TNF receptor-associated factor

Overview
NameTNF receptor-associated factor
Smed IDSMED30016053
Length (bp)1744
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of TNF receptor-associated factor (SMED30016053) t-SNE clustered cells

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30016053) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of TNF receptor-associated factor (SMED30016053) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for TNF receptor-associated factor (SMED30016053) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016053

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016053SMESG000026231.1 dd_Smed_v6_20341_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30016053SMESG000026231.1 dd_Smed_v4_20341_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 103.219 bits (256), Expect = 1.147e-22
Identity = 111/434 (25.58%), Postives = 180/434 (41.47%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI-----ENLHSNMELVTTSERK----------SET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  + +H   C +  M CP     C++ +      + H  I I+K         +N    +    KE       +  +        I +    I I     N+Y        +     +      + RNH+     EN  S+M ++  +             SE  N++E I++L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQ----CQRPFQ-----KFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANV--------ICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAK-----------METQSMYVSELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD 436          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF6 (TNF receptor associated factor 6 [Source:HGNC Symbol;Acc:HGNC:12036])

HSP 1 Score: 103.219 bits (256), Expect = 1.147e-22
Identity = 111/434 (25.58%), Postives = 180/434 (41.47%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI-----ENLHSNMELVTTSERK----------SET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  + +H   C +  M CP     C++ +      + H  I I+K         +N    +    KE       +  +        I +    I I     N+Y        +     +      + RNH+     EN  S+M ++  +             SE  N++E I++L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQ----CQRPFQ-----KFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANV--------ICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAK-----------METQSMYVSELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD 436          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 95.5153 bits (236), Expect = 4.325e-20
Identity = 94/383 (24.54%), Postives = 167/383 (43.60%), Query Frame = 3
Query:  285 CQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDEL-IKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            C++Q+  I +  H D     +   ++V CP K C+ +  L  ++  H+  C      C + R GC     TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:  180 CKSQVPMIALQKHED----TDCPCVVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 95.5153 bits (236), Expect = 4.325e-20
Identity = 94/383 (24.54%), Postives = 167/383 (43.60%), Query Frame = 3
Query:  285 CQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDEL-IKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            C++Q+  I +  H D     +   ++V CP K C+ +  L  ++  H+  C      C + R GC     TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:  180 CKSQVPMIALQKHED----TDCPCVVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 529          
BLAST of TNF receptor-associated factor vs. Ensembl Human
Match: TRAF3 (TNF receptor associated factor 3 [Source:HGNC Symbol;Acc:HGNC:12033])

HSP 1 Score: 84.7297 bits (208), Expect = 1.344e-16
Identity = 101/454 (22.25%), Postives = 184/454 (40.53%), Query Frame = 3
Query:  159 CTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHI-RVCNYR-----HMK---------------CPYSRIGCK---------QSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            CT C++ ++   +      +   C  + +    I+C N+   C  Q++  ++ +H      N+     + C    C  K     + +H+ + C YR     H K               CP   + C          +S  TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:   88 CTACQESIVKDKV------FKDNCCKREILALQIYCRNESRGCAEQLMLGHLLVHL----KNDCHFEELPCVRPDCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIALQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 504          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-1 (TNF Receptor Associated Factor (TRAF) homolog; TRF-1 [Source:UniProtKB/TrEMBL;Acc:G5EG80])

HSP 1 Score: 51.6026 bits (122), Expect = 1.186e-6
Identity = 39/146 (26.71%), Postives = 60/146 (41.10%), Query Frame = 3
Query: 1062 EKFG-EYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELIN----PHNQSLFKSILIKYFDFSNDKKWKRPKKERNDPIYKNELVTLNEFSRSLKHDQ 1448
            E FG +  W I  + Q         +  I+   F SH++GYKM     L      AG      + L++GEFD  L WPF     I L++    P ++     ++      +N+K   RP+ ERN         +L      +K D+
Sbjct:  259 EMFGPQLIWKIDKLQQRTNEAKSGADTTIFSVPFMSHRFGYKMMACACLFGDGSSAGKSISLYVLLLKGEFDPTLEWPFHRAIKISLLDQNPRPEDRVNITYVIDPRKLKANEKFLARPRGERNAAFGSQSFCSLAILQNYVKDDK 404          
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Match: trf-2 (TNF Receptor Associated Factor (TRAF) homolog [Source:UniProtKB/TrEMBL;Acc:Q9N586])

HSP 1 Score: 49.6766 bits (117), Expect = 3.128e-6
Identity = 24/62 (38.71%), Postives = 37/62 (59.68%), Query Frame = 3
Query: 1122 NIYGEAFYSHKYGYKM-CLSIKLG---AY--WILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +IY + FYSH YGYKM  ++   G   A+  +    +CLM+GE+D  L WPF+   T  +++
Sbjct:  182 SIYSQPFYSHGYGYKMMAVAAPYGDGLAFREYFSVFVCLMKGEWDDILEWPFRCDVTFSILS 243          
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Match: Traf6 (gene:FBgn0265464 transcript:FBtr0071188)

HSP 1 Score: 61.2326 bits (147), Expect = 1.488e-9
Identity = 45/168 (26.79%), Postives = 76/168 (45.24%), Query Frame = 3
Query:  159 CTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKS--CNFKDELIKIGNHIRVCNYRHM------KCPYSRIGCK--QSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRK-EFSGSKSTIE 629
            C IC D +    +  CG ++C  C+   + ++N  CP D     N+ +    ++  D  T   I +L   CP  S  C+     I++  H+  C YR        KCP+++I C       TN+ + EH   D+  H +L+L+  +  Q  I T +  + S S + +E
Sbjct:  104 CAICIDWLNEPVLTSCGHRFCRSCLTAWMQKNNQCCPMD-----NKRLSAEHDIFPDNYTRREIEQLKRDCPNSSLGCSVVASPIELHRHLPSCPYRRQQEPQEEKCPFAKIKCDFVGRPETNQ-LEEHLKADMPHHMQLMLQAFQ--QTAIATWQPHKPSTSGAAVE 263          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 82.8037 bits (203), Expect = 3.229e-16
Identity = 93/429 (21.68%), Postives = 170/429 (39.63%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCP-------------YSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQN--EIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN---LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYN----CEKF-GEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++ +   L  D      I  L VKC    C+ K EL ++  H+  C +    CP             +    C Q   T       F+  + ++ E    +   +    E+E +R + +        L  + + LK +   C        +    N+   H      M +      LR+   N   + S    +++ +R +     +  + KQ L+ L     E+EG++     R  + +     H +  K     Q+ +L+ KLV +         +++ G Y W ++N S   RN      + ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVD-----NEVL-LEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLA--------LHCDTDCLK-APVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRL----VRQDQQIRELCIHNDTQK----NQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLD 460          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 82.8037 bits (203), Expect = 3.229e-16
Identity = 93/429 (21.68%), Postives = 170/429 (39.63%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCP-------------YSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQN--EIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN---LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYN----CEKF-GEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++ +   L  D      I  L VKC    C+ K EL ++  H+  C +    CP             +    C Q   T       F+  + ++ E    +   +    E+E +R + +        L  + + LK +   C        +    N+   H      M +      LR+   N   + S    +++ +R +     +  + KQ L+ L     E+EG++     R  + +     H +  K     Q+ +L+ KLV +         +++ G Y W ++N S   RN      + ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVD-----NEVL-LEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLA--------LHCDTDCLK-APVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRL----VRQDQQIRELCIHNDTQK----NQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLD 460          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 82.8037 bits (203), Expect = 3.229e-16
Identity = 93/429 (21.68%), Postives = 170/429 (39.63%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCP-------------YSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQN--EIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN---LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYN----CEKF-GEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++ +   L  D      I  L VKC    C+ K EL ++  H+  C +    CP             +    C Q   T       F+  + ++ E    +   +    E+E +R + +        L  + + LK +   C        +    N+   H      M +      LR+   N   + S    +++ +R +     +  + KQ L+ L     E+EG++     R  + +     H +  K     Q+ +L+ KLV +         +++ G Y W ++N S   RN      + ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++
Sbjct:   55 QGYDVEFDPPLESKYECPICLMGLRSAVQTPCGHRFCDSCIRKSIRDTGQKCPVD-----NEVL-LEEQLFPDNFAKREILSLTVKCSNFGCSEKMELRQLEKHLSQCRFATAPCPQCQESVPISHLDEHKSQHCLQRIMTCPDCAGSFVYAVKQNHEQFCPFANTVCEYCEMELIRDQLA--------LHCDTDCLK-APVACTFSTFGCREKMTRNELAQHMQEFTQMHMRYMAEFLRSQTLNNCTMPSAAAHLSSDDRGASARSPDSCQCKQELLNLRETVLELEGRL----VRQDQQIRELCIHNDTQK----NQVTELRRKLVSLEESTRELEAQQYQGIYVWRVENFSHHLRNQEAGQPIVLHSPPFYTGRPGYKLCLRLHLQTPSAPRCSNFISLFVHTMQGEFDSQLSWPLQGTIRLAVLD 460          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf2a (Tnf receptor-associated factor 2a [Source:ZFIN;Acc:ZDB-GENE-071120-2])

HSP 1 Score: 70.0922 bits (170), Expect = 3.644e-12
Identity = 79/350 (22.57%), Postives = 143/350 (40.86%), Query Frame = 3
Query:  417 NHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSE--IHCLNHEIMSLATENGLLRNHIE-----NLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSE--HGEEMKVEIYKQIRDL-------KLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            +HI++C      C +  +GC  +    E I +H      +H  LLL +I  ++  +E+L+ +      ++E    +I  L  S    ++++ +L     S Q    +        +L T    L   +       LHS    V    R+ +    ++N  +  +  L+ E  E      E +NR     +   E  + +  ++E    +RDL       K++ +    Y+    G + W I + S+        R   ++  AFY+ KYGYKMCL I L       G        +MRG  D+ L WPF    T+ L++ +N+   + I+  +    +   ++RP  + N
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMT-VEKEKIHDHEQACSYEHLNLLLHFIMGIKVNLESLQPQ------SLELASHKIHELHQSLRELELKMGQLCGAGASVQGACALPPPPPPAPTLGTSFTPLPTAVGAALELQLHSEKTKVVELSRRCQELELKVNTFENIVCVLNRE-MERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEAKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR---EHIIDAFRPDISSSSFQRPVSDMN 538          
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Match: traf3 (TNF receptor-associated factor 3 [Source:ZFIN;Acc:ZDB-GENE-040801-257])

