Epidermal growth factor-8

Overview
NameEpidermal growth factor-8
Smed IDSMED30016070
Length (bp)2339
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Epidermal growth factor-8 (SMED30016070) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Epidermal growth factor-8 (SMED30016070) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016070

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
cephalic gangliaSMED30016070h1SMcG0016770 dd_Smed_v4_5631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016070h1SMcG0016770 dd_Smed_v4_5631_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A161HX36 (Epidermal growth factor-8 OS=Schmidtea mediterranea OX=79327 GN=egf-8 PE=2 SV=1)

HSP 1 Score: 112.464 bits (280), Expect = 4.958e-40
Identity = 55/133 (41.35%), Postives = 82/133 (61.65%), Query Frame = 2
Query:  329 LKKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLL-------TTKKPTFSTSQQ 706
            +  ISI V++DD DS    DHIAKF+  F ++  G++ +K++ V P + +V LQAS+S KC+  YYG  C++  +++ C   CINGKC +N +K  FFC C   W G+ CN+ +       +TK PT  TSQ+
Sbjct:  103 INSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFICNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQR 235          

HSP 2 Score: 83.9593 bits (206), Expect = 4.958e-40
Identity = 34/79 (43.04%), Postives = 53/79 (67.09%), Query Frame = 3
Query:   78 VIIRQNDGNIFLNVRLFNYKNPSDVRYDGRNCEKFYWAGDYCDPVFRICISAKQKCDLLNKKTNVFNNMKEIFTVFTES 314
            ++I        L V ++NY+N  D+++D + CE F+WA D+CDP+F ICI+ K  CD+    TNVF+N K+I+ VFT++
Sbjct:   18 ILISPITTKAILKVYIYNYQNHEDMKHDEKKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQT 96          
BLAST of Epidermal growth factor-8 vs. TrEMBL
Match: A0A419QGW3 (EGF-like domain-containing protein OS=Clonorchis sinensis OX=79923 GN=CSKR_5660s PE=4 SV=1)

HSP 1 Score: 40.817 bits (94), Expect = 9.432e-6
Identity = 25/84 (29.76%), Postives = 42/84 (50.00%), Query Frame = 3
Query:   75 MVIIRQNDGNIFLNVRLFNYKNPSDVRYDGRNCEKFYWAGDYCDPVFRICI----SAKQKCDLLNKKTNVFNNMKEIFTVFTES 314
            +++  + + N+ L VR +  KN  D R   R CE   + GD CDP+F++ +    S  ++  LL ++   F N K +  V   S
Sbjct:    9 LLLSARAEVNLLLTVRNYENKNNLDSRL--RKCEALSFLGDNCDPIFQLTVHVTNSRNERHLLLRREAGPFTNKKVLKEVLQTS 90          

HSP 2 Score: 40.0466 bits (92), Expect = 9.432e-6
Identity = 31/120 (25.83%), Postives = 47/120 (39.17%), Query Frame = 2
Query:  338 ISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCD-------------KDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKC 658
            I I + I D D+ D    IA+F+ I  L   G L  +        S V+++  +  +C+  YYG  C+                    C K CI G C+      +  C+C   W+G  C
Sbjct:  100 IEIALDIYDNDA-DEDQLIARFRRIIPLLKTGQLDLQM------GSDVKVKVLLKVECATNYYGERCEIYCQPSPQLWTCNSLTGARMCNKPCIQGSCVLT--NTSAVCVCAPGWSGEFC 210          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077699.1 (SMESG000077699.1)

HSP 1 Score: 1182.55 bits (3058), Expect = 0.000e+0
Identity = 643/643 (100.00%), Postives = 643/643 (100.00%), Query Frame = 2
Query:  332 KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDXXXXXXXXXXXXXXXXXXXFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLSSNFVISSTENSLNKHKVKTITFNKQGFAFNDIDEKYTSSISKKANSVTFNIKHFSKFSTHIPYVNKFNFNTSDKHXXXXXXXXXXXXXXFAFKKNQMSNKYKLFTTSSQPSVLTKGNDVHKKTAIQLISYKFNLSAFTSKIINQNSITKINKIYLETSNKSVNLTESNFNNASFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCXXXXXXXXXXRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC 2260
            KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDISISKKSSKSSKPFKIIYIFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLSSNFVISSTENSLNKHKVKTITFNKQGFAFNDIDEKYTSSISKKANSVTFNIKHFSKFSTHIPYVNKFNFNTSDKHILSSKSSLKVSTTIFAFKKNQMSNKYKLFTTSSQPSVLTKGNDVHKKTAIQLISYKFNLSAFTSKIINQNSITKINKIYLETSNKSVNLTESNFNNASFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCLIIMLIIIVIRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC
Sbjct:   19 KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDISISKKSSKSSKPFKIIYIFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLSSNFVISSTENSLNKHKVKTITFNKQGFAFNDIDEKYTSSISKKANSVTFNIKHFSKFSTHIPYVNKFNFNTSDKHILSSKSSLKVSTTIFAFKKNQMSNKYKLFTTSSQPSVLTKGNDVHKKTAIQLISYKFNLSAFTSKIINQNSITKINKIYLETSNKSVNLTESNFNNASFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCLIIMLIIIVIRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC 661          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077699.1 (SMESG000077699.1)

