Actin, cytoplasmic

Overview
NameActin, cytoplasmic
Smed IDSMED30016078
Length (bp)1181
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Actin, cytoplasmic (SMED30016078) t-SNE clustered cells

Violin plots show distribution of expression levels for Actin, cytoplasmic (SMED30016078) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Actin, cytoplasmic (SMED30016078) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Actin, cytoplasmic (SMED30016078) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016078

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 56

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynx progenitor cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMED30016078smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X2 cellSMED30016078SMESG000012332.1 SMESG000012317.1 SmedASXL_016037SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016078SMESG000012332.1 SMESG000012317.1 SmedASXL_006347SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016078SMESG000012332.1 SMESG000012317.1 SmedASXL_018601SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016078SMESG000012332.1 SMESG000012317.1 SmedASXL_016038SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Smed sexual biotypeSMED30016078SMESG000012332.1 SMESG000012317.1 Contig51607newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016078SMESG000012332.1 SMESG000012317.1 Contig51607uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v4_285_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMED30016078smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMED30016078smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30016078SMESG000012332.1 SMESG000012317.1 OX_Smed_1.0.17735ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30016078SMESG000012332.1 SMESG000012317.1 dd_Smed_v6_285_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cholinergic neuronSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neural progenitor cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynx progenitor cellSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
secretory systemSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058958.1 SMESG000058954.1 dd_Smed_v6_246_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016078SMESG000012332.1 SMESG000012317.1 SMESG000058954.1 dd_Smed_v4_246_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Human
Match: ACTG1 (actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-2 (Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984])

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-4 (Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986])

HSP 1 Score: 753.436 bits (1944), Expect = 0.000e+0
Identity = 353/374 (94.39%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVIT+GNERFRCPEALFQPSFLGME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEALFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Match: act-3 (Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 352/374 (94.12%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTG+VLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVIT+GNERFRCPEA+FQPSFLGME+AGIHET+YNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGVVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITVGNERFRCPEAMFQPSFLGMESAGIHETSYNSIMKCDIDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070822)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 366/374 (97.86%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME  GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100662)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 366/374 (97.86%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME  GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0345894)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 366/374 (97.86%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME  GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0070823)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 366/374 (97.86%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME  GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Match: Act5C (gene:FBgn0000042 transcript:FBtr0100663)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 366/374 (97.86%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME  GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEACGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 356/375 (94.93%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+E+IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb1 (actin, beta 1 [Source:NCBI gene;Acc:57934])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 356/375 (94.93%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+E+IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 355/375 (94.67%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 355/375 (94.67%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Match: actb2 (actin, beta 2 [Source:NCBI gene;Acc:57935])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 355/375 (94.67%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actb (actin, beta [Source:NCBI gene;Acc:407952])

HSP 1 Score: 757.673 bits (1955), Expect = 0.000e+0
Identity = 358/375 (95.47%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M++DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: actg1 (actin gamma 1 [Source:NCBI gene;Acc:394957])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+E+IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 346/374 (92.51%), Postives = 358/374 (95.72%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            EED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:   24 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 397          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 734.561 bits (1895), Expect = 0.000e+0
Identity = 346/374 (92.51%), Postives = 358/374 (95.72%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            EED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    7 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 380          
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Match: acta2 (actin, alpha 2, smooth muscle, aorta [Source:NCBI gene;Acc:496696])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 346/374 (92.51%), Postives = 358/374 (95.72%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            EED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    9 EEDTTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 382          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg1 (actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc:MGI:87906])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actb (actin, beta [Source:MGI Symbol;Acc:MGI:87904])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M++DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Acta2 (actin, alpha 2, smooth muscle, aorta [Source:MGI Symbol;Acc:MGI:87909])

HSP 1 Score: 737.643 bits (1903), Expect = 0.000e+0
Identity = 347/374 (92.78%), Postives = 359/374 (95.99%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            EED  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 EEDSTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Match: Actg2 (actin, gamma 2, smooth muscle, enteric [Source:MGI Symbol;Acc:MGI:104589])

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 345/374 (92.25%), Postives = 358/374 (95.72%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            EE+  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISK EYDE+GP IVHRKCF
Sbjct:    3 EEETTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKPEYDEAGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|P12716|ACTC_PISOC (Actin, cytoplasmic OS=Pisaster ochraceus OX=7612 PE=3 SV=1)

HSP 1 Score: 762.296 bits (1967), Expect = 0.000e+0
Identity = 360/374 (96.26%), Postives = 369/374 (98.66%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +ED+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGIADRMQKE++ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVFDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEVTALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q964E1|ACTC_BIOOB (Actin, cytoplasmic OS=Biomphalaria obstructa OX=153466 PE=3 SV=1)

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 360/374 (96.26%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +ED+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTA SSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTATSSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|O17320|ACT_CRAGI (Actin OS=Crassostrea gigas OX=29159 PE=2 SV=1)

HSP 1 Score: 759.599 bits (1960), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 370/374 (98.93%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +EDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME++GIHET+YNSIMKCDVDIRKDLY NIVLSGG+TM+PGIADRMQKE++ALAPPTMKIK+IAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESSGIHETSYNSIMKCDVDIRKDLYANIVLSGGTTMFPGIADRMQKEVTALAPPTMKIKVIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q964E0|ACTC_BIOTE (Actin, cytoplasmic OS=Biomphalaria tenagophila OX=112528 PE=3 SV=1)

