGQM N+HAI  L  +L++EK+ P+VRHEAGE L AI      D+L+K+++D   E++ETC +   R+E+ + S K    P  + S+DP P    ++  V +L+  L++    +FDRYRA+F+LR +   K      ++ A+ + L C  SALFRH+VA+V+GQ+ +  +   L++ +    E  MVRHE  EALGAI + +C EIL +Y+ND+E+VV+E+C VAL +A+Y  S+  
Sbjct:    8 SDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVDWIGKCLNDESALLKHELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPCPEVSETCQIALGRVEWVEKSGKDTNSP--YDSVDPTPSASTSD--VEELAATLIDASLPLFDRYRAMFSLRNIKTDK------SIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENSDDL 293          

HSP 2 Score: 90.1225 bits (222), Expect = 3.666e-19
Identity = 51/137 (37.23%), Postives = 75/137 (54.74%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
             ++  +    E L + K  +  R+RALF LR +   +  D       IGK L    SAL +H++A+ +GQ+ NK +I  L   + +  +  MVRHE+GEALGAI D   K++L KY  D    V ETC +ALG  ++
Sbjct:    7 FSDAEIDSFGEALNDTKKPLKARFRALFILRNIGCDRSVD------WIGKCLN-DESALLKHELAYCLGQMQNKHAIPTLVSVLEDEKQEPMVRHEAGEALGAIADPSVKDVLRKYAQDPCPEVSETCQIALGRVEW 136          

HSP 3 Score: 79.337 bits (194), Expect = 2.293e-15
Identity = 45/135 (33.33%), Postives = 75/135 (55.56%), Query Frame = 2
Query:   80 AATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITK-CFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQS 481
            +A+  D++     L D S PL +RY+A+  LR+ K+D +I  + +  +   S L +H++AY LGQ+ +  A + LKD L    E  +VRHE  E L AI + +  +ILK++  D  + + E+C +     E+  S
Sbjct:  156 SASTSDVEELAATLIDASLPLFDRYRAMFSLRNIKTDKSIKALAQGLYCEDSALFRHEVAYVLGQLQSPVATQELKDRLLLSTENCMVRHECAEALGAIANEECTEILKQYVNDEERVVRESCEVALDMAEYENS 290          
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Match: sp|Q297S2|DOHH_DROPS (Deoxyhypusine hydroxylase OS=Drosophila pseudoobscura pseudoobscura OX=46245 GN=nero PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 3.989e-76
Identity = 128/295 (43.39%), Postives = 188/295 (63.73%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ++  ++A G VLN+  +PL ER++AL  L++     AID I+K F   S LLKH+LAY LGQM +  A+++L  +L +  + P+VRHEA E + AIGHAD L IL+++ KD   E+AETC +   R+ + QS +     N + S+DP+P     +KSV +L  + L+ K  +FDRYRA+F+LR +   +      ++ AI + LK  SSALFRH+VAFV+GQ+    SI  L+E + +  E  MVRHE  EALGAI    C +IL +Y +D+++VVKE+CV+AL + +Y  S  F
Sbjct:    3 SQEQIEAIGGVLNNKDRPLKERFRALFTLKNIGGKTAIDAISKAFDDDSALLKHELAYCLGQMQDPTALEILTKVLKDTTQEPMVRHEAAEAMGAIGHADVLAILEEYKKDPVVEVAETCAIALDRVRWLQSGQQVADNNPYASVDPSPP-TAGDKSVAELKAIYLDAKQTLFDRYRAMFSLRNLCTEE------SVLAIAEGLK-DSSALFRHEVAFVLGQLQEPCSIPYLQENLEDHKENEMVRHECAEALGAIATDDCIQILTRYADDEKRVVKESCVIALDMCEYENSPEF 289          

HSP 2 Score: 78.9518 bits (193), Expect = 3.387e-15
Identity = 44/132 (33.33%), Postives = 75/132 (56.82%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            ++++ +  +  +L N    + +R+RALFTL+ +          A+ AI KA     SAL +H++A+ +GQ+ +  ++ +L + + +  +  MVRHE+ EA+GAIG A    IL +Y  D    V ETC +AL
Sbjct:    2 VSQEQIEAIGGVLNNKDRPLKERFRALFTLKNIG------GKTAIDAISKAFD-DDSALLKHELAYCLGQMQDPTALEILTKVLKDTTQEPMVRHEAAEAMGAIGHADVLAILEEYKKDPVVEVAETCAIAL 126          
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Match: sp|Q7ZUX6|DOHH_DANRE (Deoxyhypusine hydroxylase OS=Danio rerio OX=7955 GN=dohh PE=2 SV=1)

