Low density lipoprotein-receptor, class A,domain-containing protein

Overview
NameLow density lipoprotein-receptor, class A,domain-containing protein
Smed IDSMED30016063
Length (bp)720
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30016063) t-SNE clustered cells

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30016063) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Low density lipoprotein-receptor, class A,domain-containing protein (SMED30016063) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Low density lipoprotein-receptor, class A,domain-containing protein (SMED30016063) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016063

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016063SMESG000076971.1 dd_Smed_v4_3970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016063SMESG000076971.1 dd_Smed_v4_3970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30016063SMESG000076971.1 dd_Smed_v4_3970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016063SMESG000076971.1 dd_Smed_v4_3970_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30016063SMESG000076971.1 dd_Smed_v6_3970_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 60.8474 bits (146), Expect = 3.028e-11
Identity = 45/156 (28.85%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  227 CPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFL-----MKWKDSLIPKVFG----------NGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            CP   P+ C SG C+   ++CD   DC D+YDE+ ++C A  RPPV   + FL        KD L+ KVFG           G+ K +A  L ++ T   +     L + + ++  +VME +  N   D L          D     ++  ++GF 
Sbjct:   37 CPTWHPFACPSGECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLV-KVFGPKAKAELSGMGGVDK-VAVALSQTPTADLFASEMKLDDGETQHMLEVMEGIL-NGSTDELT----SNEAADFRFFVQKLQETGFF 185          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Match: F58H1.7 (NMDA receptor auxiliary protein [Source:UniProtKB/TrEMBL;Acc:G5EEF9])

HSP 1 Score: 60.4622 bits (145), Expect = 3.241e-11
Identity = 45/156 (28.85%), Postives = 70/156 (44.87%), Query Frame = 2
Query:  227 CPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFL-----MKWKDSLIPKVFG----------NGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            CP   P+ C SG C+   ++CD   DC D+YDE+ ++C A  RPPV   + FL        KD L+ KVFG           G+ K +A  L ++ T   +     L + + ++  +VME +  N   D L          D     ++  ++GF 
Sbjct:   35 CPTWHPFACPSGECVPIKYLCDGSPDCSDEYDENKSMCTAATRPPVEETQAFLKALMSAHGKDFLV-KVFGPKAKAELSGMGGVDK-VAVALSQTPTADLFASEMKLDDGETQHMLEVMEGIL-NGSTDELT----SNEAADFRFFVQKLQETGFF 183          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083762)

HSP 1 Score: 73.9442 bits (180), Expect = 9.745e-16
Identity = 50/156 (32.05%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  224 VCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIP----KVFGN---------GLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
             C   +P+ C   G C+S  ++CD   DC D YDED  LC A  RPPV     FL     S  P    K+FG+         G  + +A  L ES TI D+  A HL  S  ++   V  AV          +G+ D    D+     + + +GFL
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0083763)

HSP 1 Score: 73.9442 bits (180), Expect = 9.745e-16
Identity = 50/156 (32.05%), Postives = 68/156 (43.59%), Query Frame = 2
Query:  224 VCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIP----KVFGN---------GLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
             C   +P+ C   G C+S  ++CD   DC D YDED  LC A  RPPV     FL     S  P    K+FG+         G  + +A  L ES TI D+  A HL  S  ++   V  AV          +G+ D    D+     + + +GFL
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFL 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Match: CG31221 (gene:FBgn0051221 transcript:FBtr0330030)