HSP 1 Score: 759.214 bits (1959), Expect = 0.000e+0
Identity = 358/374 (95.72%), Postives = 369/374 (98.66%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +ED+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTA++SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DEDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTASTSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMEAAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Match: sp|Q93131|ACTC_BRAFL (Actin, cytoplasmic OS=Branchiostoma floridae OX=7739 PE=2 SV=1)

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+ G+HETTYNSIMKCD+DIRKDLY N VLSGG+TM+PGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESTGVHETTYNSIMKCDIDIRKDLYANTVLSGGTTMFPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: H2MSI7 (Uncharacterized protein OS=Oryzias latipes OX=8090 GN=LOC101155523 PE=3 SV=1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 362/375 (96.53%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3P9H8Q5 (Uncharacterized protein OS=Oryzias latipes OX=8090 PE=3 SV=1)

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 362/375 (96.53%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3P9C9Q6 (Uncharacterized protein OS=Maylandia zebra OX=106582 PE=3 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 361/375 (96.27%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+E+I+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   18 MDEEISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 392          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3B3C4C3 (Uncharacterized protein OS=Oryzias melastigma OX=30732 PE=3 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 362/375 (96.53%), Postives = 370/375 (98.67%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEEDI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 MEEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMNTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. TrEMBL
Match: A0A3B3C3C2 (Uncharacterized protein OS=Oryzias melastigma OX=30732 PE=3 SV=1)

HSP 1 Score: 765.377 bits (1975), Expect = 0.000e+0
Identity = 362/375 (96.53%), Postives = 370/375 (98.67%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEEDI+ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEDISALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMNTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 753.821 bits (1945), Expect = 0.000e+0
Identity = 356/375 (94.93%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+E+IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDEEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb2 (actin beta [Source:NCBI gene;Acc:103030443])

HSP 1 Score: 752.281 bits (1941), Expect = 0.000e+0
Identity = 355/375 (94.67%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: actb1 (actin, cytoplasmic 1 [Source:NCBI gene;Acc:103039558])

HSP 1 Score: 748.814 bits (1932), Expect = 0.000e+0
Identity = 354/372 (95.16%), Postives = 365/372 (98.12%), Query Frame = 2
Query:   44 DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI++LAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    6 EIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITSLAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: acta2 (actin alpha 2, smooth muscle [Source:NCBI gene;Acc:103040556])

HSP 1 Score: 734.176 bits (1894), Expect = 0.000e+0
Identity = 345/374 (92.25%), Postives = 359/374 (95.99%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E+  ALV DNGSG+CKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHH+FYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DEESTALVCDNGSGLCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHSFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Match: zgc:86709 (actin, alpha cardiac muscle 1 [Source:NCBI gene;Acc:103031734])