HSP 1 Score: 63.929 bits (154), Expect = 2.921e-10
Identity = 80/368 (21.74%), Postives = 147/368 (39.95%), Query Frame = 3
Query:  363 VKCPEKSCNFKDEL-IKIGNHIRVCNYRHMKCPYSRIGCKQSYTT-NESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEF----------SGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLAT---ENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDF-SNDKKWKRPKKERN 1382
            V CP   C+F   L  ++ +H   C    + C + R GC  SY   N+ +REH      +H  ++      L+ ++E ++ E           S   + +ER  +E+           + +  L  ++     E+     E+  L     E   LR  +E++ S +  + +S   S +    +  L+Q+L                   R+ + M        EM         DLKL++++   +N    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L+   +Q   +  L   F    +   ++RP  E N
Sbjct:  204 VACPNH-CSFSSILRSELSSHQHDCPKAQVTCSFIRYGC--SYKGLNQEMREHESSFASEHLRMMAVRNTTLEAKVEDVKSELMERYKVLPSLSSRLAEVERQYEEMREKNRQLEQKLVSMQMLMSSHSEKLLEVEMELRELRPLRAMREEVETLRGSVESMRSMVSSLDSSCVNSASGSHTLASLEQQL------------------TRHDDLMSVHDVRLAEM---------DLKLQVLETASFN----GTLIWKIRDYKRRKQEAVVSKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLQWPFKQKVTLMLM---DQGPARKHLGDAFKPDPSSSSFRRPTGEMN 534          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 82.4185 bits (202), Expect = 5.792e-16
Identity = 108/497 (21.73%), Postives = 191/497 (38.43%), Query Frame = 3
Query:  117 YKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN---------EDNI--------------------FCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHI-RVCNYRHMKCPYSR--------------------IGCK---------QSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELIN--PHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            YK  F   V+    C  C+ ++ N     CG ++C  C+   L+         EDNI                    FC N+   C+  I   N+ +H    ++    +L   CP   C  K     + +HI + C YR   C + R                    I C          +S  TN+ I+ H     ++H  L+ E+   L+ ++  L+ E S    +       I+IL     + +IEI R  +   +N++ I  L   I   A +   L   I NL    +              E + +K     L +   ++E   +   + N   +E   + H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   ++ L++  P  + L  +    +    N   +K+P  E N
Sbjct:   34 YKERFLKPVEEKYKCEKCRLVLCNPRQTECGHRFCETCMNAILSSTSPQCMACEDNITKDKVFKDNCCRREVLALQMFCRNETRGCKELITLGNLLIHLK--SDCQFEEL--SCPRADCKEKVIRKDLSDHIEKTCKYRETPCKFCRNQVPLVEMQKHEDVDCPSVVISCPHMCSVKSLLRSEGTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKS-------IQILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGD--------------EADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA----FKPDPNSSSFKKPTGEMN 497          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: ssh2 (slingshot protein phosphatase 2 [Source:Xenbase;Acc:XB-GENE-993093])

HSP 1 Score: 82.4185 bits (202), Expect = 6.019e-16
Identity = 86/383 (22.45%), Postives = 162/383 (42.30%), Query Frame = 3
Query:  285 CQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDEL-IKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELIN--PHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            C+NQ+  + +  H D     +   +++ CP   C+ K  L  ++  H+  C      C + R GC     TN+ I+ H     ++H  L+ E+   L+ ++  L+ E S    +I+       IL     + +IEI R  +   +N++ I  L   I   A +   L   I NL    +              E + +K     L +   ++E   +   + N   +E   + H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   ++ L++  P  + L  +    +    N   +K+P  E N
Sbjct:  175 CRNQVPLVEMQKHEDV----DCPSVVISCPHM-CSVKSLLRSELNAHLLECVNAPSTCSFKRYGCTFK-GTNQQIKAHEASSAVQHVNLMKEWSNYLEAKVSMLQNESSEKNKSIQ-------ILHNQMCSFEIEIERHKEQLRNNEARIIQLQRVIEGQADKLKDLDKEIRNLRQTGD--------------EADGMKSNYESLQNRLSQLEVMAKNAASWNPGVLETQINRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVSLMLMDQGPSRRHLGDA----FKPDPNSSSFKKPTGEMN 522          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: egf (epidermal growth factor [Source:Xenbase;Acc:XB-GENE-951823])

HSP 1 Score: 79.7221 bits (195), Expect = 4.756e-15
Identity = 102/461 (22.13%), Postives = 180/461 (39.05%), Query Frame = 3
Query:  108 LKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMK----------------------------------------------CPYSRIGCK--QSYTTNESIREHFLIDIIKHSELLLEY----IENLQ-NEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQL------ERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            ++ Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+ +  N  L  D      I  L VKCP + C    EL  +  H+  C++  ++                                              CP + + C+  Q+    E +  H+ +D        + Y     E +Q N++    +EF+  ++ +  + Q +     S        + + D ++ + S+         S+AT        + + H+  +   T E +   N +E I +L+ RL+  DH+ +E+  K           ME    +  E+K      IR L  +L ++    C   G + W I N + L      ER V I+ + FY+ K GYK+CL + L        A +I   +  M+GE+DS L WP Q    + +++
Sbjct:   55 VQGYDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACILKSIRDAGHKCPVD-----NESLMEN-QLFPDNFAKREILSLRVKCPSQGCTETMELRHLERHLVRCDFAGVECSQCQSSFPKYSLQKHKFEECPRRQIFCENCALAMALEDKLNHDQTCPLAYVTCEYCQTNLIREQMPAHYSMDCTMAPIPCMYYEFGCTEKMQRNDLARHLQEFT--QAHMRMMAQTLRSFSSSVTP----TSHMPDISFCDPSQ---FEPAPPSVAT--------VHSSHTPSQNDCTQETR---NLRETIEQLEGRLVRQDHQIRELIAK-----------METQCTYVNELK----HTIRSLDNRLGEMESQQCS--GIFIWRINNFNSLLKNQEEERPVVIHSQGFYTGKPGYKLCLRLHLQLPSAQRCANYISLFVHTMQGEYDSLLPWPLQGTIRLSILD 472          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: hspb6 (heat shock protein family B (small) member 6 [Source:Xenbase;Acc:XB-GENE-876273])

HSP 1 Score: 61.2326 bits (147), Expect = 2.142e-9
Identity = 34/116 (29.31%), Postives = 57/116 (49.14%), Query Frame = 3
Query: 1071 GEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            G + W I +++         R +++Y  AFY+ KYGYK+CL I L       G        +M+GE+D+ L WPF+H  T  L++ +N+    S+   +        ++RP  + N
Sbjct:  230 GVFLWKISDLTNKSHDAVTGRAISLYSPAFYTAKYGYKVCLRIYLNGDGAGKGTHVSLFFTVMKGEYDALLPWPFKHKVTFVLVDHNNRD---SVFDAFRPDVTSASFQRPINDMN 342          
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Match: TRAF2 (TNF receptor associated factor 2 [Source:NCBI gene;Acc:100494415])

HSP 1 Score: 58.5362 bits (140), Expect = 1.912e-8
Identity = 108/472 (22.88%), Postives = 177/472 (37.50%), Query Frame = 3
Query:  120 KFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHL-----NEDNIF-CPN--DVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHI----RVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSE-IHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEM---------KVE-IYKQIRDLKLKLVQ----------------IGVYNCEKFGEYEWNIKNVSQLERNV------NIYGEAFYSHKYGYKMCLSIKLGA------YWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            K I   +++   LC+ CK+++       CG +YC  C+ K +     N   +  CP   +  +    +I +       YL        +  CP  +C     +I+  N      R C  R + C Y    CK S+         +  DI  H E+  ++          +  E  G K  I R K  + +   S+N       R      +   E   CL HE  SLA     + ++I+  H   E    S R    + +           LD +N   E  V  V NR    +ERSS   EE+         KVE +  ++R L+  L Q                +  Y+    G + W I    +  ++        ++   FY++KYGYKMCL I L          +     +M+G  D+ L WPF    T+ L++ +N+   + ++  +    +   ++RP  E N
Sbjct:   24 KEILGTKLEVKYLCSDCKNLLRRPLQAQCGHRYCSHCLNKIIRWVARNWGGVPECPAVCERSDWTGALISVGHEGKCPYL--------LAPCP--ACK---TIIRAANRDLHSERECPERKLNCRY----CKLSF---------YFPDIKAHDEICPKF---------PMTCEGCGRKK-IPREKVRLFVCSFSRNITLSLPCRYAAVGCTEMVENDKCLEHENKSLAEHLAKVWDYIQ--HGRKEQNDLSVRMGSLSVQ--GSPAPPFDTLDKKNTTFENIVS-VLNRE---VERSSHAAEELARQLRAAQEKVEALTTKVRQLERTLGQKELIVAELETRMQESELSTYD----GVFIWKISEFGKKRQDAINGRCPAMFSPPFYTNKYGYKMCLRIYLNGDGTGRNTHLSLFFVVMKGNNDALLRWPFNQKVTLMLLDQNNR---EHVIDAFRPDVSSSSFQRPISEMN 444          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf6 (TNF receptor-associated factor 6 [Source:MGI Symbol;Acc:MGI:108072])

HSP 1 Score: 99.3673 bits (246), Expect = 1.407e-21
Identity = 110/466 (23.61%), Postives = 196/466 (42.06%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHS------ELLLEY----IENLQNEIETLRKEFSGSKSTIERLKQEIEI-LKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSE-----RKSETNWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSND-KKWKRPKKERN 1382
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L VKCP K C  K EL  + +H   C +  + CP     C++ +   + +  H + D  +         + + Y    I +    +  +  E+ G+    E++    ++    +   C   +   ++    N    H   H   +      LL   + N++  +     +      R  + N++E I +L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ ++    C   G Y W I N        + ER V I+   FY+ + GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++  +++L +    +  D   +   ++RP   RN
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLTVKCPNKGCLQKMELRHLEDHQVHCEFALVNCPQ----CQRPFQKCQ-VNTHIIEDCPRRQVSCVNCAVSMAYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPIPCTFSVFGCHEKMQRN----HLARHLQENTQLHMRLLAQAVHNVNLALRPCDAASPSRGCRPEDPNYEETIKQLESRLVRQDHQIRELTAK-----------METQSMYVGELK----RTIRTLEDKVAEMEAQQCN--GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD-QSEALIRQNHEEVMDAKPELLAFQRPTIPRN 475          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 95.1301 bits (235), Expect = 4.453e-20
Identity = 94/383 (24.54%), Postives = 167/383 (43.60%), Query Frame = 3
Query:  285 CQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDEL-IKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            C++Q+  I +  H D     +   ++V CP K C+ +  L  ++  H+  C      C + R GC     TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:  179 CKSQVPMIKLQKHED----TDCPCVVVSCPHK-CSVQTLLRSELSAHLSECVNAPSTCSFKRYGC-VFQGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 528          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 84.7297 bits (208), Expect = 8.802e-17
Identity = 110/497 (22.13%), Postives = 193/497 (38.83%), Query Frame = 3
Query:  117 YKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN-------------------EDN----------IFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHI-RVCNYR-----HMK---------------CPYSRIGCK---------QSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            YK  F   V+    C  C+ ++ N     CG ++C  C+   L+                   +DN          ++C N+   C  Q+   ++ +H      N      + C    C  K     + +H+ + C YR     H K               CP   + C          +S  TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHL----KNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf3 (TNF receptor-associated factor 3 [Source:MGI Symbol;Acc:MGI:108041])