HSP 1 Score: 73.9442 bits (180), Expect = 1.913e-15
Identity = 51/159 (32.08%), Postives = 69/159 (43.40%), Query Frame = 2
Query:  224 VCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIP----KVFGN---------GLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQV 658
             C   +P+ C   G C+S  ++CD   DC D YDED  LC A  RPPV     FL     S  P    K+FG+         G  + +A  L ES TI D+  A HL  S  ++   V  AV          +G+ D    D+     + + +GFL  V
Sbjct:   63 ACHPYEPFKCPGDGNCISIQYLCDGAPDCSDGYDEDMRLCTAAKRPPVEETASFLQSLIASHGPNYLEKLFGSKARDALSPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSLGIKDSELGDVKFFLEKLVNTGFLDXV 221          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|E2AX35|PROH4_CAMFO (IDLSRF-like peptide OS=Camponotus floridanus OX=104421 GN=EAG_01737 PE=1 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 6.133e-19
Identity = 52/164 (31.71%), Postives = 74/164 (45.12%), Query Frame = 2
Query:  200 HMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPV----VLLEQFLMKWKDSLIPKVFGN---------GLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            H+     + C   +P+ C   GLC+S  ++CD   DC D YDED  LC A  RPPV      L+  L     + + K+FGN         G  + +A  L ES TI D+  A HL  S  ++   V  AV          +G+ D    D+     + +K+GFL
Sbjct:   37 HINTKRSDACHPYEPFKCPGDGLCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETATFLQSLLASHGPNYLEKLFGNKARDTLKPLGGVEKVAIALSESQTIEDFGAALHLMRSDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 200          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|P85831|PROH4_APIME (Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 4.098e-16
Identity = 57/196 (29.08%), Postives = 83/196 (42.35%), Query Frame = 2
Query:  104 TRAMIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSG-LCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPV----VLLEQFLMKWKDSLIPKVFGN---------GLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            T     SL  +  +F    V  I L  +    + KR+ G+ C   +P+ C     C+S  ++CD   DC D YDED  LC A  RPPV      L+  L     + + K+FG          G    +A  L ES TI D+  A HL  +  ++   V  AV          +G+ D    D+     + +K+GFL
Sbjct:    7 TSVAALSLALSACVFFPRAVMAIDLSRFYGHFNTKRS-GDACRPYEPFKCPGDDTCISIQYLCDGAPDCQDGYDEDSRLCTAAKRPPVEETASFLQSLLASHGPNYLEKLFGTKARDTLKPLGGVNTVAIALSESQTIEDFGAALHLLRTDLEHLRSVFMAVENGDLGMLKSIGIKDSELGDVKFFLEKLVKTGFL 201          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Match: sp|A0A0F7YYX3|CPROH_CONVC (Neuropeptide prohormone-4 OS=Conus victoriae OX=319920 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.240e-12
Identity = 43/155 (27.74%), Postives = 73/155 (47.10%), Query Frame = 2
Query:  197 KHMKRNPGNVCPE----SKPWPCK-SGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGF 646
            +H KR    +CPE    + P+ C+ S  CL    +C+  +DC    DED ALC A  RP   ++ +FL   +D ++P +F +     +A  L E+ ++ D +   +LT+   +N                + +G+PDRAW ++  L +     G 
Sbjct:   40 QHPKRT---LCPEDCDIASPFKCEESPTCLRLFQVCNGRWDCEHGSDEDNALCAAVLRPLECMIWEFLEGQRDWILPNLFNDANTDLVAHALHEAYSMGDLQSYLNLTDQNIENIRNSTRGAIVGDPRPLMALGMPDRAWPEVMYLLKELYNLGL 191          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: W6UW14 (Prohormone-4 OS=Echinococcus granulosus OX=6210 GN=EGR_02423 PE=4 SV=1)

HSP 1 Score: 176.792 bits (447), Expect = 1.080e-51
Identity = 85/189 (44.97%), Postives = 121/189 (64.02%), Query Frame = 2
Query:  101 PTRAMIKSLKNAIKIFMILNVHII-ILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVE 661
            P+  +I+ +     IF +L+  I   + A   EK  K+   N CPES PWPC+  G CLSFDFICD E DCPD YDED  +C AK RPP+  L +F+ +++D LIP   G G P +LA KLVES TI DY ++AHLTE Q  N   ++E V + +++  +++G+P  AW++++ LF R + SGF+G V+
Sbjct:   30 PSHRVIQRVVVVGMIFYLLSKGICSTISARSNEKDAKKKIANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGKGTPLELAKKLVESPTIEDYARSAHLTEKQLVNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFVGTVD 218          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A068WKY8 (Prohormone 4 OS=Echinococcus granulosus OX=6210 GN=EgrG_000443800 PE=4 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 4.693e-51
Identity = 84/189 (44.44%), Postives = 121/189 (64.02%), Query Frame = 2
Query:  101 PTRAMIKSLKNAIKIFMILNVHII-ILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVE 661
            P+  +I+ +     IF +L+  I   + A   EK  K+   N CPES PWPC+  G CLSFDFICD E DCPD YDED  +C AK RPP+  L +F+ +++D LIP   G G P +LA K+VES TI DY ++AHLTE Q  N   ++E V + +++  +++G+P  AW++++ LF R + SGF+G V+
Sbjct:   45 PSHRVIQRVVVVGMIFYLLSKGICSTISARSNEKDAKKKIANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGKGTPLELAKKIVESPTIEDYARSAHLTEKQLVNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFVGTVD 233          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A068XY98 (Prohormone 4 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000443800 PE=4 SV=2)