HSP 1 Score: 235.343 bits (599), Expect = 5.348e-74
Identity = 128/300 (42.67%), Postives = 186/300 (62.00%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFF----QSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            A + D+ A G +L +  + L  R++AL  LR+     A+  I++ F  +S LLKH+LAY LGQM +E AI  L+ +L +  + P+VRHEAGE L AIG+   L++LKK+++D   E+AETC L  KR+E+     +  K     N + S+DPAP  +   KSV +L   LL+    +FDRYRA+F LR +   +      A+ A+G  L+C SSALFRH++ +V+GQI ++ SI  L+ A+  + E  MVRHE  EALG+IG   C +IL +Y  D+E+VVKE+C VAL + +Y  S  F
Sbjct:    2 ANDKDIAAVGSILVNTKQDLTTRFRALFTLRNLGGAEAVKWISEAFVDESALLKHELAYCLGQMQDESAIPTLEAVLKDTNQEPMVRHEAGEALGAIGNPKVLELLKKYAEDPVIEVAETCQLAVKRLEWLMNGGEQTKDGTDENPYCSVDPAPPAQ--RKSVPELRTQLLDETLPLFDRYRAMFALRNLGTEE------AVLALGDGLQC-SSALFRHEIGYVLGQIQHEASIPQLQAALEKMDENAMVRHECAEALGSIGKEPCVQILERYRKDQERVVKESCEVALDMLEYENSSQF 292          
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Match: sp|Q9V9U4|DOHH_DROME (Deoxyhypusine hydroxylase OS=Drosophila melanogaster OX=7227 GN=nero PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.515e-73
Identity = 124/295 (42.03%), Postives = 185/295 (62.71%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ++  ++A G VLN+  +PL ER++AL  L++     AI+ I+K F   S LLKH+LAY LGQM +  A+ +L  +L +  + P+VRHEA E + AIGH D L IL+++ +D   E+AETC +   R+ + QS +     N + S+DP+P     +KSV +L  + L+ +  +FDRYRA+F+LR +   +      ++ AI + LK  SSALFRH+VAFV+GQ+    SI  L+E + +  E  MVRHE  EALGAI    C +IL++Y  D ++VVKE+CV+AL + +Y  S  F
Sbjct:    3 SQQQIEAIGGVLNNKERPLKERFRALFTLKNIGGGAAIEAISKAFDDDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIALDRVRWLQSGQKVDDSNPYASVDPSPP-TAGDKSVTELKAIYLDAQQSLFDRYRAMFSLRNLRTEE------SVLAIAEGLK-DSSALFRHEVAFVLGQLQEPCSIPFLQENLEDRLENEMVRHECAEALGAIATEDCIQILNRYAEDDKRVVKESCVIALDMCEYENSPEF 289          

HSP 2 Score: 83.5741 bits (205), Expect = 8.508e-17
Identity = 45/132 (34.09%), Postives = 78/132 (59.09%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            ++++ +  +  +L N +  + +R+RALFTL+ +        GAA+ AI KA     SAL +H++A+ +GQ+ + +++ +L + + +  +  MVRHE+ EA+GAIG      IL +Y  D    V ETC +AL
Sbjct:    2 VSQQQIEAIGGVLNNKERPLKERFRALFTLKNIG------GGAAIEAISKAFD-DDSALLKHELAYCLGQMQDAQALDILTKVLKDTTQEPMVRHEAAEAMGAIGHPDVLPILEEYKQDPVVEVAETCAIAL 126          
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Match: sp|Q0VC53|DOHH_BOVIN (Deoxyhypusine hydroxylase OS=Bos taurus OX=9913 GN=DOHH PE=1 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 5.929e-72
Identity = 126/298 (42.28%), Postives = 179/298 (60.07%), Query Frame = 2
Query:   86 TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKS-NVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGA--ALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            TE +++A G+ L D  +PL  R++AL  LR     +AI  I++ F   S LLKH+LAY LGQM +  AI VL D+L + ++ P+VRHEAGE L AIG  + L+ILK++S D   E+AETC L  +R+E+ Q H   +     + S+DPAP  E  E+ +  L E LL+    +FDRYRA+F LR        DAG   A  A+ + L+C  SALFRH++ +V+GQ+ ++ ++  L  A+    E  MVRHE  EALGAI    C   L  ++ D E+VV+E+C VAL + +Y     F
Sbjct:    3 TEQEVEAVGQTLVDPGQPLQARFRALFTLRGLGGPVAISWISRAFDDDSALLKHELAYCLGQMQDRRAIPVLLDVLRDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSTDPVVEVAETCQLAVRRLEWLQQHGGESAVRGPYLSVDPAPPAE--ERDLGQLREALLDEARPLFDRYRAMFALR--------DAGGKEAALALAEGLRC-GSALFRHEIGYVLGQMQHEAAVPQLAAALAQPTENPMVRHECAEALGAIARPACLAALRAHVADPERVVRESCEVALDMYEYETGSTF 289          

HSP 2 Score: 91.2781 bits (225), Expect = 1.787e-19
Identity = 50/132 (37.88%), Postives = 79/132 (59.85%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            + E+ V  + + L++P   +  R+RALFTLR      G     A++ I +A     SAL +H++A+ +GQ+ ++ +I VL + + +  +  MVRHE+GEALGAIGD +  EIL +Y  D    V ETC +A+
Sbjct:    2 VTEQEVEAVGQTLVDPGQPLQARFRALFTLR------GLGGPVAISWISRAFD-DDSALLKHELAYCLGQMQDRRAIPVLLDVLRDTRQEPMVRHEAGEALGAIGDPEVLEILKQYSTDPVVEVAETCQLAV 126          

HSP 3 Score: 79.7221 bits (195), Expect = 1.677e-15
Identity = 44/130 (33.85%), Postives = 64/130 (49.23%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEF 472
            A E DL    E L D ++PL +RY+A+  LR +    A   + +     S L +H++ Y LGQM +E A+  L   L    E P+VRHE  E L AI     L  L+ H  D  + + E+C +     E+
Sbjct:  154 AEERDLGQLREALLDEARPLFDRYRAMFALRDAGGKEAALALAEGLRCGSALFRHEIGYVLGQMQHEAAVPQLAAALAQPTENPMVRHECAEALGAIARPACLAALRAHVADPERVVRESCEVALDMYEY 283          
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Match: E2AE55 (Deoxyhypusine hydroxylase OS=Camponotus floridanus OX=104421 GN=EAG_13199 PE=3 SV=1)

