Receptor protein-tyrosine kinase

Overview
NameReceptor protein-tyrosine kinase
Smed IDSMED30016057
Length (bp)1320
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Receptor protein-tyrosine kinase (SMED30016057) t-SNE clustered cells

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30016057) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Receptor protein-tyrosine kinase (SMED30016057) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Receptor protein-tyrosine kinase (SMED30016057) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016057

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 40

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30016057h1SMcG0011666 Contig6490newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30016057h1SMcG0011666 Contig6490uc_Smed_v2PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig6490newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig6490uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig30490uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig30490newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig48699newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig48699uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig29192uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016057h1SMcG0011666 Contig29192newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
esophagusSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
mouthSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pigment cellSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx epitheliumSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:21458439
Fraguas et al., 2011
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016057h1SMcG0011666 Contig29100newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30016057h1SMcG0011666 Contig29100uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30016057h1SMcG0011666 Contig29100newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
eyeSMED30016057h1SMcG0011666 Contig29100uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30016057h1SMcG0011666 dd_Smed_v4_8641_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
pharynxSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
pigment cup cellSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
mouthSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30016057h1SMcG0011666 HM777018smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
pharynxSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
gutSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
pigment cup cellSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
mouthSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
parenchymal cellSMED30016057h1SMcG0011666 HM777018.1smed_ncbi_20240424PMID:27122174
Barberán et al., 2016
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 51.6026 bits (122), Expect = 2.463e-6
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  368 SQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNS 634
            SQ ++Y TL   +  +C  + GN+ I  +K ++     D+ FL  IKE+ G + I ++ +S VPL NLR+IRG        ++  L NS
Sbjct:   34 SQRNHYETLST-IYRDCQVIQGNLEITYLKEDN-----DVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRGTQLYQERYALAVLSNS 116          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Match: gnb5 (guanine nucleotide binding protein (G protein), beta 5 [Source:Xenbase;Acc:XB-GENE-977853])

HSP 1 Score: 51.6026 bits (122), Expect = 2.470e-6
Identity = 31/89 (34.83%), Postives = 49/89 (55.06%), Query Frame = 2
Query:  368 SQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNS 634
            SQ ++Y TL   +  +C  + GN+ I  +K ++     D+ FL  IKE+ G + I ++ +S VPL NLR+IRG        ++  L NS
Sbjct:   42 SQRNHYETLST-IYRDCQVIQGNLEITYLKEDN-----DVSFLKDIKEVQGYVLIAHNLLSYVPLENLRIIRGTQLYQERYALAVLSNS 124          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A1B1ACY3 (Receptor protein-tyrosine kinase (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 243.817 bits (621), Expect = 2.176e-67
Identity = 122/127 (96.06%), Postives = 122/127 (96.06%), Query Frame = 2
Query:  329 ISLIFYRMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            I   F  MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR
Sbjct:   60 IKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 186          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A504YU93 (Melanoma receptor tyrosine-protein kinase OS=Fasciola gigantica OX=46835 GN=FGIG_05019 PE=4 SV=1)

HSP 1 Score: 82.8037 bits (203), Expect = 5.971e-13
Identity = 39/88 (44.32%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  347 RMDLLDGS---QSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLY 601
            R D+ D S   +  +Y  L    G+NCTH+YGN+ + ++   ++GS+PDL FL  I+EITG L I +SN++++PL NLRVIR  +  Y
Sbjct:   47 RSDMKDISGFPRDGSYEILLNTFGHNCTHIYGNLILTDLYISNDGSDPDLNFLRSIREITGYLIIMHSNVAAIPLSNLRVIRAQNGGY 134          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A4E0RE72 (Receptor protein-tyrosine kinase OS=Fasciola hepatica OX=6192 GN=D915_003452 PE=4 SV=1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.397e-12
Identity = 39/88 (44.32%), Postives = 58/88 (65.91%), Query Frame = 2
Query:  347 RMDLLDGS---QSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLY 601
            R D+ D S   +  +Y  L    G+NCTH+YGN+ + ++   ++GS+PDL FL  I+EITG L I +SN++++PL NLRVIR  +  Y
Sbjct:   32 RSDMKDISGFPRDGSYEILLNTFGHNCTHIYGNLILTDLYILNDGSDPDLNFLRSIREITGYLIIMHSNVAAIPLSNLRVIRAQNGGY 119          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A075A183 (Protein kinase domain-containing protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=T265_12870 PE=4 SV=1)