HSP 1 Score: 583.563 bits (1503), Expect = 0.000e+0
Identity = 312/314 (99.36%), Postives = 314/314 (100.00%), Query Frame = 2
Query:  332 KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDXXXXXXXXXXXXXXXXXXXFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLSSNF 1273
            KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDISISKKSSKSSKPFKIIYIFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLS++F
Sbjct:   19 KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNFKKDLVKTTDISISKKSSKSSKPFKIIYIFTTPSKQIHNSTKFYKKINTKHISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSKFTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSVNPNLSSSKIHQNLKSTQLLSTSF 332          

HSP 2 Score: 312.383 bits (799), Expect = 1.212e-97
Identity = 164/178 (92.13%), Postives = 167/178 (93.82%), Query Frame = 2
Query: 1727 LETSNKSVNLTESNFNNASFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCXXXXXXXXXXRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC 2260
            L +S    NL  +   + SFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCLIIMLIIIVIRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC
Sbjct:  313 LSSSKIHQNLKSTQLLSTSFTYLRMSVLKLLNQTFHNKYLIAICGAFWFCLIIMLIIIVIRKKQRINKFDTNKFIYRHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNNDDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFSNC 490          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 113.235 bits (282), Expect = 2.822e-43
Identity = 55/133 (41.35%), Postives = 82/133 (61.65%), Query Frame = 2
Query:  329 LKKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLL-------TTKKPTFSTSQQ 706
            +  ISI V++DD DS    DHIAKF+  F ++  G++ +K++ V P + +V LQAS+S KC+  YYG  C++  +++ C   CINGKC +N +K  FFC C   W G+ CN+ +       +TK PT  TSQ+
Sbjct:  103 INSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQR 235          

HSP 2 Score: 82.8037 bits (203), Expect = 2.822e-43
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 3
Query:   78 VIIRQNDGNIFLNVRLFNYKNPSDVRYDGRNCEKFYWAGDYCDPVFRICISAKQKCDLLNKKTNVFNNMKEIFTVFTES 314
            ++I        L V ++NY+N  D+++D   CE F+WA D+CDP+F ICI+ K  CD+    TNVF+N K+I+ VFT++
Sbjct:   18 ILISPITTKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQT 96          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077702.1 (SMESG000077702.1)

HSP 1 Score: 113.235 bits (282), Expect = 3.248e-43
Identity = 55/133 (41.35%), Postives = 82/133 (61.65%), Query Frame = 2
Query:  329 LKKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKCNQLL-------TTKKPTFSTSQQ 706
            +  ISI V++DD DS    DHIAKF+  F ++  G++ +K++ V P + +V LQAS+S KC+  YYG  C++  +++ C   CINGKC +N +K  FFC C   W G+ CN+ +       +TK PT  TSQ+
Sbjct:  101 INSISISVRVDDVDSGGISDHIAKFRTSFNIETPGLIDRKTMSVEPANVKVSLQASVSVKCALNYYGNKCEERSDKFTCNSSCINGKCNFNYQKDTFFCQCYNGWDGINCNKSIFINNLSSSTKLPTKHTSQR 233          

HSP 2 Score: 82.8037 bits (203), Expect = 3.248e-43
Identity = 34/79 (43.04%), Postives = 52/79 (65.82%), Query Frame = 3
Query:   78 VIIRQNDGNIFLNVRLFNYKNPSDVRYDGRNCEKFYWAGDYCDPVFRICISAKQKCDLLNKKTNVFNNMKEIFTVFTES 314
            ++I        L V ++NY+N  D+++D   CE F+WA D+CDP+F ICI+ K  CD+    TNVF+N K+I+ VFT++
Sbjct:   16 ILISPITTKAILKVYIYNYQNHEDMKHDKNKCETFHWANDHCDPIFEICITEKSLCDVFKTTTNVFDNSKKIYNVFTQT 94          
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Match: SMESG000077703.1 (SMESG000077703.1)