HSP 1 Score: 258.84 bits (660), Expect = 9.202e-81
Identity = 132/301 (43.85%), Postives = 199/301 (66.11%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKS--NVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            M  A+E D+ + G VLND ++PL ER++AL  L++  + +AI+ I+ CF+ +S LLKH+LAY LGQM N  AI +L  +L++  + P+VRHEAGE L AIG    + +L+K+ KD   E+AETC L   R+++ +S+ +  N+  N + +IDPAP  +I   +V  L E+LLN    +FDRYRA+F+LR +   +      ++ A+ + LK   SALFRH++AFV+GQ+  + S+  L  ++ N  E  MVRHE  EALG+I  ++C EIL+KYLND ++VV+E+C++AL + DY  S  F
Sbjct:    1 MVQASESDILSIGGVLNDSARPLKERFRALFTLKNIGNAMAINQISTCFNDQSALLKHELAYCLGQMGNPKAINILTSVLEDLSQEPMVRHEAGEALGAIGEPSVIPLLEKYRKDPVLEVAETCELALDRLKWLESNNNTENLQKNLYSTIDPAPPMDIT--NVDILKEILLNESKSLFDRYRAMFSLRDIGTKE------SILALTEGLKA-GSALFRHEIAFVLGQLQEEVSVPGLRASLENTEENEMVRHECAEALGSIATSECYEILNKYLNDSKRVVRESCIIALDMCDYENSLEF 292          
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Match: N6U7Q2 (Uncharacterized protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=109536937 PE=3 SV=1)

HSP 1 Score: 254.988 bits (650), Expect = 2.705e-79
Identity = 135/300 (45.00%), Postives = 198/300 (66.00%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQS-HKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            M   T+  +++ G+VLN+ S+PL ER++AL  LR+    LAI  I KCF+ +S LLKH+LAY LGQM +  A  +L  +L +E E P+VRHEA E L AIG +D ++IL++   DS+ E+AETC L  +RI + QS   S    N +HS+DPAP  ++  K+V +L  +L+N K  +F+RYRA+F+LR +   +      A+ A+G+ LK   SALF+H+VAFV+GQ+ ++ S+  L+ ++ N  E  MVRHE  EALGAI   +C +IL+KYL D ++VVKE+C +AL + +Y  S  F
Sbjct:    1 MLNITDDQIRSIGDVLNNPSRPLKERFRALFTLRNIGGPLAIASIEKCFADESALLKHELAYCLGQMQDTAANPILVKVLKDEAEHPMVRHEAAEALGAIGSSDMVNILERFKNDSSVEVAETCQLALERINWLQSPDNSKCSENPYHSVDPAPPAQL--KTVEELKGILINDKESLFNRYRAMFSLRNLRSKE------AVEALGEGLK-HGSALFKHEVAFVLGQLQDESSVKYLQSSLENCDENEMVRHECAEALGAIATEECMDILNKYLRDDKRVVKESCEIALDMCEYENSPEF 291          
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Match: A0A0J7L905 (Deoxyhypusine hydroxylase OS=Lasius niger OX=67767 GN=RF55_551 PE=3 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 5.512e-79
Identity = 133/300 (44.33%), Postives = 193/300 (64.33%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQS-HKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            M  A+E D+   G VLND ++PL ER++AL  L++     AI+ I+ CF  +S LLKH+LAY LGQM N  AI +L  +L++  + P+VRHEAGE L AIG    + +L+K+ +D   E+AETC L   R+++ +S +  ++  N + +IDPAP  EI   +V  L E+LLN    +FDRYRA+F+LR +   +      ++ A+ + L+   SALFRH+VAFV+GQ+  + S+  L  ++ N  E  MVRHE  EALG+I   +C EIL+KYLND ++VV+E+CVVAL + DY  S  F
Sbjct:    1 MVRASESDILTIGGVLNDSARPLKERFRALFTLKNIGGATAINQISTCFKDESALLKHELAYCLGQMRNPRAISILTSVLEDLSQEPMVRHEAGEALGAIGEPSVIPLLEKYREDPVPEVAETCELALDRLKWLKSKNMESLQKNPYSTIDPAPPTEIT--NVDILREILLNESKSLFDRYRAMFSLRNLGTKE------SILALTEGLRA-GSALFRHEVAFVLGQLQEEVSVPGLRASLENTEENEMVRHECAEALGSIATPECYEILNKYLNDSKRVVRESCVVALDMCDYENSSEF 291          
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Match: K7IN20 (Deoxyhypusine hydroxylase OS=Nasonia vitripennis OX=7425 GN=100124182 PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.294e-78
Identity = 132/303 (43.56%), Postives = 203/303 (67.00%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSH----KSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            M +  E ++ + G+VLND ++PL ER++AL  L++    LAI+ I K F   S LLKH+LAY LGQM +  AI +L D+L ++ + P+VRHEAGE L AIG  + + +L+++SKD   E+AETC L  KR+++ +S     + ++  N + SIDPAP  +   K+V +L+++LL+ K  +F+RYRA+F+LR +   +      ++ A+ K LK   SALFRH+VAFV+GQ+  + SI +L+E++ + +E  MVRHE  EALGAI    C +IL KYL+D+++VV+E+CV+AL + +Y  S  F
Sbjct:    1 MLSIQEKEIVSVGKVLNDSNRPLKERFRALFTLKNIGGSLAIEQIQKGFRDPSALLKHELAYCLGQMQDSRAIPILVDVLKDKNQEPMVRHEAGEALGAIGDTNVISVLEEYSKDPTVEVAETCELALKRLKWIESQGETKEKDLSKNPYASIDPAPPAQT--KNVKELTDILLDEKASLFERYRAMFSLRNLRTEE------SVLALAKGLKA-GSALFRHEVAFVLGQLQEEVSIPLLKESLEDANENEMVRHECAEALGAIATPYCLDILKKYLDDEKRVVRESCVIALDMCEYENSSEF 294          
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Match: A0A1U7RPZ4 (Deoxyhypusine hydroxylase OS=Alligator sinensis OX=38654 GN=DOHH PE=3 SV=1)