HSP 1 Score: 84.7297 bits (208), Expect = 8.802e-17
Identity = 110/497 (22.13%), Postives = 193/497 (38.83%), Query Frame = 3
Query:  117 YKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN-------------------EDN----------IFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHI-RVCNYR-----HMK---------------CPYSRIGCK---------QSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEG--KVQEVFNRNAEWMERS-SEHGEEMKV-EIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            YK  F   V+    C  C+ ++ N     CG ++C  C+   L+                   +DN          ++C N+   C  Q+   ++ +H      N      + C    C  K     + +H+ + C YR     H K               CP   + C          +S  TN+ I+ H     ++H  LL E+  +L+ ++  L+ E      +I+ L  +I        + +IEI R  +   +N+S+I  L   I S A +   L   I              R    NW+E + +K  +  L +   E+E   K      RN   +E   S H + + V +I     DL+ ++++   YN    G   W I++  +      + + +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++    S  + +   +    N   +K+P  E N
Sbjct:   38 YKEKFVKTVEDKYKCEKCRLVLCNPKQTECGHRFCESCMAALLSSSSPKCTACQESIIKDKVFKDNCCKREILALQVYCRNEGRGCAEQLTLGHLLVHL----KNECQFEELPCLRADCKEKVLRKDLRDHVEKACKYREATCSHCKSQVPMIKLQKHEDTDCPCVVVSCPHKCSVQTLLRSEGTNQQIKAHEASSAVQHVNLLKEWSNSLEKKVSLLQNESVEKNKSIQSLHNQI-------CSFEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEI--------------RPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQAARNTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLETASYN----GVLIWKIRDYKRRKQEAVMGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVIMRGEYDALLPWPFKQKVTLMLMD--QGSSRRHLGDAFKPDPNSSSFKKPTGEMN 503          
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Match: Traf1 (TNF receptor-associated factor 1 [Source:MGI Symbol;Acc:MGI:101836])

HSP 1 Score: 63.929 bits (154), Expect = 2.233e-10
Identity = 37/116 (31.90%), Postives = 62/116 (53.45%), Query Frame = 3
Query: 1071 GEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGA------YWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            G + W I NV++        R V+++  AFY+ KYGYK+CL + L          +   + +MRGE+D+ L WPF++  T  L++ +N+    +I     D S+   ++RP+ E N
Sbjct:  260 GTFLWKITNVTKRCHESVCGRTVSLFSPAFYTAKYGYKLCLRLYLNGDGSGKKTHLSLFIVIMRGEYDALLPWPFRNKVTFMLLDQNNRE--HAIDAFRPDLSS-ASFQRPQSETN 372          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q9Y4K3|TRAF6_HUMAN (TNF receptor-associated factor 6 OS=Homo sapiens OX=9606 GN=TRAF6 PE=1 SV=1)

HSP 1 Score: 103.219 bits (256), Expect = 5.506e-22
Identity = 111/434 (25.58%), Postives = 180/434 (41.47%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI-----ENLHSNMELVTTSERK----------SET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  + +H   C +  M CP     C++ +      + H  I I+K         +N    +    KE       +  +        I +    I I     N+Y        +     +      + RNH+     EN  S+M ++  +             SE  N++E I++L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALMDCPQ----CQRPFQ-----KFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPLANV--------ICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAK-----------METQSMYVSELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD 436          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B5DF45|TRAF6_RAT (TNF receptor-associated factor 6 OS=Rattus norvegicus OX=10116 GN=Traf6 PE=2 SV=1)

HSP 1 Score: 102.834 bits (255), Expect = 9.431e-22
Identity = 106/434 (24.42%), Postives = 180/434 (41.47%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHS------ELLLEY----IENLQNEIETLRKEFSGSKSTIERLKQEIEI-LKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSE-----RKSETNWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI K + +    CP D     N+I+  N  L  D      I  L VKCP K C  K EL  + +H   C +  + CP       Q +     I +H + D  +         + + Y    I +    +  +  E+ G+    E++    ++    +   C   +   ++    N    H   H   +      LL   + N++ ++     S      R  + N++E + +L+ RL+  DH+ +E+  K           ME  S H  E+K    + IR L+ K+ ++    C   G Y W I N        + ER V I+   FY+ + GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACITKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLTVKCPNKGCVQKMELRHLEDHQVHCEFALVICPQC-----QRFFQKCQINKHIIEDCPRRQVSCVNCAVPMPYEEKEIHDQSCPLANIICEYCGTILIREQMPNHYDLDCPTAPVPCTFSVFGCHEKMQRN----HLARHLQENTQLHMRLLAQAVHNVNLSLRPCDASSPSRGCRPEDPNYEETVKQLEGRLVRQDHQIRELTAK-----------METQSMHVSELK----RTIRSLEDKVAEMEAQQCN--GIYIWKIGNFGMHLKSQEEERPVVIHSPGFYTGRPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD 444          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY4|TRAF6_CERAT (TNF receptor-associated factor 6 OS=Cercocebus atys OX=9531 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 102.449 bits (254), Expect = 1.045e-21
Identity = 118/466 (25.32%), Postives = 193/466 (41.42%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI-----ENLHSNM----------ELVTTSERKSET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSND-KKWKRPKKERN 1382
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  + +H   C +  + CP     C++ +      + H  I I+K         +N    +    KE       +  +        I +    I I     N+Y        +     +      + RNH+     EN  S+M           L+  S   SE  N++E I++L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++  +++  +    +  D   D   ++RP   RN
Sbjct:   47 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQ----CQRPFQ-----KFHINIHILKDCPRRQVSCDNCAALVAFEDKEIHDQNCPLANV--------ICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELTAK-----------METQSTYVSELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD-QSEAPVRQNHEEIMDAKPDLLAFQRPTIPRN 467          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|B6CJY5|TRAF6_MACMU (TNF receptor-associated factor 6 OS=Macaca mulatta OX=9544 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 101.293 bits (251), Expect = 2.436e-21
Identity = 117/466 (25.11%), Postives = 193/466 (41.42%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI-----ENLHSNM----------ELVTTSERKSET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSND-KKWKRPKKERN 1382
            +S  ++I G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  + +H   C +  + CP     C++ +      + H  I I+K         +N    +    KE       +  +        I +    I I     N+Y        +     +      + RNH+     EN  S+M           L+  S   SE  N++E I++L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++  +++  +    +  D   D   ++RP   RN
Sbjct:   47 SSFMEDIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEDHQAHCEFALVDCPQ----CQRPFQ-----KFHINIHILKDCPRRQVSCDNCAALVAFEDKEIHDQNCPLANV--------ICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSLSLIPDSGYVSEVRNFQETIHQLEGRLVRQDHQIRELTAK-----------METQSTYVSELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD-QSEAPVRQNHEEIMDAKPDLLAFQRPTIPRN 467          
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Match: sp|Q3ZCC3|TRAF6_BOVIN (TNF receptor-associated factor 6 OS=Bos taurus OX=9913 GN=TRAF6 PE=2 SV=1)

HSP 1 Score: 100.523 bits (249), Expect = 4.766e-21
Identity = 114/461 (24.73%), Postives = 185/461 (40.13%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEI----LKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENG----LLRNHI-----ENLHSNMELVT-----------------------------TSERKSET-NWKE-INKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVS------QLERNVNIYGEAFYSHKYGYKMCLSIKLG-------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
            +S  +EI G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP + C  K EL  +  H   C +  M CP     C++ +      + H  I I+K                E  R++       +    ++ EI      ++   C+     L      N  ++ C    +    +  G    + RNH+     EN  S+M ++                              +S R SE  N++E I +L+ RL+  DH+ +E+  K           ME  S +  E+K    + IR L+ K+ +I    C   G Y W I N        + E+ V I+   FY+ K GYK+C+ + L        A +I   +  M+GE+DS+L WPFQ    + +++
Sbjct:   48 SSFMEEIQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNEGCLHKMELRHLEEHQAHCEFALMSCPQ----CQRPFQ-----KCHLNIHILK----------------ECPRRQVPCENCAVSMAFEDKEIHEQNCPLANVICEYCNTMLIREQMPNHYDLDCPTAPVPCTFSAFGCHEKMQRNHLARHLQENTQSHMRMMAQAVQTLSLAVAPVPQCTMPLYDSVPPTRPSSGRHSEVHNFQETIQQLEGRLVRQDHQIRELTAK-----------METQSMYVNELK----RTIRTLEDKVAEIEAQQCN--GIYIWKIGNFGMHLKSQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPSAQRCANYISLFVHTMQGEYDSHLPWPFQGTIRLTILD 456          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1E101 (TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.577e-36
Identity = 119/457 (26.04%), Postives = 220/457 (48.14%), Query Frame = 3
Query:   81 SLFDEIYGLLKKYKF-IFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEI----ETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQS-EIHCLNHEIMSLATEN-----------GLLRNHIENLHSNMELVTTSERKSETN--WKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFG-EYEWNIKNVSQLERNV-NIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKK-WKRPKKERND 1385
            S  D +  LL KY     +  V  DLLC +C  +M +A    CGC YC  CI  +L++++ +CP D  EC+   +++  ++  +   +  IS+++VKCP   CN+  EL+++  H+  C    ++CP   IGC++     + + +H    +++H++L++ +   L++EI    ET +++ S  K  + R+++ +   K ++    IE  R  DN     S +I  + +E+++L T              + R  IE + +++E+V +++ K++     KEI  +K   M +D  N+E E K+  +   N                           KL       C     ++ W I+  S+  R V ++Y ++F SH   YK CL++ +    +     +M+GE D +L WP +   T+ +I   +    K+ + +Y  +  +KK + RPK ERND
Sbjct:    4 SKLDNVQELLSKYNVKRVDESVNNDLLCILCNKLMRDACESACGCHYCYTCIRIYLSQNHNYCPGDKTECKEDYLNLEGDVFRNIRLSTRISRIVVKCPNIRCNYTSELLRLKEHLDKCTPESVECPCVTIGCEEEPLLKDEMAKHLTDQVLRHTQLIMSFCNELKSEINHNNETTKEDISHLKEVL-RVQKALNDEKTAQMEFLIEELRNKDNMILVLSQDIQEVKNEMITLLTSKESELKKLKSDIQIFRQEIEFMKNDLEVVGSTDIKNQVKDLKKEIFGIK---MNIDSNNEERERKMNNLIRLN---------------------------KL-------CPNVDMDFMWRIEEYSKKRRTVTDVYSDSFQSH--NYKFCLNLYIYGDNLGLWCVIMKGEKDDFLEWPMRRTVTLSIIEQDSLKTHKTTVFQYDTYQRNKKAFDRPKDERND 420          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: I1ZID8 (TNF receptor associated factor-2 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 123.635 bits (309), Expect = 1.403e-28
Identity = 61/190 (32.11%), Postives = 108/190 (56.84%), Query Frame = 3
Query:   90 DEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILK 659
            ++I  LL  Y F     V  +L C +CK++++NA    CGC++C +CIM++++  N++CP    EC+ + + I  N+H DY  N  I+K+ VKCPE++C    EL+ I  H+R+C  +   CP+  +GC Q     + +  H      +HS+L+++ I N++N       +F G  +    L+++I ++K
Sbjct:    4 EKINRLLITYNFEVEGGVPDNLKCDLCKNLLVNACQSRCGCRFCSKCIMEYVSRGNLYCPGGTSECKEENLTICSNIHTDYRVNRKIAKMRVKCPEETCKVYCELVDIEEHLRLCTMKSQNCPFFVLGCNQPKMVIQDLTNHLQNGTFQHSKLIIDIISNMRN-------DFFGLTTKEVELREDINLIK 186          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A0F7GWW3 (TNF receptor associated factor 4 (Fragment) OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 107.071 bits (266), Expect = 4.816e-23
Identity = 57/152 (37.50%), Postives = 88/152 (57.89%), Query Frame = 3
Query:  306 ININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSL 761
            +N N+  DY  N  I+KL VKC EKSC++ DEL K+ +H R C YR + CPYS IGC +   + + + +H   +I  H++LL++++ N  NE+E L+   +G     E L+ EI  LK+  +  ++EI  L     +   EI  LN +I +L
Sbjct:   12 LNENICVDYPMNMKIAKLQVKCKEKSCDYVDELRKMEDHSRTCKYRSVACPYSNIGCDKCNISQDKVTDHLQSEIFVHTKLLMDFVVNFNNEMEMLKANNNGLSPVNELLRNEINELKLDGDRRRVEIGDLQRKCANQAEEIELLNEDIPAL 163          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: A0A3M0JGK1 (Uncharacterized protein OS=Hirundo rustica rustica OX=333673 GN=DUI87_22875 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 1.822e-22
Identity = 109/425 (25.65%), Postives = 185/425 (43.53%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKH--------SELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQL------ERNVNIYGEAFYSHKYGYKMCL-------SIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELIN 1289
             S  +E  G    Y   F+  +++   C IC   +  A   PCG ++C  CI+K + +    CP D     N+I+  N  L  D      I  L+VKCP K C+ K EL  + +H   C++  ++CP     C+ ++  N  ++EH   +  +         + +  E  E  +NE+    +EF+           ++ +  ++++   I +   N   + N             L  E  L  +H+   H+  +     E   ET    I +L+ RL+  DH+ +E+  K           ME  + H  E+K    + IR+L+ ++ ++    C   G Y W I+N S L      ER V ++   FY+ K GYK+CL       S +  A +I   +  M+GE+DSYL WPFQ    + +++
Sbjct:   25 GSFAEETQG----YDVEFDPPLESKYECPICLMALREAVQTPCGHRFCKGCIVKSIRDAGHKCPVD-----NEILLEN-QLFPDNFAKREILSLMVKCPNKGCSMKMELRHLEDHQLQCDFSTVECPQ----CQGTFPKNH-LKEHVTQECPRRQVCCPNCATSMAYEDKEMQRNELARHMQEFT-----------QVHMRMMAQSFQNISVTAANPVPFLN------------GLHFEPALF-SHVS--HAAYDCNPEVENFKET----IQQLEGRLVRQDHQIRELIAK-----------METQNTHMAELK----RTIRNLEGRVTELEAEQCH--GIYIWKIENFSGLQKAQEEERPVVMHSPGFYTGKPGYKLCLRLHIQLPSAQRCANYISLFVHTMQGEYDSYLPWPFQGTIRLSILD 387          
BLAST of TNF receptor-associated factor vs. TrEMBL
Match: T1DBK6 (TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1)