HSP 1 Score: 80.4925 bits (197), Expect = 3.136e-12
Identity = 44/108 (40.74%), Postives = 67/108 (62.04%), Query Frame = 2
Query:  386 NTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            + L++  GNNCTHV GN+ I+++ +  NG +PDL FL  I+EITG L I  SN+ ++PL NLRVIR +   Y    +GA      + I  +   + +++  IDLR+L+
Sbjct:   19 DILRRLFGNNCTHVIGNVVISDLATGENGVDPDLSFLEHIREITGYLIIMYSNVETIPLTNLRVIRAEDGGY---KIGADLQPAALVIRHNHRNNVALRN-IDLRNLK 122          
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Match: A0A564Y9B4 (Receptor protein-tyrosine kinase OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS4263 PE=4 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 7.415e-11
Identity = 54/153 (35.29%), Postives = 78/153 (50.98%), Query Frame = 2
Query:  359 LDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYT-HDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRININLLHLFINCDI-IFDTISSGRLILTIFIAYLF 811
            +DGS    Y  +K+   ++CTH+ GN+ +  +   ++G+EPDL+FL  I+EI+G L I NS+I  +PL +L+VIRG    Y  HD +         + D     SN I         RIN N L    N D+ +FD  S   LI  +    LF
Sbjct:    9 IDGS----YEYIKRLFSSHCTHIIGNLILYGLHPSTDGTEPDLDFLKSIEEISGFLIIMNSSIREIPLSSLKVIRGQGVGYKIHDDLPPAALLIRHNYD-----SNRILH-------RINFNQLRAIENGDVYMFDNPSGCNLIGGLVFKNLF 145          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103042851])

HSP 1 Score: 52.7582 bits (125), Expect = 6.087e-7
Identity = 33/95 (34.74%), Postives = 55/95 (57.89%), Query Frame = 2
Query:  350 MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHD-SMGALQN 631
            M L   S   N+  + + L  +C  V+GN+ I +++ +      DL FL GI E+ G + I + ++  +PL+NLR+IRG S+LY    ++ AL+N
Sbjct:   32 MKLALPSSLENHYEMLRLLYTDCQVVHGNLEITHLQGKQ-----DLSFLEGIVEVQGYVLIAHVSVPVIPLKNLRIIRG-SQLYNSSFALAALEN 120          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Match: erbb2 (erb-b2 receptor tyrosine kinase 2 [Source:NCBI gene;Acc:103042851])

HSP 1 Score: 48.9062 bits (115), Expect = 9.675e-6
Identity = 33/96 (34.38%), Postives = 55/96 (57.29%), Query Frame = 2
Query:  350 MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHD-SMGALQNS 634
            M L   S   N+  + + L  +C  V+GN+ I +++ +      DL FL GI E+ G + I + ++  +PL+NLR+IRG S+LY    ++ AL+N 
Sbjct:   32 MKLALPSSLENHYEMLRLLYTDCQVVHGNLEITHLQGKQ-----DLSFLEGIVEVQGYVLIAHVSVPVIPLKNLRIIRG-SQLYNSSFALAALENP 121          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: EGFR (epidermal growth factor receptor [Source:HGNC Symbol;Acc:HGNC:3236])