HSP 1 Score: 253.447 bits (646), Expect = 1.313e-78
Identity = 134/294 (45.58%), Postives = 184/294 (62.59%), Query Frame = 2
Query:   89 EHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            E D++A G  L D ++PL  R++AL  LR+     A+D I++ F  +S LLKH+LAY LGQM +EHAI VL  +L +  + P+VRHEAGE L AIG+ D LD+LK +S+D   E+AETC L  KR+E+ Q +K     N + S+DPAP  E  E+ +  L   LL+    +FDRYRA+F LR +         AA+ A+   LKC SSALFRH++ +V+GQ+ ++  +  L  A+  + E  MVRHE  EALG+I  A C E L  Y  DKEQVV+E+C VAL + +Y  S  F
Sbjct:    4 EKDVEAVGRTLVDAAQPLAARFRALFTLRNVGGRAAVDWISRGFGDESALLKHELAYCLGQMQDEHAIPVLIQVLKDTSQEPMVRHEAGEALGAIGNPDVLDVLKHYSEDPVVEVAETCQLAVKRLEWLQKNKEVPGTNPYLSVDPAPPAE--EEDIAKLRNTLLDESCPLFDRYRAMFALRNMGGE------AAVLALADGLKC-SSALFRHEIGYVLGQMQHEACVPQLTAALERVEENPMVRHECAEALGSIAQASCLETLQTYSQDKEQVVRESCEVALDMYNYENSTEF 288          

HSP 2 Score: 80.8777 bits (198), Expect = 2.327e-13
Identity = 41/121 (33.88%), Postives = 65/121 (53.72%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETC 445
            A E D+      L D S PL +RY+A+  LR+   + A+  +       S L +H++ Y LGQM +E  +  L   L+  +E P+VRHE  E L +I  A  L+ L+ +S+D  + + E+C
Sbjct:  153 AEEEDIAKLRNTLLDESCPLFDRYRAMFALRNMGGEAAVLALADGLKCSSALFRHEIGYVLGQMQHEACVPQLTAALERVEENPMVRHECAEALGSIAQASCLETLQTYSQDKEQVVRESC 273          

HSP 3 Score: 78.5666 bits (192), Expect = 1.247e-12
Identity = 47/132 (35.61%), Postives = 74/132 (56.06%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            + EK V  +   L++    +  R+RALFTLR V         AA+  I +      SAL +H++A+ +GQ+ ++ +I VL + + +  +  MVRHE+GEALGAIG+    ++L  Y  D    V ETC +A+
Sbjct:    2 VPEKDVEAVGRTLVDAAQPLAARFRALFTLRNVG------GRAAVDWISRGFG-DESALLKHELAYCLGQMQDEHAIPVLIQVLKDTSQEPMVRHEAGEALGAIGNPDVLDVLKHYSEDPVVEVAETCQLAV 126          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Cavefish
Match: dohh (deoxyhypusine hydroxylase [Source:NCBI gene;Acc:103039788])

HSP 1 Score: 238.81 bits (608), Expect = 3.182e-76
Identity = 131/301 (43.52%), Postives = 189/301 (62.79%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFF-----QSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ATE DL + G +L +  + L  R++AL  LR+     AI  I++ F   S LLKH+LAY LGQM +E AI VL+ +L + K+ P+VRHEAGE L AIG+   LD+LK++S+D   E+AETC L  +R+E+      ++   +   N + S+DPAP  +   KSV +L + LL+    +F+RYRA+F LR ++  +      A+ A+G  L+C SSALFRH++ +V+GQI ++ SI  L  A+  + E  MVRHE  EALG+IG   C  IL +Y  D+E+VVKE+C VAL + +Y  S  F
Sbjct:    2 ATEQDLASVGSILVNPKQDLTTRFRALFTLRNLGGPEAIKWISEAFMDDSALLKHELAYCLGQMQDERAIPVLETVLKDTKQEPMVRHEAGEALGAIGNPKVLDLLKQYSEDPVIEVAETCQLAVRRLEWLMNSGDENSAGDTDCNPYCSVDPAPPAQ--RKSVPELRKQLLDEDLPLFERYRAMFALRNLSTEE------AVLALGDGLQC-SSALFRHEIGYVLGQIQHEASIPQLRAALEKVDENAMVRHECAEALGSIGKDACVPILQQYRQDRERVVKESCEVALDMLEYENSGQF 293          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Cavefish
Match: dohh (deoxyhypusine hydroxylase [Source:NCBI gene;Acc:103039788])

HSP 1 Score: 238.81 bits (608), Expect = 3.500e-76
Identity = 131/301 (43.52%), Postives = 189/301 (62.79%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFF-----QSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            ATE DL + G +L +  + L  R++AL  LR+     AI  I++ F   S LLKH+LAY LGQM +E AI VL+ +L + K+ P+VRHEAGE L AIG+   LD+LK++S+D   E+AETC L  +R+E+      ++   +   N + S+DPAP  +   KSV +L + LL+    +F+RYRA+F LR ++  +      A+ A+G  L+C SSALFRH++ +V+GQI ++ SI  L  A+  + E  MVRHE  EALG+IG   C  IL +Y  D+E+VVKE+C VAL + +Y  S  F
Sbjct:    2 ATEQDLASVGSILVNPKQDLTTRFRALFTLRNLGGPEAIKWISEAFMDDSALLKHELAYCLGQMQDERAIPVLETVLKDTKQEPMVRHEAGEALGAIGNPKVLDLLKQYSEDPVIEVAETCQLAVRRLEWLMNSGDENSAGDTDCNPYCSVDPAPPAQ--RKSVPELRKQLLDEDLPLFERYRAMFALRNLSTEE------AVLALGDGLQC-SSALFRHEIGYVLGQIQHEASIPQLRAALEKVDENAMVRHECAEALGSIGKDACVPILQQYRQDRERVVKESCEVALDMLEYENSGQF 293          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Sea Lamprey
Match: DOHH (deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:HGNC:28662])