HSP 1 Score: 175.637 bits (444), Expect = 4.955e-51
Identity = 85/189 (44.97%), Postives = 120/189 (63.49%), Query Frame = 2
Query:  101 PTRAMIKSLKNAIKIFMILNVHII-ILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVE 661
            P+   I+ +     IF +L+  I   + A   EK  K+   N CPES PWPC+  G CLSFDFICD E DCPD YDED  +C AK RPP+  L +F+ +++D LIP   G G P +LA KLVES TI DY ++AHLTE Q  N   ++E V + +++  +++G+P  AW++++ LF R + SGF+G V+
Sbjct:   45 PSHRAIQRVVVVGMIFYLLSKGICSTISARSNEKDAKKKIANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKQRPPIEYLFRFIQRYQDWLIPTFLGEGTPLELAKKLVESPTIEDYARSAHLTEKQLFNLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFVGTVD 233          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: A0A0R3WBB8 (Uncharacterized protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS7927 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 5.509e-51
Identity = 83/188 (44.15%), Postives = 119/188 (63.30%), Query Frame = 2
Query:  101 PTRAMIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVE 661
            P RA+ + L   + + ++ N     +     EK  K+   N CPES PWPC+  G CLSFDFICD E DCPD YDED  +C AK RPP+  L +F+ +++D LIP   G G P +LA KLVES TI DY ++AHLTE Q  N   ++E V + +++  +++G+P  AW++++ LF R + SGF+G V+
Sbjct:    3 PHRAIQRVLVIGMVLCLLSNGICWTIPVEGSEKDTKKKIANECPESSPWPCREPGFCLSFDFICDGELDCPDGYDEDREMCTAKERPPLEYLYRFIQRYQDWLIPTFLGEGTPLELAKKLVESPTIEDYARSAHLTEKQLINLNSLIEGVVQRKEMHMVLLGMPLGAWSELFYLFNRIVSSGFVGTVD 190          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Match: G4LZA8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_121660 PE=4 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 2.006e-50
Identity = 80/174 (45.98%), Postives = 119/174 (68.39%), Query Frame = 2
Query:  143 IFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVE 661
            + ++L++ I + R   +   ++R  GN CPES+PWPC++  +CLSFDFICD E DCPD+YDEDP +C AK RP    L  F+ ++++ L+PK  G G P++LA KLVES T+ DY +AA L E+Q KN  K+ME V+  ++++  ++G+P  AW+++Y LF R   SGFL  +E
Sbjct:   13 VLVLLSLIIYVSRQSTVSSAVER--GNDCPESQPWPCRTPRICLSFDFICDGEPDCPDEYDEDPEMCTAKLRPAQEHLAGFIHRYQNWLVPKFLGYGTPEELAAKLVESKTVSDYARAAKLNETQLKNLIKLMEGVKSGKEMELFLLGMPLGAWSELYTLFHRIYISGFLDNLE 184          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000076971.1 (SMESG000076971.1)

HSP 1 Score: 382.489 bits (981), Expect = 6.856e-137
Identity = 185/185 (100.00%), Postives = 185/185 (100.00%), Query Frame = 2
Query:  113 MIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY 667
            MIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY
Sbjct:    1 MIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY 185          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000076971.1 (SMESG000076971.1)