HSP 1 Score: 111.309 bits (277), Expect = 2.089e-22
Identity = 120/477 (25.16%), Postives = 209/477 (43.82%), Query Frame = 3
Query:   78 NSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRN--HIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQ----IRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKK---WKRPKKERNDPIYKNELVTLNEFSRSLKHD 1445
            NS  +    L K  K+ F +    +L C +C+DI+++A    CGC+YC ECI  +L      C  + ++C++ I     +  +D  TN  IS L VKC  + C F+D L  I  H+  C YR+  C      C   Y   E    + L +     E+L +Y   L        KE++ S    E           S++ C  +   +     + +S+++ L+H     + EN  L    H+ +    +     +E  + ++++    +   L +L+ +NK +E ++  +   N    +      E MK+++ K      RD  LK     ++   + G+Y W IK+ S+L       +N  I  EAFY+  +GYKMC+ I      +  G        +M+G++D  L WPF++   I + +  ++S   S       F  D K   ++RP++E N      + ++ +E    LK D
Sbjct:    6 NSFQNTALKLYKDNKWRFTI--NDNLKCVMCQDILLDAIQTDCGCRYCKECIDNYLENGEKECVAEYEDCRSVI----TSYIYDRATNKEISLLKVKCLYEGCVFEDTLKSIKGHLDFCEYRNEMCSL----CGMEYIIKE--ESNHLANECLLREVLCQYCRTLLT-----FKEYNESHLCFE-----------SRDLCG-KYEAICPYGCTGESKVNLLHHR---KSCENKPLECPLHVFDCKQLIPKDQMTEHLNTSSYEHTLTIVTELRKLEKQNKHMEERMNILIEEN----QLLKATLEVMKLDLPKNSGSISRDTSLKRANKTIF---RNGKYMWKIKSFSKLRENAMRGKNPTILSEAFYTSDFGYKMCMKIYPCGDGVGKGTHLSIFFVIMKGDYDDILPWPFKNKVIITIFDDFSKSTNLSDT-----FKPDPKSICYQRPEEEYNIASGSPKFISFSELKNFLKKD 438          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 78.5666 bits (192), Expect = 5.692e-15
Identity = 101/443 (22.80%), Postives = 178/443 (40.18%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN----LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLK--LKLVQIGVYNCEKFGEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++  +  L  D      I  L V+C    C  K EL  + NHI  C +  + CP     C++S   +E + EH   +    S  L+   +  +N I   ++    S    + LK  +         C   I    +    N   +H      M +     +LRN   N     HS      T  R + +  +   +  Q L ++     E+E ++    ++  E   R+     +M  E+ K++  L+  ++ +Q   Y     G Y W ++  S   RN      V ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++         ++    D    + ++RP  +RN
Sbjct:   54 QGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-----NEVLTED-QLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQESVWKSE-LEEHINQEC---SHRLITCPDCAENIIYAEKQ--LASHCDTDCLKAPV--------ACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQM-TELRKKLASLEESMRELQAQQYQ----GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDL---QAFQRPTVQRN 464          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 77.411 bits (189), Expect = 1.301e-14
Identity = 104/456 (22.81%), Postives = 184/456 (40.35%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHF-------LIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEI------EILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN----LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLK--LKLVQIGVYNCEKFGEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++  +  L  D      I  L V+C    C  K EL  + NHI  C +  + CP     C++S   +E + EH        LI     +E ++ Y E   +E   L          +E ++ ++      + LK +   C   I    +    N   +H      M +     +LRN   N     HS      T  R + +  +   +  Q L ++     E+E ++    ++  E   R+     +M  E+ K++  L+  ++ +Q   Y     G Y W ++  S   RN      V ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++         ++    D    + ++RP  +RN
Sbjct:   54 QGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-----NEVLTED-QLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQESVWKSE-LEEHINQECSHRLITCPDCAENII-YAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLK-APVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQM-TELRKKLASLEESMRELQAQQYQ----GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDL---QAFQRPTVQRN 488          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf6 (TNF receptor associated factor 6 [Source:NCBI gene;Acc:103021325])

HSP 1 Score: 77.411 bits (189), Expect = 1.301e-14
Identity = 104/456 (22.81%), Postives = 184/456 (40.35%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHF-------LIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEI------EILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN----LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLK--LKLVQIGVYNCEKFGEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAY-------WILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            + Y   F+  +++   C IC   + +A   PCG ++C  CI K + +    CP D     N+++  +  L  D      I  L V+C    C  K EL  + NHI  C +  + CP     C++S   +E + EH        LI     +E ++ Y E   +E   L          +E ++ ++      + LK +   C   I    +    N   +H      M +     +LRN   N     HS      T  R + +  +   +  Q L ++     E+E ++    ++  E   R+     +M  E+ K++  L+  ++ +Q   Y     G Y W ++  S   RN      V ++   FY+ + GYK+CL + L          +I   +  M+GEFDS L+WP Q    + +++         ++    D    + ++RP  +RN
Sbjct:   54 QGYDVDFDPPLESKYECPICLMGLRSAVQTPCGHRFCNCCIRKSIRDTGQKCPVD-----NEVLTED-QLFPDNFAKREILSLTVRCRNVGCMEKMELRHLENHIPHCKFATVPCPQ----CQESVWKSE-LEEHINQECSHRLITCPDCAENII-YAEKQFHEQLCLFANTVCEYCNMELIRNQLASHCDTDCLK-APVACTFSIFGCREKMLRNDLALHMQEFTQMHMRYMADVLRNQTINGLISSHSASAASPTDSRGASSRPEGACQCNQELQQMRETVLELESRLVRQDHKLRELSIRNETQSTQM-TELRKKLASLEESMRELQAQQYQ----GVYVWRLEGFSTHIRNQEAGHPVVLHSPPFYTGRPGYKLCLRLHLQTPNAPRCSNYISLFVHTMQGEFDSQLSWPLQGTIRLAVLDQAEGQHHVEVMETKPDL---QAFQRPTVQRN 488          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf2a (TNF receptor-associated factor 2-like [Source:NCBI gene;Acc:103036375])

HSP 1 Score: 71.2478 bits (173), Expect = 1.209e-12
Identity = 87/360 (24.17%), Postives = 150/360 (41.67%), Query Frame = 3
Query:  417 NHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGE---------EMKVEIYKQ----------IRDL-------KLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            +HI++C      C +  +GC  S    E I +H      +H  LLL +I  ++  +E+L+ +      ++E    +I+ L  S    ++++ +L+      Q           +LAT    L      + + +EL   SE+       ++ +L +R  EL+ +    E  V  V NR    MERS+   E         + K+EI             +RDL       K++ +    Y+    G + W I + S+        R   ++  AFY+ KYGYKMCL I L       G        +MRG  D+ L WPF    T+ L++ +N+   + I+  +    +   ++RP  + N
Sbjct:  204 DHIKLCTKFRTPCRFHVVGCDMS-VEKEKIHDHERACSYEHLNLLLHFIMGIKVNLESLQPQ------SLELASHKIQELHQSLRELELKMGQLS-AGAPVQGACAPPPPPPPTLATSFTPLPT---TVGAALELQLHSEKT------KVAELSRRCQELELKVGTFENIVC-VLNRE---MERSATTMEAYNRQHRLDQDKIEILNNKVRQLERTVGLRDLSIVEMEGKMREMSAATYD----GVFVWKISDFSKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR---EHIIDAFRPDISSSSFQRPVSDMN 535          
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Match: traf1 (TNF receptor-associated factor 1-like [Source:NCBI gene;Acc:103045252])