HSP 1 Score: 192.2 bits (487), Expect = 1.011e-58
Identity = 109/294 (37.07%), Postives = 166/294 (56.46%), Query Frame = 2
Query:  110 GEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKS-------NVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            G+VL D S+PL  R++AL  L+    + A+  +       S LL H+ A+ LGQ  +  A   L+++L +    PIVRHEAGE L AIG  D LD+L++ S D   E+AETC L  +R+E+ Q  ++        +  + + ++DP P    ++  V  L   LL+    +++RYRA+F LR V  ++      A+ A+   L C  SALFRH+VAFV+GQ+ +  S+  L   +    E GMVRHE  EALG++   +  EIL  Y +D E+VV+E+  VAL + ++ A+  F
Sbjct:   15 GKVLADESQPLKARFRALFTLKGMGGEAAVRWLASALRDPSALLGHEAAFCLGQTGHAAAKAPLEELLRDRDARPIVRHEAGEALGAIGTPDVLDVLREFSSDPVVEVAETCQLAVRRVEWLQRTRAAGGAEEERLGTSTYDTVDPVPAAASSD--VKQLRCTLLDDGAPLYERYRAMFALRNVGSNE------AVLALSDGLSC-GSALFRHEVAFVLGQMQHPASVPALASRLAVAEESGMVRHECAEALGSVATPESLEILRAYRDDPERVVRESVEVALDMWEHEAAGEF 299          

HSP 2 Score: 78.5666 bits (192), Expect = 1.346e-16
Identity = 49/137 (35.77%), Postives = 77/137 (56.20%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADY 952
             +EKSV ++ ++L +    +  R+RALFTL      KG    AA+  +  AL+ P SAL  H+ AF +GQ  +  +   LEE + +     +VRHE+GEALGAIG     ++L ++ +D    V ETC +A+   ++
Sbjct:    6 FDEKSVDEVGKVLADESQPLKARFRALFTL------KGMGGEAAVRWLASALRDP-SALLGHEAAFCLGQTGHAAAKAPLEELLRDRDARPIVRHEAGEALGAIGTPDVLDVLREFSSDPVVEVAETCQLAVRRVEW 135          

HSP 3 Score: 71.2478 bits (173), Expect = 3.811e-14
Identity = 39/121 (32.23%), Postives = 67/121 (55.37%), Query Frame = 2
Query:   80 AATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAET 442
            AA   D+K     L D   PL ERY+A+  LR+  S+ A+  ++   S  S L +H++A+ LGQM +  ++  L   L   +E+ +VRHE  E L ++   ++L+IL+ +  D  + + E+
Sbjct:  163 AAASSDVKQLRCTLLDDGAPLYERYRAMFALRNVGSNEAVLALSDGLSCGSALFRHEVAFVLGQMQHPASVPALASRLAVAEESGMVRHECAEALGSVATPESLEILRAYRDDPERVVRES 283          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Yeast
Match: LIA1 (Deoxyhypusine hydroxylase; HEAT-repeat containing metalloenzyme that catalyzes hypusine formation; binds to and is required for the modification of Hyp2p (eIF5A); complements S. pombe mmd1 mutants defective in mitochondrial positioning; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000003831])

HSP 1 Score: 185.267 bits (469), Expect = 3.999e-56
Identity = 112/293 (38.23%), Postives = 167/293 (57.00%), Query Frame = 2
Query:  128 GSKPLVERYKALKGLRHSKSDLA---------IDLITKCF-SSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSK-DSNKELAETCYLGYKRIEFFQS---HKSNVPPNEFHSIDPAPEFEIN-EKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSAS 961
            G   L  R++AL  L+    + A         I+ I + F + KS+LLKH++AY LGQ  N  A   L+ ++ ++ + P+VRHEA E L A+G  D+LD L K +K D +  + ETC L   RI +       K N+  + + SIDPAP   +  + ++ +L  LL +PK  +F RYRA+F LR +    G+D   A+ A+       SS LF+H++A+V GQI +  ++  L E +G   E  MVRHE+ EALGAI   +  ++L  YLND+  VV+E+C+VAL + DY  S
Sbjct:   30 GKTVLANRFRALFNLKTVAEEFATKPEEAKKAIEYIAESFVNDKSELLKHEVAYVLGQTKNLDAAPTLRHVMLDQNQEPMVRHEAAEALGALGDKDSLDDLNKAAKEDPHVAVRETCELAINRINWTHGGAKDKENLQQSLYSSIDPAPPLPLEKDATIPELQALLNDPKQPLFQRYRAMFRLRDI----GTDE--AILALATGFSAESS-LFKHEIAYVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAEALGAIASPEVVDVLKSYLNDEVDVVRESCIVALDMYDYENS 315          

HSP 2 Score: 92.4337 bits (228), Expect = 1.182e-21
Identity = 50/141 (35.46%), Postives = 82/141 (58.16%), Query Frame = 2
Query:   83 ATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPN 505
            AT  +L+A   +LND  +PL +RY+A+  LR   +D AI  +   FS++S L KH++AY  GQ+ +  A+  L ++L  ++EAP+VRHEA E L AI   + +D+LK +  D    + E+C +     ++  S++    P 
Sbjct:  186 ATIPELQA---LLNDPKQPLFQRYRAMFRLRDIGTDEAILALATGFSAESSLFKHEIAYVFGQIGSPAAVPSLIEVLGRKEEAPMVRHEAAEALGAIASPEVVDVLKSYLNDEVDVVRESCIVALDMYDYENSNELEYAPT 323          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Nematostella
Match: EDO39972 (Deoxyhypusine hydroxylase [Source:UniProtKB/TrEMBL;Acc:A7S8F4])