HSP 1 Score: 55.0694 bits (131), Expect = 2.050e-8
Identity = 38/85 (44.71%), Postives = 52/85 (61.18%), Query Frame = 2
Query:  347 RMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLY 601
            +M LL GS    YNTL+  +  NC  V GN+ I  ++   NGS  DL FL  I+E++G + I  + +  VPL NLRV+RG +RLY
Sbjct:    7 KMSLL-GSAEKQYNTLR-SMYTNCEVVMGNLEITYIR---NGS--DLSFLRTIREVSGYVLIALNEVDHVPLENLRVVRG-TRLY 83          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000860.1 (pep scaffold:Pmarinus_7.0:GL476362:331258:338742:-1 gene:ENSPMAG00000000783.1 transcript:ENSPMAT00000000860.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 45.0542 bits (105), Expect = 5.149e-6
Identity = 28/79 (35.44%), Postives = 45/79 (56.96%), Query Frame = 2
Query:  365 GSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLY 601
             ++   Y TL++ +  +C  V GN+ I N+     G + DL FL  I E++G + I  +    +PL NLR+IRG ++LY
Sbjct:   41 ATRELQYQTLRK-IYEHCEVVLGNLEITNI-----GPDKDLSFLRTIHEVSGYVLIAINEFEHLPLENLRIIRG-TKLY 112          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb2 (receptor tyrosine-protein kinase erbB-2 [Source:NCBI gene;Acc:101174230])

HSP 1 Score: 60.4622 bits (145), Expect = 2.522e-9
Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  359 LDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNS 634
            L  S  ++YNTLK  L  +C  V+GN+ I ++        PDL FL GI E+ G + + N ++S VPL NLR+IRG     +  ++  L N+
Sbjct:    5 LPSSLENHYNTLKL-LYTDCQVVHGNLEITHLHGN-----PDLSFLQGIIEVQGYVLVANVSVSLVPLDNLRIIRGSQLFDSQYAIAVLNNT 90          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb2 (receptor tyrosine-protein kinase erbB-2 [Source:NCBI gene;Acc:101174230])

HSP 1 Score: 60.4622 bits (145), Expect = 2.522e-9
Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  359 LDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNS 634
            L  S  ++YNTLK  L  +C  V+GN+ I ++        PDL FL GI E+ G + + N ++S VPL NLR+IRG     +  ++  L N+
Sbjct:    5 LPSSLENHYNTLKL-LYTDCQVVHGNLEITHLHGN-----PDLSFLQGIIEVQGYVLVANVSVSLVPLDNLRIIRGSQLFDSQYAIAVLNNT 90          
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Match: erbb2 (receptor tyrosine-protein kinase erbB-2 [Source:NCBI gene;Acc:101174230])

HSP 1 Score: 60.4622 bits (145), Expect = 2.535e-9
Identity = 35/92 (38.04%), Postives = 52/92 (56.52%), Query Frame = 2
Query:  359 LDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNS 634
            L  S  ++YNTLK  L  +C  V+GN+ I ++        PDL FL GI E+ G + + N ++S VPL NLR+IRG     +  ++  L N+
Sbjct:   35 LPSSLENHYNTLKL-LYTDCQVVHGNLEITHLHGN-----PDLSFLQGIIEVQGYVLVANVSVSLVPLDNLRIIRGSQLFDSQYAIAVLNNT 120          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 276.174 bits (705), Expect = 8.143e-84
Identity = 141/159 (88.68%), Postives = 141/159 (88.68%), Query Frame = 2
Query:  284 MLYLSYCWIYFHILLISLIFYR-----------------MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            MLYLSYCWIY HILLISLIFYR                 MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR
Sbjct:    1 MLYLSYCWIYLHILLISLIFYRYSDSLIEYPEIKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 159          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 274.633 bits (701), Expect = 8.946e-82
Identity = 141/159 (88.68%), Postives = 141/159 (88.68%), Query Frame = 2
Query:  284 MLYLSYCWIYFHILLISLIFYR-----------------MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            MLYLSYCWIY HILLISLIFYR                 MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR
Sbjct:    1 MLYLSYCWIYLHILLISLIFYRYSDSLIEYPEIKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 159          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 244.973 bits (624), Expect = 2.836e-72
Identity = 122/127 (96.06%), Postives = 122/127 (96.06%), Query Frame = 2
Query:  329 ISLIFYRMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            I   F  MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR
Sbjct:   41 IKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 167          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000070834.1 (SMESG000070834.1)