HSP 1 Score: 70.0922 bits (170), Expect = 2.460e-12
Identity = 97/462 (21.00%), Postives = 193/462 (41.77%), Query Frame = 3
Query:  153 LLCTICKDIMINAYIGPCGCKYCLECIMKHL-NEDNIFCPNDVDECQNQIIDININLHFDYLTNNN-----ISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKC--------------PYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKE---FSGSKSTIERLKQEIEILKISKNTCQ----IEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETN-WKEINKLKQRL--ME--LDHENKEIEGKVQ---EVFNRNAEWMERSSEHGEEMKVEIYKQI--RDLKLKLVQIGVYNCEKF---GEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
             LC+ C +++  A+   CG +YC  C+M  L N  ++ C     E      D ++ L  D+  ++N     I +L V C  + C ++  L    +H   C Y  + C               +   GC  + TT +          ++       ++++ + E    RKE   FS    T +    ++   ++S  +      +E+ R    +     E   + +  + L    G L     +  +N + ++  + ++E    ++++ L+QRL  ME  +   N+E+E K Q    V  R+        +H E +  E  +++  +DL++  +Q  +   +     G + W I +VSQ        +  + Y  AFY+ +YG+K+C+ + +    +  G        +M+G++D  L+WPF+   T  LI   +Q+  + ++  +        ++RP  E N
Sbjct:   27 FLCSSCNNVLNEAHQTQCGHRYCRACVMWLLRNNKDLIC-TKCKEDPGSESDSSMMLTLDHFFSDNAINKEIQELRVHCVNQGCGWRSTLKDFEDHQSQCEYALIPCNIGCGLMVLRKTLATHLEKGCPNNKTTCQVCCSALTPAELQSVTYFSLFLKDSKQE-SPKRKETCVFSEIGCTFKGNPDKVREHEVSSTSAHLHLLVEVVRNVQMSVPPPPE-RTVQYPALDLTLNGGELETDSGDTGANDKALSLHDDQAELEVGQQLHALQQRLQIMENIITALNREVE-KTQLTVVVLERDNHNNMNLIQHLEAVVAEQQQRLIRKDLQISSLQQSISAQQDVSYDGTFLWRICDVSQKLKEAATGQKSSQYSPAFYTSRYGFKVCMRLYMYGDGVGKGTHISLFFVIMKGDYDPLLSWPFKQKVTFFLI---DQNQREHVVDAFRPDLRSASFQRPVSEMN 481          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000074.1 (pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-1 gene:ENSPMAG00000000066.1 transcript:ENSPMAT00000000074.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 83.1889 bits (204), Expect = 3.345e-17
Identity = 82/358 (22.91%), Postives = 157/358 (43.85%), Query Frame = 3
Query:  366 KCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIE---GKV--QEVFNRNAEWMERSSEHGEEMKVEIYKQIR-DLKLKLVQIGVYNCEKFGEYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDF-SNDKKWKRPKKERN 1382
            KC E+S   ++EL+   +H+ +C Y+  +C +S+ GCK   T  + ++EH      +H  L+     NL+ ++  L+ + +   ++ + L   +  L       + E+  +      N+S + C+   ++++ TE  LLR     L  +M+  TT     +    +++     L EL      IE   G V       R A      S H  ++     +    DL+ ++++   YN    G+  W I++ ++ +      R +++Y + FY+  +GY+MC    L    +  G        +MRGE+D+ L WPF+   T+ L+   +Q   +  L   F        ++RP  + N
Sbjct:  108 KCEEQSIA-REELV---SHLGICPYKQAECFFSQFGCKYKGTL-QGLKEHESGATQQHLSLVTARSANLELKVSMLQSQLAERANSADLLGTRVREL-------EKELISVGQTASKNES-VLCVVQRMLAVQTER-LLR-----LQESMQ-GTTRRADHDALRGDLDGTAATLHELGTRVAAIEESGGSVTHSSTPTRLAALDSALSRHDTQLFAHDTRLAEMDLRFQVLETASYN----GKLVWKIRDYARRKQDAVSGRTLSLYSQPFYTSPFGYRMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLPWPFRQRVTLTLL---DQGAARRQLSDTFKPDPASSSFRRPTSDMN 438          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002130.1 (pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 gene:ENSPMAG00000001936.1 transcript:ENSPMAT00000002130.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.481e-13
Identity = 78/391 (19.95%), Postives = 153/391 (39.13%), Query Frame = 3
Query:  264 CPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNW--KEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDL---KLKLVQIGVYNCEKFGEYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDF-SNDKKWKRPKKERN 1382
            CP+  + C+     +  +L  +       ++  + CP           ++  H+  C      C +  +GC     T+ES+REH    +  H  L++     L+ +   L+       +  E L Q +  L               + + S+ S +   N+  +    E  +L  H E L S        +R ++T    +++  L++RL  L           +          ER   H  E ++ ++  + D    +L++++   Y+    G+  W I++ ++ +      R +++Y + FY+  +GYKMC    L    +  G        +MRGE+D+ L WPF+   T+ L+   +Q   +  L   F        ++RP  + N
Sbjct:   29 CPHRAEFCKYCSAAVTCSL-LERHHKEECAQYPLPCPNNCEEHGIPRAELSQHMSACAMSTKLCGFHMLGCTFKQGTSESVREHEESAVRSHFTLVISRNSELELQCARLQCSIEDHTNMSEMLTQRVAQL---------------EQDLSHWSTLTGSNNTRLGSTLE--MLTQHNEQLQSLHVAQRAPQRDADTAALRRDMATLRERLRAL-----------EAALGNPGPCEERC--HMHEQRLTMHDGLLDTAERRLQVLETAGYS----GKLVWKIRDYARRKQEAASGRTLSLYSQPFYTSPFGYKMCARAYLNGDGVGRGTHLSLFFVVMRGEYDALLEWPFRRRVTLSLL---DQGAARRHLSDTFTPDPASGSFRRPDGDMN 381          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008091.1 (pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 gene:ENSPMAG00000007312.1 transcript:ENSPMAT00000008091.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.9138 bits (128), Expect = 6.051e-8
Identity = 82/406 (20.20%), Postives = 150/406 (36.95%), Query Frame = 3
Query:  147 ADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIG-NHIRVCNY-------RHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEI-----ETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLN----------DNNYSNQSEIHCLNHEIMSLATENGLLRNHIENL-HSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQI--GVYNCEKFGEYEWNIKNV--------SQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQ 1262
            A   C  C+ ++ +A    CG ++C  CI + +   +  C ND     N ++        D      +  L V+C  + C ++  L++    H+  C++               R    +      S+R        +    LL Y +  ++++      T   +  G KS  E   Q  E  +  KN      + L            N+  N  E+H          T   L++ H +N+ H     +  +E +  T  + + ++ +R+ E D    E   +   +       ++      E    E  + I  L  +L ++    YN    G + W IK+V        +  ER   I   AF++ +YGY++ L +      + A   L  G +D+ LAWP+Q
Sbjct:    1 ARFACGSCQGLLRDAVQTHCGHRFCKPCIARLITSVHRSC-NDTLMNSNFLVYSPTQFFPDAALRREMGVLPVRCVSEGCEWRGRLLEYDVAHVERCDWVLVPCLLAGCALLLPRAELHRHVAQECSVRPVPCAACAQ----LLPYRQLQKHQLHCRSRRTRECKLCGQKSIPEDKWQHHEERRCMKNRDTCPYSPLGCLYRGHGESLHNHDKNSVEVHLAIVYDAFKKTFEQLIKGHADNIKHPPSARLVAAEAQLATMDRRVEEVAKRV-ERDVRVSEASTRQGNIDRDETARLQNKMARVEHSDQETERSILGLTRRLAELENTAYN----GMFLWKIKHVINRLREAGNGAERPPQIDSPAFFTTRYGYRLRLRLCRSGEHVSAYAMLGPGPYDATLAWPYQ 396          
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Match: traf6 (TNF receptor-associated factor 6 [Source:NCBI gene;Acc:554561])

HSP 1 Score: 50.0618 bits (118), Expect = 1.100e-6
Identity = 33/122 (27.05%), Postives = 49/122 (40.16%), Query Frame = 3
Query:  111 KKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMK--HLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISK-----LIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKC 455
            + Y+  F   +++   C IC   +      PCG ++C  CI+    L +    CP D           N  LH   L  +N +K     L V+CP K C  + EL  +  H   C Y  + C
Sbjct:   49 QGYEADFEPPLESKYECPICLMALREPVQTPCGHRFCRACILHSMRLRDAGPKCPVD-----------NAVLHEGQLFPDNFAKREILSLTVRCPNKPCGHRGELRALQEHQLRCEYAQVPC 159          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31692 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX78])

HSP 1 Score: 78.1814 bits (191), Expect = 1.832e-15
Identity = 108/430 (25.12%), Postives = 173/430 (40.23%), Query Frame = 3
Query:  129 FNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN-EDNIFCPNDVDECQ-NQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN-LHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAY------------WILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKK--WKRP 1367
            F      +L+C IC  ++    +  CG  YC  C  K  N +D + CP D  + + NQ +        D  T   +  L VKC    C++K EL     H+  C++  +KC +   GC      N          + KH E           E + +  EF      +   K+E E +K  +  C + I           S+I C      +          H EN L +++++   + R    N KEI K  +++ +    NKEIE   +E+   N                   + IR LK ++ ++        G + W I +   L     IY  +FY+ KYGYK    ++L AY            W+ A  C+M GE+D+ L WPF+   T+ +I+  +Q   +++LI   D   D+K  + RP
Sbjct:   17 FETPPSPELMCGICLMVVNKPVLTYCGHSYCNFCFNKWRNGKDVVTCPVDYKQLETNQFMA-------DKKTERQVLSLCVKCMNGPCSWKGELRDKKKHLTKCDHEVIKCVFD--GCDTRLARNS---------MEKHEETC---------EWKIVTCEFC----DVPYPKREEETVK-HRGDCPLAILP------CKFSDIGC------TFEGRQHAHVAHCENALQAHLDMACGTIRD---NNKEIRKNNKKIRD---NNKEIETLHEELNTAN-------------------QTIRKLKGQMAKL-------VGTFVWRICDYKDLYEE--IYSPSFYTSKYGYK----VQLKAYLHTNPFNGETHLWLYA--CIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRP 362          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO31690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SX76])

HSP 1 Score: 76.6406 bits (187), Expect = 5.538e-15
Identity = 103/452 (22.79%), Postives = 170/452 (37.61%), Query Frame = 3
Query:  129 FNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN-EDNIFCPNDVDECQ-NQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEI--ARLNDNNYSNQSE-----IHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKL------GAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKK--WKRPKKERNDPIYKNELVTLNEFSRS 1433
            F      +L+C IC  ++    +  CG  +C  C  K  N +D + CP D  + + NQ +        D  T   +  L VKC    C++K EL     H+  C +  +KC +   GC      N          + KH E           E + +  EF      +   K+E E +K  +  C + I   + +D   + +        HC N     L    G +R++ + +  N + +  + ++ ET  KE+N   Q                                            IR+LK K+ ++        G + W I +   L     IY  +FY+ KYGYK+ L   L      G   +    C+M GE+D+ L WPF+   T+ +I+  +Q   +++LI   D   D+K  + RP    N        ++L E +  
Sbjct:   17 FETPPSPELMCGICLMVVNKPVLTYCGHSFCNFCFNKWRNGKDVVTCPVDYKQLETNQFMA-------DKKTERQVLSLCVKCMNGPCSWKGELRDKKKHLTKCGHEVIKCVFD--GCDTRLARNS---------MEKHEETC---------EWKIVTCEFC----DVPYPKREEETVK-HRGDCPLAILPCKFSDIGCTFEGRQHAHVAHCENAVQAHLDMACGTIRDNNKEIRKNNKKIRGNNKEIETLHKELNTANQ-------------------------------------------TIRELKGKMAKL-------IGTFVWRICDYKDLYGE--IYSPSFYTSKYGYKVQLKANLRTNPFNGGTHLSLYACIMVGEYDALLEWPFRRKITLYVIDQSDQRKHETLLINPDDVLPDRKKCFHRPITGNNVGYGLTRFLSLEELTSG 384          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO35237 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM27])