HSP 1 Score: 182.57 bits (462), Expect = 3.773e-55
Identity = 112/283 (39.58%), Postives = 167/283 (59.01%), Query Frame = 2
Query:  134 KPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSN----VPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            + L +R++AL  LR+    +AI+ I+KCF+  S LLKH+LAY LGQM +  A+     IL    E   V++  GE L  + +    D+  ++    +  +AETC L  +RIE+ Q+ K +    +  N ++S+DPAP   I +  V  L E LLN    +FDRYRA+F+LR   +  G DA   + A+ + LKC SSALFRH++A+V+GQ+ +  +   L   + + +E  MVRHE  EALG+I    C +IL  Y +DKE+VVKE+C VAL +++Y     F
Sbjct:    3 RSLTKRFRALFTLRNLGGKVAIEHISKCFNDPSALLKHELAYCLGQMQDPDALP----ILIRTGEDLGVQYLTGEDLG-VQYRTGEDLGVQYLTGEDLGIAETCQLALQRIEWLQTQKDDEKDHLSENPYNSVDPAPPSIITD--VKQLKETLLNESLPLFDRYRAMFSLR---NKGGEDA---VLALAEGLKC-SSALFRHEIAYVLGQMQDDGAAKQLSVNLADANENPMVRHECAEALGSIAKDSCLDILKNYKDDKERVVKESCEVALDMSEYERGPEF 271          

HSP 2 Score: 79.7221 bits (195), Expect = 7.061e-17
Identity = 44/126 (34.92%), Postives = 68/126 (53.97%), Query Frame = 2
Query:   95 DLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEF 472
            D+K   E L + S PL +RY+A+  LR+   + A+  + +     S L +H++AY LGQM ++ A K L   L +  E P+VRHE  E L +I     LDILK +  D  + + E+C +     E+
Sbjct:  140 DVKQLKETLLNESLPLFDRYRAMFSLRNKGGEDAVLALAEGLKCSSALFRHEIAYVLGQMQDDGAAKQLSVNLADANENPMVRHECAEALGSIAKDSCLDILKNYKDDKERVVKESCEVALDMSEY 265          
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Medaka
Match: dohh (deoxyhypusine hydroxylase [Source:NCBI gene;Acc:101174172])

HSP 1 Score: 224.942 bits (572), Expect = 6.676e-71
Identity = 124/291 (42.61%), Postives = 177/291 (60.82%), Query Frame = 2
Query:  110 GEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQS----HKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            G +L D  + L +R++AL  L++     AI+ I K FS KS LLKH+LAY LGQM +  AI VL  +L + ++ P+VRHEAGE L AIG    LD+LK++S+D   E+AETC L   R+++ QS           N + S+DPAP      +SV +L   LL+    +F+RYRA+F LR +          A+ A+   L+C SSALFRH++ +V+GQ+ +  +I  L  A+ +  E  MVRHE+ EALG+IG  +C  +LH Y  D+E VVKE+C VAL + +Y  S+ F
Sbjct:   11 GRILVDPGQVLTQRFRALFTLKNLGGAEAIEWIGKAFSDKSALLKHELAYCLGQMQDRQAIPVLTAVLRDAQQEPMVRHEAGEALGAIGDPVVLDLLKEYSRDPVIEVAETCQLAVSRLKWLQSGGEQQDGATDMNPYCSVDPAP--PAPRRSVPELRRALLDEDLPLFERYRAMFALRNLGSED------AVLALADGLQC-SSALFRHEIGYVLGQMQHPAAIPALSAALQHAAENPMVRHEAAEALGSIGRDECLAVLHCYRGDQEPVVKESCEVALDMLEYENSDQF 292          

HSP 2 Score: 85.8853 bits (211), Expect = 1.600e-18
Identity = 47/129 (36.43%), Postives = 78/129 (60.47%), Query Frame = 2
Query:  551 KSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVAL 937
            + V  +  +L++P   +  R+RALFTL+ +  ++      A+  IGKA     SAL +H++A+ +GQ+ ++++I VL   + +  +  MVRHE+GEALGAIGD    ++L +Y  D    V ETC +A+
Sbjct:    5 EQVASVGRILVDPGQVLTQRFRALFTLKNLGGAE------AIEWIGKAFS-DKSALLKHELAYCLGQMQDRQAIPVLTAVLRDAQQEPMVRHEAGEALGAIGDPVVLDLLKEYSRDPVIEVAETCQLAV 126          
BLAST of Deoxyhypusine hydroxylase vs. Planmine SMEST
Match: SMESG000051726.1 (SMESG000051726.1)

HSP 1 Score: 603.594 bits (1555), Expect = 0.000e+0
Identity = 297/299 (99.33%), Postives = 298/299 (99.67%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQI+NKE IHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF
Sbjct:    1 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQISNKELIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 299          
BLAST of Deoxyhypusine hydroxylase vs. Planmine SMEST
Match: SMESG000051751.1 (SMESG000051751.1)