HSP 1 Score: 731.095 bits (1886), Expect = 0.000e+0
Identity = 344/374 (91.98%), Postives = 358/374 (95.72%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +++  ALV DNGSG+ KAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGI+TNWDDMEKIWHHTFYNELRVAPEEHP LLTEAPLNPKANREKMTQIMFETFN PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+H VPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSF TTAEREIVRDIKEKLCY+ALDFE EM TAASSSSLEKSYELPDGQVITIGNERFRCPE LFQPSF+GME+AGIHETTYNSIMKCD+DIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE+GP IVHRKCF
Sbjct:    4 DDETTALVCDNGSGLVKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIITNWDDMEKIWHHTFYNELRVAPEEHPTLLTEAPLNPKANREKMTQIMFETFNVPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHNVPIYEGYALPHAIMRLDLAGRDLTDYLMKILTERGYSFVTTAEREIVRDIKEKLCYVALDFENEMATAASSSSLEKSYELPDGQVITIGNERFRCPETLFQPSFIGMESAGIHETTYNSIMKCDIDIRKDLYANNVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDEAGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011113.1 (pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene:ENSPMAG00000010086.1 transcript:ENSPMAT00000011113.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 754.977 bits (1948), Expect = 0.000e+0
Identity = 357/374 (95.45%), Postives = 367/374 (98.13%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            E++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 EDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004586.1 (pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 gene:ENSPMAG00000004161.1 transcript:ENSPMAT00000004586.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 749.969 bits (1935), Expect = 0.000e+0
Identity = 355/374 (94.92%), Postives = 365/374 (97.59%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            E++IAALVVDNGSGMCKAGFAGDDAPRAVFPSIVG P HQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 EDEIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGHPLHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011230.1 (pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1 gene:ENSPMAG00000010203.1 transcript:ENSPMAT00000011230.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 460.685 bits (1184), Expect = 9.371e-163
Identity = 208/381 (54.59%), Postives = 285/381 (74.80%), Query Frame = 2
Query:   44 DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMV---------GMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            D  A+V+DNGSG+CKAGFAG++APR   PS+VGRPR +  M+         G G    Y+G +A  +RG+L+L+YP+E GIVT WDDME++W H +  EL   P++ PVLLTEAPLNP  NRE+  Q++FE F +PA+++A+QAVLSLYASG  TG+ +  GDGV+H VP++EGY LP A+ R D+AGRD+TD L +IL ERG++F ++AE EIV DIKE++CY+A D+E+E++       L   Y+LPDGQVIT+ ++RFR PE LF P+ +G++  GIH+  + S+ + D+D+RK LY NI+LSGGS+++PG+ +R+ +E++ LAP    ++I APPERKYSVWIGGSILASLSTFQQMWI+  EY E GP +VHR+C 
Sbjct:    6 DNPAVVMDNGSGLCKAGFAGENAPRFCVPSLVGRPRQRDTMLVSRGLDDAGGSGDGGCYIGRQALCRRGVLSLRYPVERGIVTRWDDMERVWAHAYEAELHARPQDQPVLLTEAPLNPLENREQAAQLLFERFGAPAVHIAVQAVLSLYASGMVTGLAVGVGDGVTHAVPVFEGYGLPRAVLRSDVAGRDVTDNLGRILAERGHAFVSSAEWEIVADIKEQVCYVAGDYEKELRR--KPEELAVDYKLPDGQVITLHSQRFRAPELLFSPTIVGLDAPGIHQLVWKSVTRSDIDLRKSLYSNILLSGGSSLFPGLDERLWQELAKLAPRGAPVRIFAPPERKYSVWIGGSILASLSTFQQMWITAPEYKEFGPSVVHRRCL 384          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008200.1 (pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 gene:ENSPMAG00000007412.1 transcript:ENSPMAT00000008200.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 235.728 bits (600), Expect = 6.065e-76
Identity = 124/286 (43.36%), Postives = 178/286 (62.24%), Query Frame = 2
Query:   80 MCKAGFAGDDAPRAVFPSIVGRP--RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFY-NELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYA-SGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKIL-TERGYSF------TTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIR 904
              K G+AG + P  +FP++VGRP  R    +  +  KD  VGD+A   R +L + YP+E+GIV NWDDM+ +W +TF  ++L V   E  +LLTE P+NP  NREK+ ++MFE +   A+Y+AIQAVL+LYA +G  TG+V+DSGDGV+H  P+YEG++LPH   R+D+AGRD+T YL+K+L     Y F       T+AE E V         ++     ++ T     S     +LPDG++I +G ERF  PEALFQP  + +E+ G+ E  +N+I   D+D R
Sbjct:    1 FVKCGYAGSNFPEHIFPALVGRPIIRSTAKVGNIEIKDLMVGDDASELRSMLEVNYPMENGIVRNWDDMKHLWDYTFGPDKLNVNTRECKILLTEPPMNPMKNREKIIEVMFEQYGFSAVYIAIQAVLTLYAQAGLLTGVVVDSGDGVTHICPVYEGFSLPHLTRRLDIAGRDITRYLIKVLWLNHSYFFIPVLFRCTSAEWESVN--------VSSLRRAKLFTIVRVRSFLP--QLPDGRIIKVGGERFEAPEALFQPHLIDVESVGVAELLFNTIQAADIDTR 276          
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003686.1 (pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 gene:ENSPMAG00000003346.1 transcript:ENSPMAT00000003686.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 1.528e-74
Identity = 150/409 (36.67%), Postives = 213/409 (52.08%), Query Frame = 2
Query:   53 ALVVDNGSGMCKAGFAGDDAPRAVFPSI--------VGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEM-QTAASSSSLEKSYE-----LPDGQVITIGNERFRCPEALFQPSFLGME-TAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEIS----------------ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIV-HRKCF 1159
            A  +D  +   K G+AG+  P+ + PS         VG    + VM G+   D ++GDEA  K    T K+PI HGIV +WD ME+      +  LR  PE+H  LLTE PLN   NRE   +IMFE+FN P +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ EGY +   I  + +AGRD+T ++ ++L ER          E  + IKE+  YI  D  +E  +  A  S   K Y            I +G ERF  PE  F P F   + T  I E   N I  C +D+R+ LY N+VLSGGSTM+     R+Q+++                  + P  + +++I    ++Y+VW GGS+LAS   F Q+  +K++Y+E GP I  H   F
Sbjct:    4 ACTLDKKNRYTKIGYAGNTEPQFIIPSCISIKESAKVGDQSQRRVMKGVDDLDFFIGDEAIEKPNYST-KWPIRHGIVEDWDLMERFMEQVIFKYLRAEPEDHYFLLTEPPLNTPENREYTAEIMFESFNIPGLYIAVQAVLALAASWTSRQVGERTLTGTVIDSGDGVTHVIPVAEGYVIGSCIKHIPIAGRDITYFIQQLLREREVGIPPEQSLETAKVIKERFSYICPDIVKEFSKFDADPSKWMKQYTGINAITKKEFTIDVGYERFLGPEIFFHPEFCNPDFTQPISEVVDNVIQNCPIDVRRPLYKNVVLSGGSTMFRDFGRRLQRDLKRTVDSRLKFSEELSGGRIKPKPIDVQVITHHMQRYAVWFGGSMLASTPEFFQVCHTKKDYEEYGPSICRHNPVF 411          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ACT1 (Actin; structural protein involved in cell polarization, endocytosis, and other cytoskeletal functions [Source:SGD;Acc:S000001855])