HSP 1 Score: 85.5001 bits (210), Expect = 1.507e-32
Identity = 37/88 (42.05%), Postives = 59/88 (67.05%), Query Frame = 3
Query:   63 FVYLMVII-RQNDGNIFLNVRLFNYKNPSDVRYDGRNCEKFYWAGDYCDPVFRICISAKQKCDLLNKKTNVFNNMKEIFTVFTESIPL 323
            F+Y+++ I  Q      L + + NYKN +++++DG  CE F WA D CDP+F+IC++AK  CD+LNKK + + N K ++TV ++ I L
Sbjct:   12 FLYILLQINHQTKAKAVLTIHILNYKNYANLKHDGNKCETFDWANDNCDPMFQICVTAKNPCDILNKKIDHWPNAKTLYTVLSQKIEL 99          

HSP 2 Score: 74.7146 bits (182), Expect = 1.507e-32
Identity = 36/109 (33.03%), Postives = 59/109 (54.13%), Query Frame = 2
Query:  332 KKISIEVKIDDEDSYDNIDHIAKFQGIFYLQAVGILSQKSLMVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNERKKAFFCLCDKTWTGLKC 658
            +K+S+ V++DD D +D  DHIA F   F ++ + +  ++ + + P +  + LQ S+  KC+  YYG  C+K   +  C + CI+GKC +N  K    C C   W    C
Sbjct:  104 RKLSVIVQVDDHDRFDAPDHIAIFTTSFQIKDLNVFYKQKMQIKPKNLDISLQTSVMIKCADSYYGNNCEKKRTQ--CKQSCIHGKCSFNIEKNQETCECFSGWDLPNC 210          
The following BLAST results are available for this feature:
BLAST of Epidermal growth factor-8 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 2
Match NameE-valueIdentityDescription
A0A161HX364.958e-4041.35Epidermal growth factor-8 OS=Schmidtea mediterrane... [more]
A0A419QGW39.432e-629.76EGF-like domain-containing protein OS=Clonorchis s... [more]
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Epidermal growth factor-8 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000077699.10.000e+0100.00SMESG000077699.1[more]
SMESG000077699.11.212e-9799.36SMESG000077699.1[more]
SMESG000077702.12.822e-4341.35SMESG000077702.1[more]
SMESG000077702.13.248e-4341.35SMESG000077702.1[more]
SMESG000077703.11.507e-3242.05SMESG000077703.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016070 ID=SMED30016070|Name=Epidermal growth factor-8|organism=Schmidtea mediterranea sexual|type=transcript|length=2339bp
TCGAACTTTGCATTATTAATAAATAATTGTAGTCATTATCAATGAAACTA
ATTATAATTCTTTTTGTATATTTAATGGTTATAATTCGACAAAATGATGG
AAATATCTTTCTCAATGTTCGCTTGTTTAATTACAAAAATCCATCTGATG
TTCGTTATGATGGTCGAAATTGTGAAAAGTTTTATTGGGCAGGTGATTAT
TGTGATCCAGTTTTTCGGATATGTATATCAGCAAAACAAAAGTGTGATCT
TTTAAACAAAAAGACAAATGTATTCAATAATATGAAAGAAATATTTACTG
TATTCACTGAAAGTATTCCATTAATTGTTTGAAGAAAATATCAATTGAAG
TAAAGATTGATGATGAAGACAGCTATGATAACATTGATCATATAGCAAAG
TTTCAAGGAATATTTTATTTACAAGCGGTTGGCATTTTGTCTCAGAAAAG
TTTAATGGTTAATCCTCCTAGTTCAAGGGTTCGATTGCAAGCATCTATTT
CCACGAAATGTTCGCCAGGTTATTATGGGGCTCTTTGTGATAAAGATTAT
AATGAATATAAATGCATCAAAGACTGTATAAATGGAAAATGTCTGTGGAA
TGAAAGAAAAAAAGCATTTTTTTGTTTGTGTGATAAAACATGGACTGGCT
TAAAATGTAATCAACTTCTAACAACTAAAAAGCCAACTTTCTCTACGAGT
CAACAAACAAAAGATTTGAGGCTGAATATATCGAAAATCAAATTTCTTAA
TTTTAAAAAAGATCTTGTTAAAACAACAGATATATCTATTTCTAAAAAAA
GCTCTAAATCATCAAAGCCATTCAAAATAATTTATATATTTACGACTCCT
TCAAAACAAATTCACAATTCTACAAAATTTTACAAGAAAATAAATACTAA
ACATATTTCTAATTTCAGTACGAATATCAGTTCTTTAAAACCTATTTCAA
CACCTATTAATATTAATGTTTTCAATCAAAAAACAAAAACACAAAAGTTA
GACTATGCCACTTCAAGCTCAGCAACTATTTCAACAAAACCTTTGAGTTC
AAAATTTACTTCGGCAATGGAATCTCTTTTCAATTTTAAACTATATAAAG
AAAATTATGCGAAAAAATTTGATAAAAATCTTATTTTTCGCAAAGAATCA
GTAAGTCCTGAAATATACAGAGTCAACAGTTTTACTAAACCTAGTACATC
TGTAAATCCAAATTTATCAAGCTCAAAGATTCATCAAAATTTAAAATCAA
CTCAACTACTTTCAAGTAATTTTGTCATAAGTAGTACAGAGAATTCCCTA
AATAAACACAAAGTAAAGACAATAACTTTTAATAAACAAGGATTCGCTTT
CAATGATATAGATGAAAAATACACATCATCTATCTCAAAAAAAGCAAATT
CTGTGACATTCAATATAAAACATTTTTCAAAATTCAGTACTCACATTCCA
TATGTTAACAAATTTAATTTCAACACTTCTGACAAGCATATTCTTTCTTC
AAAATCAAGTTTGAAAGTTTCAACAACAATTTTTGCTTTTAAGAAAAATC
AAATGTCTAATAAATACAAGTTATTTACAACTTCTTCACAACCGTCAGTC
TTGACCAAAGGAAATGACGTTCATAAAAAAACAGCAATTCAATTAATATC
TTATAAATTTAATTTATCTGCATTCACAAGTAAAATTATTAACCAAAACT
CCATTACCAAAATTAACAAAATTTATCTTGAGACATCGAATAAATCAGTT
AATTTAACTGAATCTAATTTCAATAATGCATCTTTCACATATCTTCGAAT
GTCAGTTTTGAAATTATTAAATCAGACATTCCACAATAAATATTTAATTG
CGATTTGTGGCGCATTTTGGTTCTGTTTGATTATAATGCTAATCATTATT
GTTATTCGTAAAAAACAAAGAATAAATAAATTTGATACAAACAAATTCAT
ATATCGTCACCAAAAGGCACCTACTACAAATTACCATGAACCTGATTTAG
AAAGCGAAGAAGTAAATATTATACAAACGACAAATCCGAGTATTCCTTTC
AAGTCAAAAATTCTAACTCAAAAACCTGCAACCGAAATTAACAATAAAAA
CAACGATGACAGTAATGAGTATGAGACTATTTTGAGAAATCTCAACAATC
CGAACACCGAGAGTTATGTGAGATTGACTTATTTTTCAAAGACAAGTGAA
AAACCTGAAAAAAATGAAAATTTTCGGCCGACAAATAATACAAAAGATTT
TTCCAATTGTTAACATTAAACTAAAAACTCTTTGTTTGGATTTTATAGTT
ACCTCAATATTTGCTGAAAAAGATATAATTACATGAAAC
back to top