HSP 1 Score: 360.533 bits (924), Expect = 2.179e-128
Identity = 173/173 (100.00%), Postives = 173/173 (100.00%), Query Frame = 2
Query:  149 MILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY 667
            MILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY
Sbjct:    1 MILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSGLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY 173          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000033681.1 (SMESG000033681.1)

HSP 1 Score: 188.348 bits (477), Expect = 2.354e-60
Identity = 89/168 (52.98%), Postives = 119/168 (70.83%), Query Frame = 2
Query:  149 MILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            +I+ V++     + I +  +   GN CPES PWPCK+ G CLSFDFICD E DCP+KYDED ALCIAK+RPP +++EQF+ KWK+  IP +F +   K +A  L+ES TI D+ K+  L + Q+KN  KVMEAVR  RQID L+M +P+RAW D+Y LF R +K+GF+
Sbjct:    9 LIVFVYVYATECFNIFEKRESRSGNGCPESAPWPCKTPGNCLSFDFICDGEPDCPEKYDEDAALCIAKDRPPAIIMEQFITKWKEWFIPNIFSDKPIKIIATLLIESPTIDDFAKSVGLNKDQYKNVRKVMEAVRDGRQIDLLLMEMPERAWTDLYLLFSRIVKTGFI 176          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 172.94 bits (437), Expect = 4.566e-54
Identity = 81/161 (50.31%), Postives = 111/161 (68.94%), Query Frame = 2
Query:  170 IILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            I LR   +    K   GN CPESKPWPCK+ G+CLSFDFICD E DC D YDED  LC AKNRPP ++L QF+ K+KD LIP   G+G P+ ++  L+ES    +Y K+ ++T  + +NF  ++E+V++ RQI+ +M G+P RAWN++  LF R +KSGF+
Sbjct:   34 IFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 194          
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Match: SMESG000059509.1 (SMESG000059509.1)

HSP 1 Score: 173.711 bits (439), Expect = 1.521e-53
Identity = 81/161 (50.31%), Postives = 111/161 (68.94%), Query Frame = 2
Query:  170 IILRAYEIEKHMKRNPGNVCPESKPWPCKS-GLCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIPKVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQIDWLMMGLPDRAWNDMYNLFRRFLKSGFL 649
            I LR   +    K   GN CPESKPWPCK+ G+CLSFDFICD E DC D YDED  LC AKNRPP ++L QF+ K+KD LIP   G+G P+ ++  L+ES    +Y K+ ++T  + +NF  ++E+V++ RQI+ +M G+P RAWN++  LF R +KSGF+
Sbjct:  106 IFLRPIRLSPGEKAFSGNNCPESKPWPCKTPGVCLSFDFICDGEKDCDDNYDEDENLCTAKNRPPFIILNQFITKYKDWLIPNYLGSGTPEKVSTHLIESKNDQEYIKSMNMTPEEAENFKSLLESVKEGRQIELIMFGMPPRAWNELSILFGRIVKSGFM 266          
The following BLAST results are available for this feature:
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
F58H1.73.028e-1128.85NMDA receptor auxiliary protein [Source:UniProtKB... [more]
F58H1.73.241e-1128.85NMDA receptor auxiliary protein [Source:UniProtKB... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG312219.745e-1632.05gene:FBgn0051221 transcript:FBtr0083762[more]
CG312219.745e-1632.05gene:FBgn0051221 transcript:FBtr0083763[more]
CG312211.913e-1532.08gene:FBgn0051221 transcript:FBtr0330030[more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|E2AX35|PROH4_CAMFO6.133e-1931.71IDLSRF-like peptide OS=Camponotus floridanus OX=10... [more]
sp|P85831|PROH4_APIME4.098e-1629.08Prohormone-4 OS=Apis mellifera OX=7460 PE=1 SV=1[more]
sp|A0A0F7YYX3|CPROH_CONVC1.240e-1227.74Neuropeptide prohormone-4 OS=Conus victoriae OX=31... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
W6UW141.080e-5144.97Prohormone-4 OS=Echinococcus granulosus OX=6210 GN... [more]
A0A068WKY84.693e-5144.44Prohormone 4 OS=Echinococcus granulosus OX=6210 GN... [more]
A0A068XY984.955e-5144.97Prohormone 4 OS=Echinococcus multilocularis OX=621... [more]
A0A0R3WBB85.509e-5144.15Uncharacterized protein OS=Taenia asiatica OX=6051... [more]
G4LZA82.006e-5045.98Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Low density lipoprotein-receptor, class A,domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000076971.16.856e-137100.00SMESG000076971.1[more]
SMESG000076971.12.179e-128100.00SMESG000076971.1[more]
SMESG000033681.12.354e-6052.98SMESG000033681.1[more]
SMESG000059509.14.566e-5450.31SMESG000059509.1[more]
SMESG000059509.11.521e-5350.31SMESG000059509.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016063 ID=SMED30016063|Name=Low density lipoprotein-receptor, class A,domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=720bp
TTGGTCAATAGTTTATTCGACAGCCTCATAAGCCATTAAAAAATAAAATA
TAAAGCTTTTTCGACAATATCAGTTACATTCTACATTATTACCGATATAT
CCCACTCGAGCAATGATAAAAAGTCTGAAAAATGCAATCAAAATATTCAT
GATTTTAAATGTCCATATTATTATTCTCAGAGCATACGAAATTGAGAAAC
ATATGAAAAGAAATCCGGGCAACGTTTGTCCCGAGAGTAAACCTTGGCCA
TGCAAATCTGGTTTGTGTCTGAGTTTTGATTTCATTTGTGACGAGGAATT
CGATTGTCCTGATAAATATGACGAAGATCCAGCATTATGCATTGCTAAAA
ACCGACCTCCAGTGGTGTTACTGGAACAGTTTCTTATGAAATGGAAGGAT
TCGTTGATTCCAAAGGTTTTCGGAAATGGTTTACCCAAAGACTTAGCTGA
TAAACTCGTTGAATCCTTAACAATTCTTGATTATAAAAAGGCGGCTCATT
TGACAGAAAGTCAATTTAAAAACTTCTACAAAGTCATGGAAGCGGTTCGC
AAGAACCGTCAAATTGATTGGCTGATGATGGGTCTACCCGATCGAGCCTG
GAATGACATGTACAATTTATTCCGAAGATTTTTAAAATCTGGATTCCTTG
GACAAGTTGAAGTCTATTGAATCTCTTATTTTTTAGACAAATGAATTTTC
AAAATAAAATTGTTTGCAAC
back to top