HSP 1 Score: 72.0182 bits (175), Expect = 2.600e-13
Identity = 91/367 (24.80%), Postives = 158/367 (43.05%), Query Frame = 3
Query:  285 CQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNE-SIREHFLIDIIKHSELLLEY-------IENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENG-----LLRNHIENLHSNMEL---VTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERS-SEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQL------ERNVNIYGEAFYSHKYGYKMCLSI------KLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHN 1298
            CQN + +  +  H             ++CP +    + E  K+  H R C      C +S +GC  +Y   + ++REH    +IKH  LL          +  L+N++E    E +  K+ +ER K E   +K           R ND N         L     ++A + G      +R   ENL   + +   +   + K++ N + +  L +RL E+  +++    K+    NR    +E S + H    K +++++  DL++++ Q   Y+    G + W I   ++           +IY   FY+H++GYK+C  +           ++   + LMRGE+DS L WPFQ   TI LI+  N
Sbjct:  140 CQNDVPERTLIEHL-----KKCPAFPIECPNECGVKRIERKKLSAHTRECPNALTDCRFSPLGC--TYKVKKIALREHQNKHVIKHMILLGRTTGEPQPNLLELENQLERFDGENTSFKTELERHKYEFAQMK----------ERFNDQNAR-------LGIVEKTVANQKGDIAEIWMRFDQENLVGEVRMRDKLKKFKVKTKANKECLLSLMKRL-EVQDDSQTNPNKL----NRRLSQLESSITIH----KTKLFQE--DLRIQIQQAISYD----GTFLWKIDKFTERYAEAKSGNATSIYSSPFYTHRFGYKLCARLFPNGDGSARDNYLSIFIALMRGEYDSILPWPFQETITITLIDQDN 467          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO48394 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJK8])

HSP 1 Score: 68.5514 bits (166), Expect = 2.736e-12
Identity = 108/478 (22.59%), Postives = 181/478 (37.87%), Query Frame = 3
Query:  129 FNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLN-EDNIFCPNDVDECQNQIIDIN-----INLHFDYLTNNN-----------------ISKLIVKCPEKSCNFKDELIKIGNHIRVCNYR----------------------------HMKCPYSRIGCKQSYTTNESIR-EHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGE-----AFYSHKYGYKMCLSIKLGAYWILAGLCL------MRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWK--RP 1367
            F +    +L+C IC  ++    +  CG  YC  CI K  N ++ + CP D ++ +   I  +     I L  +    NN                  S   VKC  + CN K   I +  H   C +R                             + C +S IGC  ++   ES R EH    +  H  +  E I + + +I  L KE       +++++QE++       +C   +  +N     +   I     +I +L+ E+G+  N I   H N E + T +++     + I K + ++ +L    K                    +++ +   V      +D   K V        K G         S  + ++++ G+      FY+ +YGYKM L      Y    G  L      M+GE+D+ L WPF+   T+ LIN   Q   +++ I   D + DKK K  RP
Sbjct:   20 FIIPPNDELICAICHMVVNEPVLTSCGHSYCKYCIEKWCNGKEVVTCPVDNEQLKPSQIFPDKKTDRIVLSLEVKCTNNPCRWKGELRQKQKHLKICSHKAVKCILEGCNVKVPRILMEKHTNTCGWRLLHCKPCNLSYPKKDEETVQHKDDCPLAFLPCRFSEIGC--TFKGRESARDEHCESAVQTHLHIACETIRDNKEQISDLHKE-------LDKVRQELQT-----KSCD-HMKEVNAIREKHDEAIRDNKGQIEALSKEHGIASNTI---HENKEQLDTLKKELGIASETIRKNRDQIAKLSTACK--------------------TQYTDGTFVWRICNYKDKYKKAVAFATNQEVKGGN--------SDSDDDISMAGDIMVSLPFYTSRYGYKMRLKAYPNGYGDGKGTHLSLSIRIMKGEYDAILEWPFRRKITLSLINQSEQWRSETVEIYPDDATPDKKHKFERP 451          
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Match: EDO49464 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RG36])

HSP 1 Score: 65.0846 bits (157), Expect = 4.014e-11
Identity = 105/492 (21.34%), Postives = 184/492 (37.40%), Query Frame = 3
Query:  159 CTICKDIMINAYIGPCG---CKYCLECIMKHLNEDNIFCPNDVDE-----------CQNQIIDI-----NINLHFDYLTN--------NNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPY--SRIGCKQSYTTNESIREHFLI------------DIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIE---RLKQEIEILKISKNTCQIEIARLN--------DNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQR--LMELDHENKEIE---GKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIR---------------DLKLKLVQIGVYNCEKFGEYEWNIKNVSQL------ERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            C +C + + +    PCG   C+ CLE I++  ++    CP D +E           C+ +I+ +     N  L  +++ +         N     V+C    C  K     +  H+  C ++   C Y   RI         ++  +H ++            +++ H   + E  E L          F G++  +E   R +  + +  +   T   E AR          +   + Q E      E +++A +N  LR +   L+         ER      +E+ +LK+R  L E++   +E +   G ++   +R A         G  M +E  +Q R               DLKL++++   Y+    G Y W I   ++        +  +IY   FY  +YGYK C  +      +  G        LMRGEFD+ L WPF+   T +L+   +Q     I   +        +KRP    N
Sbjct:   21 CPVCGNALKHPVQTPCGHRFCEGCLEPILRGPSK----CPVDGEELKIDGVFKDVCCRREILCLACYCPNRQLGCEWMKDLQYLEEHRANCEYKGVQCHNPGCQEKVAKRDLEAHLERCEFKPSDCQYCLQRIPAASMEDHLQTCEKHPVVCPHCGAEGICRDELLHHQTNICEQAE-LPCSFAKHGCHFKGTREALETHFRDQASVHVNLLLTATQNEEKARSEMAAKLSQMEKERAKQQEQMYEQREALAVANQN--LRTYQGKLN-------VIERSVAEQRRELAELKERIQLQEVEAAIREQDRRLGMIENEASRGAAPSSGPGSMGGTMALE-RRQDRNEHQLALHDIQLAEHDLKLQMLEATSYD----GTYIWKIDEYTRRYQEGVSGKTPSIYSPPFYVGRYGYKACARVYPNGDGMGKGSHLSLFFVLMRGEFDALLPWPFRQKVTFKLL---DQDRVHDIGDTFRPDPTSSSFKRPTSNMN 490          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf3 (TNF receptor associated factor 3 [Source:NCBI gene;Acc:101161601])

HSP 1 Score: 77.411 bits (189), Expect = 1.129e-14
Identity = 92/433 (21.25%), Postives = 172/433 (39.72%), Query Frame = 3
Query:  144 QADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKS--CNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNH-EIMSLATENGLLRNHIENLHSNMELVTTSER---KSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERN------VNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELIN--PHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            +A   C  C+ ++       CG ++C  CI   L+  N  CP D++      I  ++  H        I  L V C  ++  C  +  L +I +H+ VC +  + CP  +  CK+     E         I +H     +Y E                 ST E  K ++ + ++ K+                   + C NH    SL     L+ +H E L      + +  +   + E+    ++ ++ RL  L+   +     ++   NR+ + +   S H      EI     DL+ ++++   YN    G   W I++  + +++      +++Y + FY+  +GYKMC  + L    +  G        +MRGE+D+ L WPF+   T+ L++  P  + L  +    +    +   ++RP  E N
Sbjct:   43 EAKYCCEACRLVLCQPRQTECGHRFCYSCINDILSCPNPVCPADMEPLFKDKIFRDVCCH------REIMALKVYCRSEANGCQEQMSLQQIPDHVNVCPFFEVPCPLGK--CKERMMRKE---------IPEHLAWKCKYRE-----------------STCEFCKNKMPLTELQKH----------KETVCPAFPVSCPNHCTSSSLPRSEKLMSSHTEKLLELELELRSLRQLRDEMESLRGTLDTVRTRLSALEQGGR---ASLETQLNRHDDML---SVH------EIRLADMDLRFQVLETASYN----GTLIWKIRDYKRRKQDAVAGKTLSLYSQPFYTGYFGYKMCARVYLNGDGMGKGTHLSLFFVVMRGEYDALLPWPFKQKVTLMLMDQGPSRKHLGDA----FKPDPSSSSFRRPVAEMN 411          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: ENSORLT00000020861.2 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101167626])

HSP 1 Score: 69.3218 bits (168), Expect = 5.795e-12
Identity = 83/356 (23.31%), Postives = 149/356 (41.85%), Query Frame = 3
Query:  417 NHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHE-----------NKEIEGK--VQEVFNRNAEWMERSSE--HGEEMKVEIYKQIRDL-------KLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            +HI+ C+     C +  +GC  S    E I +H      +H  LLL +I  ++  +E+L+ +       +E   Q++  L  S    ++ +++L  +  +    + C      +LAT           LHS M      + +SE    ++ +L +R  EL+ +           N+E+E      E +NR     +   E    +  ++E    +RDL       K+K +    Y+    G + W I + ++        R   ++  AFY+ KYGYKMCL I L       G        +MRG  D+ L WPF    T+ L++ +N+   + I+  +    +   ++RP  + N
Sbjct:  205 DHIKFCSKFKAPCRFHVVGCDTS-VEKEKIHDHERQCSYEHLNLLLHFIMGIKVSLESLQPQ------RLEVASQKLHELHQSLRDLELRMSQLGRSGTAPLQGV-C----AATLATS-------FTPLHSAMGAALELQLQSEKT--KVAELSRRCQELELKVSTFENIVCILNRELERSCATMEAYNRQHRLDQDKIEILSNKVRQLERTVSLRDLSIVEMEGKMKDMSAATYD----GIFIWKISDFTKKRQDAMAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGHSDALLKWPFNQKVTLMLLDQNNR---EHIIDAFRPDISSSSFQRPVSDMN 532          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 65.0846 bits (157), Expect = 9.834e-11
Identity = 78/341 (22.87%), Postives = 128/341 (37.54%), Query Frame = 3
Query:  408 KIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLN---DNNYSNQSEIHC-LNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            K  +H + C      CP+S +GCK S   N  I EH     ++H  LLL  +      +   R     S S   +    + + +   + C    +  +   D   S    I C LN E+                           ER S T           L    H+++  + K++ + N+  + +ERS    +    E  + +R+L+          C   G + W I + S         R   ++  AFYS KYGYKMCL + L       G        +MR ++D+ L WPF    T+ L++ +N+   + I+  +        ++RP  E N
Sbjct:  197 KFNDHAKSCAKSKSACPFSEVGCK-SVVENGKISEHEHSSTMEHLRLLLPMV------LSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREV---------------------------ERSSLT-----------LEAFSHQHRLDQEKIENLSNKIRQ-LERSLTVKDLQLSEAEQMVRELQY---------CTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR---EHIIDAFRPDITSTSFQRPVSEMN 479          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: traf2b (TNF receptor associated factor 2 [Source:NCBI gene;Acc:101159764])