HSP 1 Score: 716.457 bits (1848), Expect = 0.000e+0
Identity = 330/375 (88.00%), Postives = 361/375 (96.27%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M+ ++AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQG+MVGMGQKDSYVGDEAQSKRGILTL+YPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAP+NPK+NREKMTQIMFETFN PA YV+IQAVLSLY+SGRTTGIVLDSGDGV+H VPIY G++LPHAI R+DLAGRDLTDYLMKIL+ERGYSF+TTAEREIVRDIKEKLCY+ALDFEQEMQTAA SSS+EKSYELPDGQVITIGNERFR PEALF PS LG+E+AGI +TTYNSIMKCDVD+RK+LYGNIV+SGG+TM+PGIA+RMQKEI+ALAP +MK+KIIAPPERKYSVWIGGSILASL+TFQQMWISKQEYDESGP IVH KCF
Sbjct:    1 MDSEVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGIMVGMGQKDSYVGDEAQSKRGILTLRYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPMNPKSNREKMTQIMFETFNVPAFYVSIQAVLSLYSSGRTTGIVLDSGDGVTHVVPIYAGFSLPHAILRIDLAGRDLTDYLMKILSERGYSFSTTAEREIVRDIKEKLCYVALDFEQEMQTAAQSSSIEKSYELPDGQVITIGNERFRAPEALFHPSVLGLESAGIDQTTYNSIMKCDVDVRKELYGNIVMSGGTTMFPGIAERMQKEITALAPSSMKVKIIAPPERKYSVWIGGSILASLTTFQQMWISKQEYDESGPSIVHHKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP1 (Actin-related protein of the dynactin complex; required for spindle orientation and nuclear migration; forms actin-like short filament composed of 9 or 10 Arp1p monomers; putative ortholog of mammalian centractin [Source:SGD;Acc:S000001171])

HSP 1 Score: 363.999 bits (933), Expect = 8.460e-125
Identity = 173/360 (48.06%), Postives = 251/360 (69.72%), Query Frame = 2
Query:   56 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAP-EEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYL-MKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQT-AASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDE 1126
            +V+DNGSG+ KAGF+G++ P+A+   +VG  ++  VM+   Q D+++G+ AQ  RG+L L+YPI+HG+V +WD ME IW +     L++    EHP+L+TEAP+NP  NRE+M Q++FETF+  A+YV+  AVLSLYASGRTTG V+D G+G   TVPIY+G+ALP ++ RMD+ G D+T+ L  ++    G S  +++EREIVR +KEK+CY+A + ++E +     +  L  +++LPDG+ I +GN+R+R PE LF P  +G+   G+ +    SI K D+D+RK L  +I+LSGG+T   G  DRM  ++ AL   T KIKIIAP ERKY+ WIGGSIL  LSTFQ++W  K ++ E
Sbjct:   15 VVIDNGSGIIKAGFSGEERPKALEYCLVGNTKYDKVMLEGLQGDTFIGNNAQKLRGLLKLRYPIKHGVVEDWDSMELIWSYVLNEVLQLQNIGEHPLLITEAPMNPLKNREQMAQVLFETFDVSALYVSNPAVLSLYASGRTTGCVVDCGEGYCSTVPIYDGFALPASMMRMDIGGADITEQLQFQLRKSAGVSLFSSSEREIVRTMKEKVCYLAKNIKKEEEKYLQGTQDLISTFKLPDGRCIEVGNDRYRAPEILFSPQIIGLGYDGLSDMCMQSIWKVDLDLRKPLLSSIILSGGTTTLKGFGDRMLWDLEALTKGTSKIKIIAPSERKYTTWIGGSILTGLSTFQRLWTKKSDWLE 374          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP2 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity; required for efficient Golgi-to-ER trafficking in COPI mutants [Source:SGD;Acc:S000002187])

HSP 1 Score: 363.614 bits (932), Expect = 1.463e-124
Identity = 176/376 (46.81%), Postives = 251/376 (66.76%), Query Frame = 2
Query:   56 LVVDNGSGMCKAGFAGDDAPRAVFPSIVGRP---RHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISAL-------APPT----MKIKIIAPPERKYSVWIGGSILAS-LSTFQQMWISKQEYDESGP 1135
            +V+D G+G  K G AG++ P   FPSIVGRP     +   V    KD  +GDEA   R  L + YP+E+GI+ NW DME +W + F+ ++++    +  +LLTE P+NP  NREKM ++MFE ++   +YVAIQAVL+LYA G ++G+V+DSGDGV+H VP+YE   L H   R+D+AGRD+T +L+ +L+ RGY+F  TA+ E VR IKEKLCY++ D + + + A  +++L +SYELPDG+ I +G ERF  PE LFQP  + +E  G+ E  +N++   DVDIR  LY  IVLSGGS+MYPG+  R++KE+  L         P+     K++I  PP RK+ V+IGG++LAS ++    MW+SKQE+ ESGP
Sbjct:    7 IVLDQGTGFVKIGRAGENFPDYTFPSIVGRPILRAEERASVATPLKDIMIGDEASEVRSYLQISYPMENGIIKNWTDMELLWDYAFFEQMKLPSTSNGKILLTEPPMNPLKNREKMCEVMFEKYDFGGVYVAIQAVLALYAQGLSSGVVVDSGDGVTHIVPVYESVVLSHLTRRLDVAGRDVTRHLIDLLSRRGYAFNRTADFETVRQIKEKLCYVSYDLDLDTKLARETTALVESYELPDGRTIKVGQERFEAPECLFQPGLVDVEQPGVGELLFNTVQSADVDIRSSLYKAIVLSGGSSMYPGLPSRLEKELKQLWFSRVLHNDPSRLDKFKVRIEDPPRRKHMVFIGGAVLASIMADKDHMWLSKQEWQESGP 382          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP3 (Essential component of the Arp2/3 complex; Arp2/3 is a highly conserved actin nucleation center required for the motility and integrity of actin patches; involved in endocytosis and membrane growth and polarity [Source:SGD;Acc:S000003826])