HSP 1 Score: 243.817 bits (621), Expect = 5.891e-71
Identity = 122/127 (96.06%), Postives = 122/127 (96.06%), Query Frame = 2
Query:  329 ISLIFYRMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 709
            I   F  MDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR
Sbjct:   41 IKYCFSSMDLLDGSQSSNYNTLKQDLGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLR 167          
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Match: SMESG000016935.1 (SMESG000016935.1)

HSP 1 Score: 74.7146 bits (182), Expect = 6.906e-14
Identity = 51/144 (35.42%), Postives = 77/144 (53.47%), Query Frame = 2
Query:  404 LGNNCTHVYGNIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIRGDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRI----------NINLLHLFINCDI--IFDTISSGRLILTIFI 799
            LG  CTH+YGN+ I+++    NGS+PDL FL  I EI+GSL I N+++  +PL NL+VIRG +     D++  + N  E         + +    IDLR+LR           N  L +L  N D   I D  ++ +L ++ F+
Sbjct:   56 LGQRCTHIYGNLPISDLSRFKNGSDPDLSFLESIIEISGSLSIINNDVKRIPLTNLKVIRGVTLRNEPDALNIIHNHSE---------NGTFLEEIDLRNLRAIMSKNVIISQNPGLEYLEKNLDWSQILDDPTTQKLKVSEFV 190          
The following BLAST results are available for this feature:
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
gnb52.463e-634.83guanine nucleotide binding protein (G protein), be... [more]
gnb52.470e-634.83guanine nucleotide binding protein (G protein), be... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1B1ACY32.176e-6796.06Receptor protein-tyrosine kinase (Fragment) OS=Sch... [more]
A0A504YU935.971e-1344.32Melanoma receptor tyrosine-protein kinase OS=Fasci... [more]
A0A4E0RE721.397e-1244.32Receptor protein-tyrosine kinase OS=Fasciola hepat... [more]
A0A075A1833.136e-1240.74Protein kinase domain-containing protein (Fragment... [more]
A0A564Y9B47.415e-1135.29Receptor protein-tyrosine kinase OS=Hymenolepis di... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
erbb26.087e-734.74erb-b2 receptor tyrosine kinase 2 [Source:NCBI gen... [more]
erbb29.675e-634.38erb-b2 receptor tyrosine kinase 2 [Source:NCBI gen... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
EGFR2.050e-844.71epidermal growth factor receptor [Source:HGNC Symb... [more]
ENSPMAT00000000860.15.149e-635.44pep scaffold:Pmarinus_7.0:GL476362:331258:338742:-... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Receptor protein-tyrosine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
erbb22.522e-938.04receptor tyrosine-protein kinase erbB-2 [Source:NC... [more]
erbb22.522e-938.04receptor tyrosine-protein kinase erbB-2 [Source:NC... [more]
erbb22.535e-938.04receptor tyrosine-protein kinase erbB-2 [Source:NC... [more]
back to top
BLAST of Receptor protein-tyrosine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070834.18.143e-8488.68SMESG000070834.1[more]
SMESG000070834.18.946e-8288.68SMESG000070834.1[more]
SMESG000070834.12.836e-7296.06SMESG000070834.1[more]
SMESG000070834.15.891e-7196.06SMESG000070834.1[more]
SMESG000016935.16.906e-1435.42SMESG000016935.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016057 ID=SMED30016057|Name=Receptor protein-tyrosine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1320bp
GCAAAAATTTGATCCAATTGAATTTCGAACTCAACCTCACCACCAATCAA
TTCGTCAATCGTGACAAATATTCATTTATTAATTAACCACAAACCGCAGT
TTAGCGAAAACCAATACAACACCGATTCGACTCACTGATTGGATCGATTG
GAATATTAATTGAAATATCAATGTTCAAATGTTATTTTTTTCAATTAAAA
TAGAGACTAGAGCCATAAATTATTTTTTATCTGTATTAATTGCATCGATC
ATGTATTTGATTGACAAATCTACTTTTTGAGTTATGCTTTATCTTTCTTA
CTGTTGGATTTATTTTCATATTTTATTGATTTCATTGATTTTCTATCGCA
TGGATTTATTGGATGGCAGTCAGTCTTCTAATTATAATACTTTGAAACAA
GATTTGGGCAACAACTGTACACACGTGTATGGGAATATTTTCATAAATAA
TGTCAAAAGTGAAAGTAATGGTTCGGAACCAGATTTAGAGTTTCTATCAG
GAATTAAAGAAATAACTGGTTCATTGAAGATCCGAAATTCAAATATCTCT
AGTGTTCCTTTGCGAAATTTGCGGGTGATTCGTGGAGATTCTAGACTATA
TACTCACGATTCAATGGGGGCTCTTCAAAATTCTTTTGAAGTCAGTATAG
ATCAAGATATATCGGTATCAAATTCGATCAAAACAGTTATTGATTTACGA
TCTCTGCGCATCAACATTAATTTACTACATTTATTTATAAATTGTGATAT
AATATTCGATACGATTTCTAGTGGCAGACTAATTTTGACCATATTTATCG
CTTATCTATTCTATATAAGAAACTCAATCACACTGAATCGCACCTATTAT
TTTCATATACATTTATTGATGGTATTTTACGAGAAAAATATGAAATATAC
ATTGGATTATTAGTTCCTAGTCATTTATTTATTTTTGAAATTATAATGAA
AAATAACACCATATACATAATAATTTACGCACGGGATGTTATTTTCAAAA
AACTTTGTTGACTAGTATAAAAAAAAATTCAATCTCATCAAATGTGCCAG
AATACTGATTACGGTAATATTTATTTCACCTTTATAATGCTCGTCCATAC
AGTTTGTTTTAATTCATGACAAATCATAATTTGATTTGGAATTATTATAT
TTTCTTGCCAATCTATCATTTTTATGCCACAAATATTTAACTTATATTAT
ATTAACTCTTACAGTATATTAATTGTTTTTACTAGTTTAGTTAAAATTTA
CTGTTTATACGAGGGTATTAGTCAGACCTACATGCGCGTTATATGAACAC
AAAAATACGAAACCTTTTCC
back to top