HSP 1 Score: 65.0846 bits (157), Expect = 1.005e-10
Identity = 78/341 (22.87%), Postives = 128/341 (37.54%), Query Frame = 3
Query:  408 KIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLN---DNNYSNQSEIHC-LNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLE------RNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            K  +H + C      CP+S +GCK S   N  I EH     ++H  LLL  +      +   R     S S   +    + + +   + C    +  +   D   S    I C LN E+                           ER S T           L    H+++  + K++ + N+  + +ERS    +    E  + +R+L+          C   G + W I + S         R   ++  AFYS KYGYKMCL + L       G        +MR ++D+ L WPF    T+ L++ +N+   + I+  +        ++RP  E N
Sbjct:  204 KFNDHAKSCAKSKSACPFSEVGCK-SVVENGKISEHEHSSTMEHLRLLLPMV------LSMTRTRLDTSPSGEWQEDSGLGLYRAPDDGCGAAASVPSVDLDKKVSALENIVCVLNREV---------------------------ERSSLT-----------LEAFSHQHRLDQEKIENLSNKIRQ-LERSLTVKDLQLSEAEQMVRELQY---------CTYDGIFVWKITDFSHRRQEAVSGRAPAMFSPAFYSSKYGYKMCLRLYLNGDGTGRGTHLSLFFVVMRSKYDALLKWPFSQKVTLMLLDQNNR---EHIIDAFRPDITSTSFQRPVSEMN 486          
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Match: unm_sa808 (TNF receptor-associated factor 2 [Source:NCBI gene;Acc:101155367])

HSP 1 Score: 58.5362 bits (140), Expect = 1.332e-8
Identity = 75/387 (19.38%), Postives = 137/387 (35.40%), Query Frame = 3
Query:  417 NHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRK---EFSGSK-----STIERLKQEIEILKISKNTCQIEI---------------------------------------------ARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQ------LERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAG------LCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERN 1382
            +HI+ C+     C +  +GC  S    E I +H      +H  LLL YI  ++  +E L+    E +G K      ++  L+  +  L  + +   ++                                              A L    +S ++++  L      L  ++G   N +  L+  +E  TT+                  ME  +   +++    E  +     +ER+    +    E+  ++R++               G + W I + ++        R   ++  AFY+ KYGYKMCL I L       G        +MRG  D+ L WPF    T+ L++  N+   + I+  +        ++RP  E N
Sbjct:  204 DHIKFCSKFRTPCRFHVVGCDMS-VEKEKIHDHERAFAYEHLNLLLHYIMGMKVSMEGLQPQGLETAGHKLVELQKSLRDLEARVSQLSTTSSGPPVQGAAASSSSSSSGPPGPPASVPLPPPPTLPPTLSVSTSFTPLPSSVGAALELQLHSEKTKVAELGRRCTELEVKSGTFENVVCVLNREVERFTTT------------------MEASNRQHKLDQDKIEALSNKVRQLERTVGLKDLTVAEMEGRLREMAATTFD---------GVFIWRISDFAKKRQDAVAGRAPAMFSPAFYTSKYGYKMCLRIYLNGDGTGRGTHLSLFFVVMRGLSDALLKWPFNQKVTLMLLDQSNR---EHIIDAFRPDVTSSSFQRPVSEMN 559          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000026231.1 (SMESG000026231.1)

HSP 1 Score: 842.032 bits (2174), Expect = 0.000e+0
Identity = 413/415 (99.52%), Postives = 415/415 (100.00%), Query Frame = 3
Query:   75 MNSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSI 1319
            MNSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIR+LKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKS+
Sbjct:    1 MNSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRNLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSL 415          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 246.128 bits (627), Expect = 2.305e-74
Identity = 153/476 (32.14%), Postives = 260/476 (54.62%), Query Frame = 3
Query:   75 MNSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIE----NLHSNMELVTTSERKSETNWKEINKLKQ----RLMELDHENKEIEGKVQEVFNRNAEWMER-SSEHGEEMKVEIYKQIRDLKLKLVQIGV--YNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLG----------------------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERND--PIYK 1397
            ++ + + IY ++K+  F    E+  +L C IC ++MI A   PCGC +C +CI ++L+ D+ FCP     CQ ++I+   ++  D   N  IS++IVKCP K+C F+DEL  I NH+R C+ R +  P++ IGCK +   N+ ++ H   D   HS+LL + I NL  E+E+++ E    K    + KQ+I+ +++     Q +I  +  N   N+ EI  LN E++ L  EN  LR+ IE    ++++  + +   E KS+    +I++LKQ    +  EL+ E +    ++ ++  +NA    R  + +GE  K  I  +I +L+L+++++     N +  GE+EW I+N+SQ  ++  I+ + FYS   GYKMCLS+ +                        + I  G  +MRG+ D  LAWPF++  TI++I+  N  +++S  IKY D  +   W +P  +RN+  P+YK
Sbjct:    5 LDKMSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQQQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQL---QIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYK 477          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070162.1 (SMESG000070162.1)

HSP 1 Score: 245.358 bits (625), Expect = 3.339e-74
Identity = 153/473 (32.35%), Postives = 258/473 (54.55%), Query Frame = 3
Query:   84 LFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIE----NLHSNMELVTTSERKSETNWKEINKLKQ----RLMELDHENKEIEGKVQEVFNRNAEWMER-SSEHGEEMKVEIYKQIRDLKLKLVQIGV--YNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLG----------------------AYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERND--PIYK 1397
            + + IY ++K+  F    E+  +L C IC ++MI A   PCGC +C +CI ++L+ D+ FCP     CQ ++I+   ++  D   N  IS++IVKCP K+C F+DEL  I NH+R C+ R +  P++ IGCK +   N+ ++ H   D   HS+LL + I NL  E+E+++ E    K    + KQ+I+ +++     Q +I  +  N   N+ EI  LN E++ L  EN  LR+ IE    ++++  + +   E KS+    +I++LKQ    +  EL+ E +    ++ ++  +NA    R  + +GE  K  I  +I +L+L+++++     N +  GE+EW I+N+SQ  ++  I+ + FYS   GYKMCLS+ +                        + I  G  +MRG+ D  LAWPF++  TI++I+  N  +++S  IKY D  +   W +P  +RN+  P+YK
Sbjct:    1 MSESIYKIMKENNFEIVNEISKELKCYICNELMIKACSAPCGCCFCSDCIEQYLDGDDKFCPGTSRRCQMKMINYANDIVIDIRANVKISEIIVKCPRKNCEFEDELEMIENHVRTCDKRPISYPFNAIGCKVNEAMNDEMKAHLNEDNYWHSKLLTDLINNLLGEMESMKNENIELKRENSQFKQKIDNIELQSANQQQKICEMESNEMENRGEIEQLNEEMVVLKNENRRLRSEIETNAQSINAIRQQIGIIETKSQL---QIDELKQNHQQQQQELNDEAEMPRREINKLNEQNANGASRVDNNNGETFKQVIDGEINNLELRMIEMETRFINAQIRGEFEWKIENLSQQVKDKWIHSKPFYSGPNGYKMCLSVNINHLEIENLSQRVRGRRMCLNVIIDWRICVGFYMMRGDSDDKLAWPFKYAVTIDVIDTANGDIWRSETIKYSDRPDAAGWMKPVTDRNERIPVYK 470          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000014828.1 (SMESG000014828.1)

HSP 1 Score: 239.965 bits (611), Expect = 1.486e-72
Identity = 145/459 (31.59%), Postives = 244/459 (53.16%), Query Frame = 3
Query:   84 LFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHI----ENLHSNMELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERNDPIYKNELVTLNEFSRSLKHDQ 1448
            + + I+  +K+ K     E++ DL+CTIC ++MI A   PCGC++C +CI  +L E+  FCP     C+ Q+I+ + N+  D   N  IS+L+VKCP K C FKDEL  I NH+ +C  R + CP+S +GC+ +   N+ + +H       HS LL++   N  +E+E+++ E    K+    LKQ+++ +K+     Q +I+ L +   +  SEI  LN E++++  EN  LR  +    E+L+   +++   + KS+   +E+N+  Q   E ++E + +  K+ E+  +N + + R      E K  I K I             N E F E++W ++ +SQ  R   I+ + FYS K GYKMCLS  +    +     LMRG+ D  L WPF++   I++I+  + +++ S +I Y +      W +P  +RN  I    L+ L   S ++  DQ
Sbjct:    1 MSENIWKFMKENKIETGNEIKKDLMCTICNELMIKASNAPCGCRFCFDCIGNYLGENEQFCPGKSKWCKKQMINYSDNILIDCPINKMISELVVKCPRKYCLFKDELCLIENHMSLCEKRPISCPFSELGCEINEVVNDEMNDHLNEHGYWHSRLLIDSFNNFHSEMESMKNEIIELKTENNGLKQQLDDIKLQSTNQQKKISELENIENTMTSEITILNKEVVAIKNENRSLRMKVEKNAESLNEARQIIGEFQTKSQQQTEELNRYYQGQKEENNEIELLRRKINEICKQNLDLVSRLDNLDGEFKEIIDKNI-------------NEEIFEEFQWKVEKLSQQNRETEIFSKPFYSDKSGYKMCLSETIWDDLLYVYFHLMRGDSDDKLEWPFKYDVKIDVIDQQDSTIYTSQIISYSNRPTHLGWNKPSNDRNRGIL---LLKLPINSPAISSDQ 443          
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Match: SMESG000070140.1 (SMESG000070140.1)