HSP 1 Score: 237.654 bits (605), Expect = 9.178e-75
Identity = 155/440 (35.23%), Postives = 232/440 (52.73%), Query Frame = 2
Query:   53 ALVVDNGSGMCKAGFAGDDAPRAVFP--------------SIVGRP-----------------RHQGVMVGM------GQK-----DSYVGDEA--QSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRT--------TGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTT--TAEREIVRDIKEKLCYIALDFEQEMQTAASSSS-----LEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYN-SIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALA--------------PPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHR 1150
            A+V+DNG+G+ K GFAG+D+P  VFP              S VG P                    G   G+      G++     D Y+G+EA   S+    +L YPI HG V NWD ME+ W ++ +  LR  PE+H  LLTE PLNP  NRE++ +I FE+FN   +Y+A+QAVL+L AS  +        TG V+DSGDGV+H +P+ EGY +  AI  + +AGRD+T ++  +L ERG + T+  TAE+     IK++ CY+  D  +E        S     + ++ E    +V+ IG ERF  PE  F P     +      T  + +I  C +D+RK LY NIVLSGGSTM+     R+Q+++ ++                  + + +I+  +++ +VW GGS+LA  + F+    +K++Y+E GP IV  
Sbjct:    8 AVVMDNGTGLTKLGFAGNDSPSWVFPTAIATAAPSNTKKSSGVGAPSAVSNEASYFGNSTSATNFNGATGGLLSNNLSGKRGTEDLDFYIGNEALVASQGPSYSLSYPIRHGQVENWDHMERFWENSIFKYLRTEPEDHFFLLTEPPLNPPENREQVAEIFFESFNCAGLYIAVQAVLALAASWTSSKVTDRSLTGTVIDSGDGVTHVIPVAEGYVIGSAIKNIPIAGRDITLFIQSLLRERGEADTSLRTAEK-----IKQEYCYVCPDIVKEFNKFDKDPSKFAQFVVENQEKTRRKVVDIGYERFLAPEIFFNPEIASSDFLTPLPTVVDQTIQACPIDVRKGLYNNIVLSGGSTMFKDFGRRLQRDLKSIVNNRIAQSELLSGTKSTGVDVSVISHRKQRNAVWFGGSLLAQTAEFKGYCHTKKDYEEYGPEIVRN 442          
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Match: ARP4 (Nuclear actin-related protein involved in chromatin remodeling; component of chromatin-remodeling enzyme complexes [Source:SGD;Acc:S000003617])

HSP 1 Score: 99.7525 bits (247), Expect = 1.917e-23
Identity = 77/289 (26.64%), Postives = 122/289 (42.21%), Query Frame = 2
Query:   41 EDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEH-PVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKIL-----------TERGYSFTTTA--------------EREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNE-RFRCPEALFQP 826
            ++++A+V+D GS     G++G D P+++ PS+ G+          G K  +        R    LK  IE+G+V +WD  ++ W     NEL +      P LLTE   N   NR+K  +++ E     A Y+A  +    +A+GR   +V+D G       PI +G  L  +  R  +AG+ +   + K L            +R   F                   R   ++ KE LC+I      E      SS+ ++S E P  + I   NE R+   E LF P
Sbjct:   12 DEVSAVVIDPGSYTTNIGYSGSDFPQSILPSVYGK-----YTADEGNKKIFSEQSIGIPRKDYELKPIIENGLVIDWDTAQEQWQWALQNELYLNSNSGIPALLTEPVWNSTENRKKSLEVLLEGMQFEACYLAPTSTCVSFAAGRPNCLVVDIGHDTCSVSPIVDGMTLSKSTRRNFIAGKFINHLIKKALEPKEIIPLFAIKQRKPEFIKKTFDYEVDKSLYDYANNRGFFQECKETLCHICPTKTLEETKTELSSTAKRSIESPWNEEIVFDNETRYGFAEELFLP 295          

HSP 2 Score: 97.4413 bits (241), Expect = 1.140e-22
Identity = 53/146 (36.30%), Postives = 83/146 (56.85%), Query Frame = 2
Query:  704 EQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPP---ERKYSVWIGGSILASLSTFQQMWISKQEYDESG 1132
            E+E +  + S+S       P        NE  + P    +P     E  G+ +  Y+SIM  DVD+R  L  N+VL+GG++  PG++DR+  E++ +  P++K +I+      ER+Y  W+GGSIL SL TF Q+W+ K+EY+E G
Sbjct:  342 EKEQEAVSKSTS-------PAANSADTPNETGKRPLEEEKPPKENNELIGLADLVYSSIMSSDVDLRATLAHNVVLTGGTSSIPGLSDRLMTELNKIL-PSLKFRILTTGHTIERQYQSWLGGSILTSLGTFHQLWVGKKEYEEVG 479          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO45013 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RU31])

HSP 1 Score: 764.222 bits (1972), Expect = 0.000e+0
Identity = 360/375 (96.00%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+++AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDEVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO42646 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0V7])

HSP 1 Score: 761.911 bits (1966), Expect = 0.000e+0
Identity = 358/375 (95.47%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M++D+AALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM+TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEI++LAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDDVAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAIIRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMETAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38520 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCN8])

HSP 1 Score: 761.14 bits (1964), Expect = 0.000e+0
Identity = 360/374 (96.26%), Postives = 369/374 (98.66%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMTTAASSSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO38006 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEB1])