protein sequence of SMED30016057-orf-1

>SMED30016057-orf-1 ID=SMED30016057-orf-1|Name=SMED30016057-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=210bp
MLYLSYCWIYFHILLISLIFYRMDLLDGSQSSNYNTLKQDLGNNCTHVYG
NIFINNVKSESNGSEPDLEFLSGIKEITGSLKIRNSNISSVPLRNLRVIR
GDSRLYTHDSMGALQNSFEVSIDQDISVSNSIKTVIDLRSLRININLLHL
FINCDIIFDTISSGRLILTIFIAYLFYIRNSITLNRTYYFHIHLLMVFYE
KNMKYTLDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR036941Rcpt_L-dom_sf
IPR019774Aromatic-AA_hydroxylase_C
IPR011528NERD
IPR000494Rcpt_L-dom
IPR032675LRR_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0000166nucleotide binding
GO:0004672protein kinase activity
GO:0004713protein tyrosine kinase activity
GO:0004714transmembrane receptor protein tyrosine kinase activity
GO:0005524ATP binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0055114oxidation-reduction process
GO:0006468protein phosphorylation
GO:0007169transmembrane receptor protein tyrosine kinase signaling pathway
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR036941Receptor L-domain superfamilyGENE3DG3DSA:3.80.20.20coord: 22..153
e-value: 6.9E-19
score: 70.3
IPR000494Receptor L-domainPFAMPF01030Recep_L_domaincoord: 44..118
e-value: 9.2E-13
score: 48.3
NoneNo IPR availableSUPERFAMILYSSF52058L domain-likecoord: 33..116
NoneNo IPR availableTMHMMTMhelixcoord: 2..21
NoneNo IPR availableTMHMMTMhelixcoord: 156..178