HSP 1 Score: 236.113 bits (601), Expect = 6.922e-71
Identity = 149/439 (33.94%), Postives = 250/439 (56.95%), Query Frame = 3
Query:  105 LLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCLECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCPEKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLIDIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNTCQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIEN---LHSNM-ELVTTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSSEHGEEM-KVEIYKQIRDLKLKLVQ-----IGVYNCEKFGEYEWNIKNVSQLERNVNIYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFTIELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERNDPI 1391
            ++K+ KF    E+  +L C IC ++MI A   PCGC++C +CI  +L+E++ FCP     CQ +II+   ++  D   N  IS++IVKCP ++C F+DEL  I NH+R CN R + CP++ IGCK +   N+ ++ H   D   HS++L+  I NL +++E+++ E    K    + KQ  + LK+ ++T Q ++  ++    +N  EI  LN E++ L  EN  LR+ +E    L + M + +   E K +  + E+ +  Q+L +  ++  E+  ++ ++   NA    R   + E++ K  I +++ DL+L + +     I   +CE   E+EW I+N+SQL+R+  IY + FYS   GYK+CLS+ +    I     LMRG+FD  LAWPF++  TI++I+  +   + S + K+ D S D  W +P  E+N  I
Sbjct:    8 IMKENKFEIVNEISRELKCNICNELMIKACSAPCGCRFCSDCIEHYLDENDKFCPGKSRYCQKKIINYANDIAIDNAINIRISEIIVKCPIQNCEFEDELQIIANHMRTCNKRPISCPFNMIGCKVNEVMNDEMKAHLNEDNYCHSKILISLINNLLSDMESMKSEIVNLKKENSQFKQRFDTLKL-QSTNQQKMIEIDKKEMTNDEEIEELNEEMVVLKNENRKLRSEMEKFTELFNKMRQQIGMIETKFQQQFDELKQNHQQLQKQLNKKLEMLREIDKLSEENANCASRVDNNDEKIFKQSIDEKMSDLELGMTEMETRLINARHCE---EFEWKIENLSQLKRDKCIYSKPFYSGPSGYKLCLSVTISDV-IRIYFHLMRGKFDDKLAWPFKYAVTIDVIDSLDGKTYCSKIRKFTDCSGDTGWNKPSTEKNKGI 441          
The following BLAST results are available for this feature:
BLAST of TNF receptor-associated factor vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
TRAF61.147e-2225.58TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF61.147e-2225.58TNF receptor associated factor 6 [Source:HGNC Symb... [more]
TRAF34.325e-2024.54TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF34.325e-2024.54TNF receptor associated factor 3 [Source:HGNC Symb... [more]
TRAF31.344e-1622.25TNF receptor associated factor 3 [Source:HGNC Symb... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
trf-11.186e-626.71TNF Receptor Associated Factor (TRAF) homolog; TRF... [more]
trf-23.128e-638.71TNF Receptor Associated Factor (TRAF) homolog [So... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Traf61.488e-926.79gene:FBgn0265464 transcript:FBtr0071188[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf63.229e-1621.68TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf63.229e-1621.68TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf63.229e-1621.68TNF receptor-associated factor 6 [Source:NCBI gene... [more]
traf2a3.644e-1222.57Tnf receptor-associated factor 2a [Source:ZFIN;Acc... [more]
traf32.921e-1021.74TNF receptor-associated factor 3 [Source:ZFIN;Acc:... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ssh25.792e-1621.73slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
ssh26.019e-1622.45slingshot protein phosphatase 2 [Source:Xenbase;Ac... [more]
egf4.756e-1522.13epidermal growth factor [Source:Xenbase;Acc:XB-GEN... [more]
hspb62.142e-929.31heat shock protein family B (small) member 6 [Sour... [more]
TRAF21.912e-822.88TNF receptor associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Traf61.407e-2123.61TNF receptor-associated factor 6 [Source:MGI Symbo... [more]
Traf34.453e-2024.54TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf38.802e-1722.13TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf38.802e-1722.13TNF receptor-associated factor 3 [Source:MGI Symbo... [more]
Traf12.233e-1031.90TNF receptor-associated factor 1 [Source:MGI Symbo... [more]
back to top
BLAST of TNF receptor-associated factor vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y4K3|TRAF6_HUMAN5.506e-2225.58TNF receptor-associated factor 6 OS=Homo sapiens O... [more]
sp|B5DF45|TRAF6_RAT9.431e-2224.42TNF receptor-associated factor 6 OS=Rattus norvegi... [more]
sp|B6CJY4|TRAF6_CERAT1.045e-2125.32TNF receptor-associated factor 6 OS=Cercocebus aty... [more]
sp|B6CJY5|TRAF6_MACMU2.436e-2125.11TNF receptor-associated factor 6 OS=Macaca mulatta... [more]
sp|Q3ZCC3|TRAF6_BOVIN4.766e-2124.73TNF receptor-associated factor 6 OS=Bos taurus OX=... [more]
back to top
BLAST of TNF receptor-associated factor vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1E1011.577e-3626.04TRAF-6 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
I1ZID81.403e-2832.11TNF receptor associated factor-2 (Fragment) OS=Sch... [more]
A0A0F7GWW34.816e-2337.50TNF receptor associated factor 4 (Fragment) OS=Sch... [more]
A0A3M0JGK11.822e-2225.65Uncharacterized protein OS=Hirundo rustica rustica... [more]
T1DBK62.089e-2225.16TRAF-4 OS=Dendrocoelum lacteum OX=27895 PE=2 SV=1[more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf65.692e-1522.80TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.301e-1422.81TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf61.301e-1422.81TNF receptor associated factor 6 [Source:NCBI gene... [more]
traf2a1.209e-1224.17TNF receptor-associated factor 2-like [Source:NCBI... [more]
traf12.460e-1221.00TNF receptor-associated factor 1-like [Source:NCBI... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000000074.13.345e-1722.91pep scaffold:Pmarinus_7.0:GL482142:165593:173010:-... [more]
ENSPMAT00000002130.11.481e-1319.95pep scaffold:Pmarinus_7.0:GL484662:8457:12718:-1 g... [more]
ENSPMAT00000008091.16.051e-820.20pep scaffold:Pmarinus_7.0:GL477915:34322:50582:-1 ... [more]
traf61.100e-627.05TNF receptor-associated factor 6 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO316921.832e-1525.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316905.538e-1522.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352372.600e-1324.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO483942.736e-1222.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO494644.014e-1121.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of TNF receptor-associated factor vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf31.129e-1421.25TNF receptor associated factor 3 [Source:NCBI gene... [more]
ENSORLT00000020861.25.795e-1223.31TNF receptor-associated factor 2 [Source:NCBI gene... [more]
traf2b9.834e-1122.87TNF receptor associated factor 2 [Source:NCBI gene... [more]
traf2b1.005e-1022.87TNF receptor associated factor 2 [Source:NCBI gene... [more]
unm_sa8081.332e-819.38TNF receptor-associated factor 2 [Source:NCBI gene... [more]
back to top
BLAST of TNF receptor-associated factor vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000026231.10.000e+099.52SMESG000026231.1[more]
SMESG000070162.12.305e-7432.14SMESG000070162.1[more]
SMESG000070162.13.339e-7432.35SMESG000070162.1[more]
SMESG000014828.11.486e-7231.59SMESG000014828.1[more]
SMESG000070140.16.922e-7133.94SMESG000070140.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016053 ID=SMED30016053|Name=TNF receptor-associated factor|organism=Schmidtea mediterranea sexual|type=transcript|length=1744bp
CGCGATATATAACATTAATTAACTAATTAAAAAAGTTATTGAAAATTATT
AAATGTTAGATTCCCATTGAAATAATGAATTCATTATTCGATGAAATTTA
CGGATTACTAAAAAAATACAAGTTTATTTTTAATGTTGAAGTTCAGGCAG
ATTTACTTTGTACAATTTGTAAAGATATAATGATAAATGCCTATATTGGA
CCCTGTGGTTGTAAATATTGTTTGGAATGTATAATGAAACATTTGAATGA
AGATAACATCTTTTGTCCGAATGATGTGGACGAATGTCAAAATCAGATTA
TTGATATCAATATCAATTTGCATTTCGATTATTTAACAAATAATAATATA
TCGAAACTGATTGTTAAATGTCCTGAAAAAAGTTGTAATTTTAAAGATGA
ATTAATAAAAATCGGAAATCATATACGAGTTTGCAATTACCGTCACATGA
AATGTCCATATTCTAGAATCGGATGTAAACAATCATATACTACAAATGAA
AGCATTAGAGAGCATTTTCTAATTGATATTATAAAACACTCGGAATTATT
ACTAGAATATATTGAAAACTTACAGAATGAAATTGAAACTTTACGAAAAG
AATTTTCTGGATCGAAATCAACCATTGAAAGGTTAAAACAGGAAATTGAA
ATATTAAAGATCAGTAAAAACACCTGTCAAATTGAAATCGCAAGACTAAA
TGACAATAATTACTCAAACCAATCGGAAATCCATTGTTTGAATCACGAAA
TTATGTCACTAGCAACTGAAAATGGGTTATTGAGGAATCATATTGAAAAT
TTGCATAGTAATATGGAACTTGTGACGACATCTGAACGGAAATCAGAAAC
GAATTGGAAGGAAATAAACAAACTAAAACAAAGGTTGATGGAACTTGATC
ACGAAAATAAGGAAATAGAGGGAAAAGTACAGGAAGTATTTAATAGAAAT
GCTGAATGGATGGAGCGCTCAAGTGAGCACGGTGAAGAAATGAAAGTCGA
AATTTACAAGCAAATACGAGATTTAAAATTAAAACTTGTTCAAATAGGAG
TTTATAATTGCGAAAAATTTGGAGAATACGAATGGAATATCAAAAACGTT
TCACAGCTCGAAAGAAATGTAAATATCTACGGTGAGGCTTTCTATTCGCA
TAAATACGGATATAAAATGTGCTTGAGTATTAAACTTGGAGCTTATTGGA
TACTTGCGGGTTTATGTTTGATGAGAGGGGAATTTGACAGTTATCTCGCC
TGGCCATTCCAGCACGGGTTCACAATTGAGTTGATAAATCCCCATAATCA
ATCCCTTTTCAAAAGTATTTTGATTAAATATTTTGATTTCTCTAATGACA
AGAAATGGAAAAGGCCTAAAAAGGAAAGAAATGATCCAATATACAAAAAT
GAATTGGTGACCCTGAACGAATTTTCAAGGTCTCTCAAACATGATCAGAT
AATTATCAAATGCAAGCTGATTATCATTAAAGAATAAATTTGTTGTGTTT
AATCTGTTATGTTTGATTGAGCAATTGGTTTTAGCAATCTTTCTTGTGAT
TGGTGGAATCTGATGAATTTATCAAAATTCAATTGGATGAATATTTTTTC
ATTACATTTTGATTGGATATATATATTTATATTATGTCAGTTGATAAATA
CAACCTATTGGAAAATTTAGTTATTTTCGAAGCATTCAATATATTTACTC
GGTGCCAGGTCAAATCTACCCAACGGTAAATTTTCTCTCAGTAC
back to top

protein sequence of SMED30016053-orf-1

>SMED30016053-orf-1 ID=SMED30016053-orf-1|Name=SMED30016053-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=471bp
MNSLFDEIYGLLKKYKFIFNVEVQADLLCTICKDIMINAYIGPCGCKYCL
ECIMKHLNEDNIFCPNDVDECQNQIIDININLHFDYLTNNNISKLIVKCP
EKSCNFKDELIKIGNHIRVCNYRHMKCPYSRIGCKQSYTTNESIREHFLI
DIIKHSELLLEYIENLQNEIETLRKEFSGSKSTIERLKQEIEILKISKNT
CQIEIARLNDNNYSNQSEIHCLNHEIMSLATENGLLRNHIENLHSNMELV
TTSERKSETNWKEINKLKQRLMELDHENKEIEGKVQEVFNRNAEWMERSS
EHGEEMKVEIYKQIRDLKLKLVQIGVYNCEKFGEYEWNIKNVSQLERNVN
IYGEAFYSHKYGYKMCLSIKLGAYWILAGLCLMRGEFDSYLAWPFQHGFT
IELINPHNQSLFKSILIKYFDFSNDKKWKRPKKERNDPIYKNELVTLNEF
SRSLKHDQIIIKCKLIIIKE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005164tumor necrosis factor receptor binding
GO:0005515protein binding
GO:0008270zinc ion binding
GO:0004842ubiquitin-protein transferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
Vocabulary: biological process
TermDefinition
GO:0042981regulation of apoptotic process
GO:0006955immune response
GO:0007165signal transduction
GO:0016567protein ubiquitination
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR043211TNF_rcpt-assoc_TRAF
IPR008974TRAF-like
IPR001293Znf_TRAF
IPR013083Znf_RING/FYVE/PHD
IPR001841Znf_RING
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 156..204
NoneNo IPR availableCOILSCoilCoilcoord: 264..291
NoneNo IPR availablePANTHERPTHR10131:SF129TNF RECEPTOR-ASSOCIATED FACTOR 6coord: 13..465
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 23..68
IPR001293Zinc finger, TRAF-typePFAMPF02176zf-TRAFcoord: 93..142
e-value: 4.7E-6
score: 27.2
IPR008974TRAF-likeGENE3DG3DSA:2.60.210.10coord: 292..468
e-value: 5.0E-27
score: 96.6
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 334..465
IPR008974TRAF-likeSUPERFAMILYSSF49599TRAF domain-likecoord: 94..149
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 19..94
e-value: 9.7E-9
score: 36.9
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 95..148
e-value: 7.1E-5
score: 25.0
IPR043211TNF receptor-associated factor TRAFPANTHERPTHR10131TNF RECEPTOR ASSOCIATED FACTORcoord: 13..465
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 29..67
score: 9.332