HSP 1 Score: 760.755 bits (1963), Expect = 0.000e+0
Identity = 359/375 (95.73%), Postives = 369/375 (98.40%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+D+AALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKL Y+ALDFEQEM TAA+SSSLEKSYELPDGQVITIGNERFRCPEA+FQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGGSTM+PGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDDVAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLAYVALDFEQEMATAAASSSLEKSYELPDGQVITIGNERFRCPEAMFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGSTMFPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Match: EDO37976 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEA7])

HSP 1 Score: 756.133 bits (1951), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ++DIAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSS+EKSYELPDGQVITIGNERFRCPEAL QPSFLGME++GIHETTYNSIMKCDVDIRKDLY N V+SGG+TMYPG+ADRMQKEISALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 DDDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSIEKSYELPDGQVITIGNERFRCPEALLQPSFLGMESSGIHETTYNSIMKCDVDIRKDLYANTVMSGGTTMYPGLADRMQKEISALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000021726.2 (actin, cytoplasmic [Source:NCBI gene;Acc:101155523])

HSP 1 Score: 766.533 bits (1978), Expect = 0.000e+0
Identity = 362/375 (96.53%), Postives = 371/375 (98.93%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            ME+D++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGVSHTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEDDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVSHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPAIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 358/375 (95.47%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M++DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    3 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 377          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000011677.2 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 757.288 bits (1954), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:   36 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 410          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: actb (cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:100049433])

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 358/375 (95.47%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            M++DIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELR+APEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETTYNSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MDDDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRIAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTYNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPSTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Match: ENSORLT00000029375.1 (actin, cytoplasmic 2 [Source:NCBI gene;Acc:101168921])

HSP 1 Score: 755.747 bits (1950), Expect = 0.000e+0
Identity = 357/375 (95.20%), Postives = 368/375 (98.13%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEE+IAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIV+DSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+ GIHETT+NSIMKCDVDIRKDLY N VLSGG+TMYPGIADRMQKEI+ALAP TMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGP IVHRKCF
Sbjct:    1 MEEEIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVMDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMGTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESCGIHETTFNSIMKCDVDIRKDLYANTVLSGGTTMYPGIADRMQKEITALAPTTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000012332.1 (SMESG000012332.1)

HSP 1 Score: 784.252 bits (2024), Expect = 0.000e+0
Identity = 375/375 (100.00%), Postives = 375/375 (100.00%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000012317.1 (SMESG000012317.1)

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 372/375 (99.20%), Postives = 373/375 (99.47%), Query Frame = 2
Query:   35 MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            MEEDIAALV+DNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    1 MEEDIAALVIDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYSNTVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 375          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000066020.1 (SMESG000066020.1)

HSP 1 Score: 758.829 bits (1958), Expect = 0.000e+0
Identity = 357/374 (95.45%), Postives = 369/374 (98.66%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +ED++ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGME+AGIHETT+NSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEI++LAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    3 DEDVSALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNAPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMSTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITSLAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000066029.1 (SMESG000066029.1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+AGIHETT+NSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEI+ALAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    3 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Match: SMESG000066027.1 (SMESG000066027.1)