protein sequence of SMED30016070-orf-1

>SMED30016070-orf-1 ID=SMED30016070-orf-1|Name=SMED30016070-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=603bp
MVNPPSSRVRLQASISTKCSPGYYGALCDKDYNEYKCIKDCINGKCLWNE
RKKAFFCLCDKTWTGLKCNQLLTTKKPTFSTSQQTKDLRLNISKIKFLNF
KKDLVKTTDISISKKSSKSSKPFKIIYIFTTPSKQIHNSTKFYKKINTKH
ISNFSTNISSLKPISTPININVFNQKTKTQKLDYATSSSATISTKPLSSK
FTSAMESLFNFKLYKENYAKKFDKNLIFRKESVSPEIYRVNSFTKPSTSV
NPNLSSSKIHQNLKSTQLLSSNFVISSTENSLNKHKVKTITFNKQGFAFN
DIDEKYTSSISKKANSVTFNIKHFSKFSTHIPYVNKFNFNTSDKHILSSK
SSLKVSTTIFAFKKNQMSNKYKLFTTSSQPSVLTKGNDVHKKTAIQLISY
KFNLSAFTSKIINQNSITKINKIYLETSNKSVNLTESNFNNASFTYLRMS
VLKLLNQTFHNKYLIAICGAFWFCLIIMLIIIVIRKKQRINKFDTNKFIY
RHQKAPTTNYHEPDLESEEVNIIQTTNPSIPFKSKILTQKPATEINNKNN
DDSNEYETILRNLNNPNTESYVRLTYFSKTSEKPEKNENFRPTNNTKDFS
NC*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR013032EGF-like_CS
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 7..73
e-value: 1.1E-6
score: 30.7
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 582..602
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 36..71
NoneNo IPR availableTMHMMTMhelixcoord: 463..485
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 57..68