HSP 1 Score: 347.051 bits (889), Expect = 9.266e-119
Identity = 162/299 (54.18%), Postives = 229/299 (76.59%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF 970
            M + +E +L++WG++L++  KPLVER++AL GL+H++ DLAIDLI + FSSKS+LLKH+LAY LGQ AN +A KVL ++L++  + PIVRHEAGE LAAIG  D L IL+K+S   NKE+AETCY+GYKRI FF  +++++ PN F +IDPAPE+ IN+  +  L  +L +   +IF++YR+LF+LRR+AHS  SDA  AL  I   L    SALFRH+VAFV+GQ+AN  S+  L  ++ N++E+GMVRHES EALG+IG+ +C+++L  +L+DKEQVV E+CV+AL +A Y++ E+F
Sbjct:    1 MVSVSESELRSWGDILSNPEKPLVERFRALWGLKHAREDLAIDLIAEAFSSKSELLKHELAYCLGQKANSYASKVLINVLEDLDQEPIVRHEAGEALAAIGCPDFLHILEKYSHCDNKEIAETCYIGYKRILFFIENETDILPNNFDTIDPAPEYPINQFDISTLKNILFDDLHNIFEKYRSLFSLRRIAHSISSDAIEALQIICDGLNYAPSALFRHEVAFVLGQLANPLSVEALAASVANVNEMGMVRHESAEALGSIGNERCQKVLKDFLSDKEQVVMESCVIALDIASYNSCENF 299          
BLAST of Deoxyhypusine hydroxylase vs. Planmine SMEST
Match: SMESG000051721.1 (SMESG000051721.1)

HSP 1 Score: 334.339 bits (856), Expect = 8.454e-116
Identity = 163/166 (98.19%), Postives = 164/166 (98.80%), Query Frame = 2
Query:   74 MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLS 571
            M A TEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDL+
Sbjct:    1 MTAVTEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSIDPAPEFEINEKSVHDLN 166          

HSP 2 Score: 72.4034 bits (176), Expect = 6.705e-15
Identity = 48/133 (36.09%), Postives = 72/133 (54.14%), Query Frame = 2
Query:  542 INEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAALTAIGKALKCPSSA--LFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVRHESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVA 934
            + E  +    E+L +    + +RY+AL  LR   HSK         AI    KC SS   L +H +A+ +GQ+AN+ +I VL++ + N  E  +VRHE+GE L AIG A   +IL K+  D  + + ETC + 
Sbjct:    4 VTEHDLKAWGEVLNDGSKPLVERYKALKGLR---HSKSD------LAIDLITKCFSSKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAIGHADALDILKKHSKDSNKELAETCYLG 127          
The following BLAST results are available for this feature:
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
DOHH1.436e-7042.03deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:... [more]
DOHH1.436e-7042.03deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:... [more]
DOHH6.753e-3746.00deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dohh-19.708e-7841.89Deoxyhypusine hydroxylase [Source:UniProtKB/Swiss... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nero1.512e-7442.03gene:FBgn0261479 transcript:FBtr0085863[more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dohh1.269e-7442.67deoxyhypusine hydroxylase/monooxygenase [Source:NC... [more]
dohh1.269e-7442.67deoxyhypusine hydroxylase/monooxygenase [Source:NC... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
plk37.100e-6436.87polo-like kinase 3 [Source:Xenbase;Acc:XB-GENE-586... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dohh1.578e-7142.57deoxyhypusine hydroxylase/monooxygenase [Source:MG... [more]
Gm485516.140e-4543.43predicted gene, 48551 [Source:MGI Symbol;Acc:MGI:6... [more]
Dohh1.030e-4444.09deoxyhypusine hydroxylase/monooxygenase [Source:MG... [more]
Dohh1.933e-4444.09deoxyhypusine hydroxylase/monooxygenase [Source:MG... [more]
Gm485511.892e-2237.66predicted gene, 48551 [Source:MGI Symbol;Acc:MGI:6... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q17949|DOHH_CAEEL1.235e-7641.89Deoxyhypusine hydroxylase OS=Caenorhabditis elegan... [more]
sp|Q297S2|DOHH_DROPS3.989e-7643.39Deoxyhypusine hydroxylase OS=Drosophila pseudoobsc... [more]
sp|Q7ZUX6|DOHH_DANRE5.348e-7442.67Deoxyhypusine hydroxylase OS=Danio rerio OX=7955 G... [more]
sp|Q9V9U4|DOHH_DROME1.515e-7342.03Deoxyhypusine hydroxylase OS=Drosophila melanogast... [more]
sp|Q0VC53|DOHH_BOVIN5.929e-7242.28Deoxyhypusine hydroxylase OS=Bos taurus OX=9913 GN... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E2AE559.202e-8143.85Deoxyhypusine hydroxylase OS=Camponotus floridanus... [more]
N6U7Q22.705e-7945.00Uncharacterized protein (Fragment) OS=Dendroctonus... [more]
A0A0J7L9055.512e-7944.33Deoxyhypusine hydroxylase OS=Lasius niger OX=67767... [more]
K7IN201.294e-7843.56Deoxyhypusine hydroxylase OS=Nasonia vitripennis O... [more]
A0A1U7RPZ41.313e-7845.58Deoxyhypusine hydroxylase OS=Alligator sinensis OX... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
dohh3.182e-7643.52deoxyhypusine hydroxylase [Source:NCBI gene;Acc:10... [more]
dohh3.500e-7643.52deoxyhypusine hydroxylase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
DOHH1.011e-5837.07deoxyhypusine hydroxylase [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LIA13.999e-5638.23Deoxyhypusine hydroxylase; HEAT-repeat containing ... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO399723.773e-5539.58Deoxyhypusine hydroxylase [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
dohh6.676e-7142.61deoxyhypusine hydroxylase [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Deoxyhypusine hydroxylase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000051726.10.000e+099.33SMESG000051726.1[more]
SMESG000051751.19.266e-11954.18SMESG000051751.1[more]
SMESG000051721.18.454e-11698.19SMESG000051721.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016080 ID=SMED30016080|Name=Deoxyhypusine hydroxylase|organism=Schmidtea mediterranea sexual|type=transcript|length=1139bp
AAACATTTAAAAATCCTTTCTGAAAATTATATTACGTGACTTTTATCAGT
ACCATTAAACAGTCGCTTTAGACATGGCAGCTGCAACGGAACACGATTTA
AAAGCCTGGGGCGAGGTCTTAAATGATGGTAGTAAGCCATTAGTAGAACG
ATATAAGGCTTTAAAAGGCTTAAGACATTCAAAAAGTGATCTTGCCATCG
ATTTGATTACAAAATGTTTTTCAAGCAAATCTGATTTATTGAAACATGAT
TTAGCTTATGCTCTTGGTCAAATGGCAAATGAGCATGCGATTAAAGTATT
GAAAGATATTCTTGACAATGAAAAGGAGGCACCAATTGTTCGTCATGAAG
CTGGTGAAGGGCTTGCTGCAATTGGACATGCCGATGCTTTAGATATTTTA
AAGAAGCACAGCAAAGATTCAAATAAAGAACTCGCTGAAACATGTTATTT
GGGTTATAAAAGAATTGAATTTTTTCAATCTCATAAGTCAAATGTTCCCC
CCAATGAATTCCATTCAATTGATCCAGCTCCGGAATTTGAAATCAACGAG
AAATCAGTTCATGATTTAAGTGAACTTTTACTTAATCCAAAAACTGACAT
TTTTGATAGATATCGAGCTTTGTTTACTTTAAGAAGAGTAGCTCATTCTA
AAGGAAGCGATGCAGGAGCTGCTTTGACTGCTATTGGGAAAGCATTAAAA
TGCCCGAGCAGTGCATTATTTCGTCATCAAGTGGCATTTGTAATCGGGCA
AATCGCAAATAAAGAATCGATTCATGTATTGGAAGAAGCAATCGGAAATT
TACATGAGCTCGGAATGGTTCGACACGAAAGCGGAGAAGCTCTAGGAGCA
ATTGGAGATGCTAAATGCAAGGAAATCTTGCACAAATATCTGAACGACAA
GGAGCAAGTAGTGAAGGAGACTTGTGTTGTCGCTCTCGGAGTTGCCGATT
ACAGCGCTTCGGAACACTTCTAGATACTTGGCTTAATTTGTACTTTTTGT
GGATTTATTATTAGCATTTTACTAGCAAGGAAATCTCATTTAATAATTTA
CGTAAGAATCTCGTAGAATGTTTATTTATATTATTGTTAGATGTGCAGTT
ATTTATATTTAATAATACAACTTTCTATTTGGAAAAAAA
back to top