HSP 1 Score: 756.518 bits (1952), Expect = 0.000e+0
Identity = 356/374 (95.19%), Postives = 368/374 (98.40%), Query Frame = 2
Query:   38 EEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTGIVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITIGNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLSGGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 1159
            +E++ ALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFN+PAMYVAIQAVLSLYASGRTTGIVLDSGDGV+HTVPIYEGYALPHAI R+DLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCY+ALDFEQEM TAASSSSLEKSYELPDGQVITIGNERFRCPE+LFQPSFLGME+AGIHETT+NSIMKCDVDIRKDLY N VLSGGSTMYPGIADRMQKEI+ALAP TMKIKI+APPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF
Sbjct:    3 DEEVTALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQKDSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEEHPVLLTEAPLNPKANREKMTQIMFETFNTPAMYVAIQAVLSLYASGRTTGIVLDSGDGVTHTVPIYEGYALPHAILRLDLAGRDLTDYLMKILTERGYSFTTTAEREIVRDIKEKLCYVALDFEQEMATAASSSSLEKSYELPDGQVITIGNERFRCPESLFQPSFLGMESAGIHETTFNSIMKCDVDIRKDLYANTVLSGGSTMYPGIADRMQKEITALAPSTMKIKIVAPPERKYSVWIGGSILASLSTFQQMWISKQEYDESGPGIVHRKCF 376          
The following BLAST results are available for this feature:
BLAST of Actin, cytoplasmic vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ACTG10.000e+095.20actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.20actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.20actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.20actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
ACTG10.000e+095.20actin gamma 1 [Source:HGNC Symbol;Acc:HGNC:144][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
act-20.000e+094.92Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+094.92Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-20.000e+094.92Actin-2 [Source:UniProtKB/Swiss-Prot;Acc:P10984][more]
act-40.000e+094.39Actin-4 [Source:UniProtKB/Swiss-Prot;Acc:P10986][more]
act-30.000e+094.12Actin-3 [Source:UniProtKB/Swiss-Prot;Acc:P0DM42][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Act5C0.000e+095.72gene:FBgn0000042 transcript:FBtr0070822[more]
Act5C0.000e+095.72gene:FBgn0000042 transcript:FBtr0100662[more]
Act5C0.000e+095.72gene:FBgn0000042 transcript:FBtr0345894[more]
Act5C0.000e+095.72gene:FBgn0000042 transcript:FBtr0070823[more]
Act5C0.000e+095.72gene:FBgn0000042 transcript:FBtr0100663[more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+094.93actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb10.000e+094.93actin, beta 1 [Source:NCBI gene;Acc:57934][more]
actb20.000e+094.67actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+094.67actin, beta 2 [Source:NCBI gene;Acc:57935][more]
actb20.000e+094.67actin, beta 2 [Source:NCBI gene;Acc:57935][more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb0.000e+095.47actin, beta [Source:NCBI gene;Acc:407952][more]
actg10.000e+095.20actin gamma 1 [Source:NCBI gene;Acc:394957][more]
acta20.000e+092.51actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
acta20.000e+092.51actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
acta20.000e+092.51actin, alpha 2, smooth muscle, aorta [Source:NCBI ... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Actg10.000e+095.20actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actg10.000e+095.20actin, gamma, cytoplasmic 1 [Source:MGI Symbol;Acc... [more]
Actb0.000e+095.20actin, beta [Source:MGI Symbol;Acc:MGI:87904][more]
Acta20.000e+092.78actin, alpha 2, smooth muscle, aorta [Source:MGI S... [more]
Actg20.000e+092.25actin, gamma 2, smooth muscle, enteric [Source:MGI... [more]
back to top
BLAST of Actin, cytoplasmic vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P12716|ACTC_PISOC0.000e+096.26Actin, cytoplasmic OS=Pisaster ochraceus OX=7612 P... [more]
sp|Q964E1|ACTC_BIOOB0.000e+096.26Actin, cytoplasmic OS=Biomphalaria obstructa OX=15... [more]
sp|O17320|ACT_CRAGI0.000e+095.72Actin OS=Crassostrea gigas OX=29159 PE=2 SV=1[more]
sp|Q964E0|ACTC_BIOTE0.000e+095.72Actin, cytoplasmic OS=Biomphalaria tenagophila OX=... [more]
sp|Q93131|ACTC_BRAFL0.000e+095.20Actin, cytoplasmic OS=Branchiostoma floridae OX=77... [more]
back to top
BLAST of Actin, cytoplasmic vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2MSI70.000e+096.53Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3P9H8Q50.000e+096.53Uncharacterized protein OS=Oryzias latipes OX=8090... [more]
A0A3P9C9Q60.000e+096.27Uncharacterized protein OS=Maylandia zebra OX=1065... [more]
A0A3B3C4C30.000e+096.53Uncharacterized protein OS=Oryzias melastigma OX=3... [more]
A0A3B3C3C20.000e+096.53Uncharacterized protein OS=Oryzias melastigma OX=3... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
actb10.000e+094.93actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
actb20.000e+094.67actin beta [Source:NCBI gene;Acc:103030443][more]
actb10.000e+095.16actin, cytoplasmic 1 [Source:NCBI gene;Acc:1030395... [more]
acta20.000e+092.25actin alpha 2, smooth muscle [Source:NCBI gene;Acc... [more]
zgc:867090.000e+091.98actin, alpha cardiac muscle 1 [Source:NCBI gene;Ac... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000011113.10.000e+095.45pep scaffold:Pmarinus_7.0:GL498954:115:1245:1 gene... [more]
ENSPMAT00000004586.10.000e+094.92pep scaffold:Pmarinus_7.0:GL479516:23873:27955:-1 ... [more]
ENSPMAT00000011230.19.371e-16354.59pep scaffold:Pmarinus_7.0:GL476986:121012:122166:1... [more]
ENSPMAT00000008200.16.065e-7643.36pep scaffold:Pmarinus_7.0:GL477804:3783:17322:1 ge... [more]
ENSPMAT00000003686.11.528e-7436.67pep scaffold:Pmarinus_7.0:GL476472:70600:102044:1 ... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ACT10.000e+088.00Actin; structural protein involved in cell polariz... [more]
ARP18.460e-12548.06Actin-related protein of the dynactin complex; req... [more]
ARP21.463e-12446.81Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP39.178e-7535.23Essential component of the Arp2/3 complex; Arp2/3 ... [more]
ARP41.917e-2326.64Nuclear actin-related protein involved in chromati... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO450130.000e+096.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO426460.000e+095.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO385200.000e+096.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO380060.000e+095.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379760.000e+095.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Actin, cytoplasmic vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000021726.20.000e+096.53actin, cytoplasmic [Source:NCBI gene;Acc:101155523... [more]
actb0.000e+095.47cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000011677.20.000e+095.20actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
actb0.000e+095.47cytoplasmic actin OlCA1 [Source:NCBI gene;Acc:1000... [more]
ENSORLT00000029375.10.000e+095.20actin, cytoplasmic 2 [Source:NCBI gene;Acc:1011689... [more]
back to top
BLAST of Actin, cytoplasmic vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012332.10.000e+0100.00SMESG000012332.1[more]
SMESG000012317.10.000e+099.20SMESG000012317.1[more]
SMESG000066020.10.000e+095.45SMESG000066020.1[more]
SMESG000066029.10.000e+095.19SMESG000066029.1[more]
SMESG000066027.10.000e+095.19SMESG000066027.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016078 ID=SMED30016078|Name=Actin, cytoplasmic|organism=Schmidtea mediterranea sexual|type=transcript|length=1181bp
TTCCGATCTAAAATAATAAAATTACTTATTCTAAATGGAAGAAGATATTG
CCGCACTTGTTGTAGATAATGGATCTGGTATGTGTAAAGCTGGGTTTGCT
GGAGATGACGCACCAAGAGCTGTGTTTCCGTCAATTGTTGGTCGACCCAG
GCATCAAGGTGTCATGGTTGGAATGGGTCAAAAAGACAGCTATGTTGGTG
ATGAGGCCCAATCAAAAAGAGGTATCCTAACGTTGAAATACCCAATTGAG
CACGGTATTGTGACTAATTGGGATGATATGGAAAAAATCTGGCATCACAC
ATTCTATAATGAACTGAGAGTAGCACCAGAAGAACATCCAGTTTTGCTTA
CTGAAGCGCCGTTGAATCCCAAGGCGAACCGCGAAAAAATGACTCAAATA
ATGTTTGAAACCTTCAATTCGCCGGCTATGTATGTCGCAATTCAAGCCGT
TCTCTCATTGTATGCGTCTGGGCGTACAACGGGTATCGTTCTCGATTCTG
GAGATGGTGTATCGCATACCGTGCCGATTTATGAAGGGTATGCGTTACCT
CACGCCATTTGCAGAATGGATTTGGCTGGAAGAGATTTGACCGATTATTT
AATGAAAATACTAACAGAAAGAGGTTACAGTTTTACAACTACAGCCGAAA
GAGAAATTGTCCGAGATATTAAAGAAAAATTGTGTTATATTGCTCTTGAT
TTTGAGCAAGAAATGCAAACTGCGGCCTCTTCATCTTCACTGGAAAAAAG
TTACGAACTACCAGATGGACAAGTTATTACTATTGGAAATGAAAGATTCA
GATGTCCAGAAGCTTTGTTTCAGCCATCGTTCTTGGGAATGGAAACAGCT
GGTATTCATGAAACTACTTATAATAGCATAATGAAATGCGATGTGGATAT
CCGTAAAGATTTGTATGGAAACATTGTGTTGTCTGGAGGTTCAACTATGT
ATCCTGGTATTGCTGATCGTATGCAGAAAGAAATATCAGCCCTGGCTCCA
CCTACAATGAAAATTAAAATTATTGCACCTCCAGAAAGAAAATATTCTGT
ATGGATTGGTGGGTCAATTCTAGCTTCACTGTCAACCTTCCAGCAAATGT
GGATTTCCAAGCAAGAATATGATGAATCGGGTCCAGGAATTGTTCATAGA
AAATGTTTTTAATTCTTTATTAAACACTTGT
back to top