protein sequence of SMED30016063-orf-1

>SMED30016063-orf-1 ID=SMED30016063-orf-1|Name=SMED30016063-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=186bp
MIKSLKNAIKIFMILNVHIIILRAYEIEKHMKRNPGNVCPESKPWPCKSG
LCLSFDFICDEEFDCPDKYDEDPALCIAKNRPPVVLLEQFLMKWKDSLIP
KVFGNGLPKDLADKLVESLTILDYKKAAHLTESQFKNFYKVMEAVRKNRQ
IDWLMMGLPDRAWNDMYNLFRRFLKSGFLGQVEVY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007218neuropeptide signaling pathway
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR036055LDL_receptor-like_sf
IPR002172LDrepeatLR_classA_rpt
IPR023415LDLR_class-A_CS
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002172Low-density lipoprotein (LDL) receptor class A repeatSMARTSM00192LDLa_2coord: 38..78
e-value: 8.1E-5
score: 32.0
IPR002172Low-density lipoprotein (LDL) receptor class A repeatPROSITEPS50068LDLRA_2coord: 38..77
score: 9.538
IPR002172Low-density lipoprotein (LDL) receptor class A repeatCDDcd00112LDLacoord: 39..72
e-value: 4.45475E-6
score: 39.8826
IPR036055LDL receptor-like superfamilyGENE3DG3DSA:4.10.400.10coord: 34..79
e-value: 1.2E-7
score: 33.3
IPR036055LDL receptor-like superfamilySUPERFAMILYSSF57424LDL receptor-like modulecoord: 43..77
NoneNo IPR availablePANTHERPTHR20967UNCHARACTERIZEDcoord: 32..104
IPR023415Low-density lipoprotein (LDL) receptor class A, conserved sitePROSITEPS01209LDLRA_1coord: 52..76