protein sequence of SMED30016080-orf-1

>SMED30016080-orf-1 ID=SMED30016080-orf-1|Name=SMED30016080-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=300bp
MAAATEHDLKAWGEVLNDGSKPLVERYKALKGLRHSKSDLAIDLITKCFS
SKSDLLKHDLAYALGQMANEHAIKVLKDILDNEKEAPIVRHEAGEGLAAI
GHADALDILKKHSKDSNKELAETCYLGYKRIEFFQSHKSNVPPNEFHSID
PAPEFEINEKSVHDLSELLLNPKTDIFDRYRALFTLRRVAHSKGSDAGAA
LTAIGKALKCPSSALFRHQVAFVIGQIANKESIHVLEEAIGNLHELGMVR
HESGEALGAIGDAKCKEILHKYLNDKEQVVKETCVVALGVADYSASEHF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
PLANA:0000428musculature system
PLANA:0000478pharynx musculature
PLANA:0007528glial cell
PLANA:0007547anterior pole progenitor cell
Vocabulary: INTERPRO
TermDefinition
IPR004155PBS_lyase_HEAT
IPR011989ARM-like
IPR016024ARM-type_fold
Vocabulary: molecular function
TermDefinition
GO:0005488binding
GO:0004497monooxygenase activity
GO:0016491oxidoreductase activity
GO:0019135deoxyhypusine monooxygenase activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0008612peptidyl-lysine modification to peptidyl-hypusine
GO:0055114oxidation-reduction process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004155PBS lyase HEAT-like repeatSMARTSM00567EZ_HEATcoord: 247..276
e-value: 0.074
score: 22.2
coord: 23..52
e-value: 340.0
score: 4.4
coord: 214..243
e-value: 16.0
score: 14.5
coord: 87..116
e-value: 0.0031
score: 26.7
coord: 54..83
e-value: 0.0096
score: 25.1
coord: 176..211
e-value: 30.0
score: 12.9
NoneNo IPR availablePFAMPF13646HEAT_2coord: 203..289
e-value: 5.1E-8
score: 33.2
coord: 51..119
e-value: 1.8E-8
score: 34.6
NoneNo IPR availablePANTHERPTHR12697:SF5DEOXYHYPUSINE HYDROXYLASEcoord: 52..296
NoneNo IPR availablePANTHERPTHR12697PBS LYASE HEAT-LIKE PROTEINcoord: 15..111
NoneNo IPR availablePANTHERPTHR12697:SF5DEOXYHYPUSINE HYDROXYLASEcoord: 15..111
NoneNo IPR availablePANTHERPTHR12697PBS LYASE HEAT-LIKE PROTEINcoord: 52..296
IPR011989Armadillo-like helicalGENE3DG3DSA:1.25.10.10coord: 150..297
e-value: 7.8E-12
score: 46.9
coord: 2..133
e-value: 3.6E-11
score: 44.7
IPR016024Armadillo-type foldSUPERFAMILYSSF48371ARM repeatcoord: 55..289