protein sequence of SMED30016078-orf-1

>SMED30016078-orf-1 ID=SMED30016078-orf-1|Name=SMED30016078-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=376bp
MEEDIAALVVDNGSGMCKAGFAGDDAPRAVFPSIVGRPRHQGVMVGMGQK
DSYVGDEAQSKRGILTLKYPIEHGIVTNWDDMEKIWHHTFYNELRVAPEE
HPVLLTEAPLNPKANREKMTQIMFETFNSPAMYVAIQAVLSLYASGRTTG
IVLDSGDGVSHTVPIYEGYALPHAICRMDLAGRDLTDYLMKILTERGYSF
TTTAEREIVRDIKEKLCYIALDFEQEMQTAASSSSLEKSYELPDGQVITI
GNERFRCPEALFQPSFLGMETAGIHETTYNSIMKCDVDIRKDLYGNIVLS
GGSTMYPGIADRMQKEISALAPPTMKIKIIAPPERKYSVWIGGSILASLS
TFQQMWISKQEYDESGPGIVHRKCF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000012neural progenitor cell
PLANA:0000016pharynx
PLANA:0000017photoreceptor neuron
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000110pharynx progenitor cell
PLANA:0000418head
PLANA:0000429neoblast
PLANA:0000463cholinergic neuron
PLANA:0000484secretory system
PLANA:0002032epidermal cell
PLANA:0002075pigment cell
PLANA:0002111X2 cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR043129ATPase_NBD
IPR004000Actin
IPR020902Actin/actin-like_CS
IPR004001Actin_CS
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0005524ATP binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR004000Actin familyPRINTSPR00190ACTINcoord: 140..159
score: 96.3
coord: 26..35
score: 96.55
coord: 115..128
score: 97.31
coord: 236..252
score: 91.95
coord: 61..83
score: 94.91
coord: 49..60
score: 92.79
IPR004000Actin familySMARTSM00268actin_3coord: 5..375
e-value: 1.2E-244
score: 828.8
IPR004000Actin familyPFAMPF00022Actincoord: 4..375
e-value: 1.7E-151
score: 504.5
IPR004000Actin familyPANTHERPTHR11937ACTINcoord: 4..373
NoneNo IPR availableGENE3DG3DSA:3.90.640.10coord: 180..272
e-value: 3.1E-192
score: 640.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 138..338
e-value: 3.1E-192
score: 640.0
NoneNo IPR availableGENE3DG3DSA:3.30.420.40coord: 8..371
e-value: 3.1E-192
score: 640.0
NoneNo IPR availablePANTHERPTHR11937:SF415coord: 4..373
NoneNo IPR availableCDDcd00012NBD_sugar-kinase_HSP70_actincoord: 8..181
e-value: 3.15373E-20
score: 85.3331
IPR004001Actin, conserved sitePROSITEPS00432ACTINS_2coord: 356..364
IPR004001Actin, conserved sitePROSITEPS00406ACTINS_1coord: 53..63
IPR020902Actin/actin-like conserved sitePROSITEPS01132ACTINS_ACT_LIKEcoord: 104..116
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 4..153
IPR043129ATPase, nucleotide binding domainSUPERFAMILYSSF53067Actin-like ATPase domaincoord: 147..375