Peptidase S1 S6 chymotrypsin Hap active site isoform 1

Overview
NamePeptidase S1 S6 chymotrypsin Hap active site isoform 1
Smed IDSMED30016027
Length (bp)1185
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 (SMED30016027) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase S1 S6 chymotrypsin Hap active site isoform 1 (SMED30016027) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 (SMED30016027) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase S1 S6 chymotrypsin Hap active site isoform 1 (SMED30016027) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016027

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30016027SMESG000000812.1 SmedASXL_008765SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
head regionSMED30016027SMESG000000812.1 dd_Smed_v6_11609_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Match: G4V8I9 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_048380 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.455e-55
Identity = 97/227 (42.73%), Postives = 140/227 (61.67%), Query Frame = 1
Query:  220 LSNIFTL--LSTVICVCFDPEKELKKCSDEYKFVLPNRDI-GYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINS 891
            L NIF +  L+T    CF+ E EL  CS ++K  +P   + GY+FG+GS+NDTE MC+T+WHI +  CM  +A+  C ++ ++     IW  +LD  KF+  A Y+C   NL++   H+ +CL QQE  A QCA  ++ TI+E + AL N+S  L S   +Y + +K  L +YECK L+ +L CLYNILH  C  NAV LI+ YF+E LP  C + YE  L+ ++ S
Sbjct:    5 LINIFLIQYLTTARKQCFNLEHELDYCSRKHKVHIPTSQLSGYSFGYGSLNDTEYMCRTRWHILVFHCMRKRAEESCNHSDEEKFRQIIWSISLDTRKFEKAAAYICHEHNLRILREHQYKCLKQQEKLAEQCAVHRNETIKEVVLALHNQSSRLLSSPNEYYSIIKHTLTSYECKSLRTKLDCLYNILHNECPSNAVRLIMNYFKETLPDGCTFNYETRLSKHLES 231          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Match: A0A183QQF4 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 1.569e-55
Identity = 103/249 (41.37%), Postives = 147/249 (59.04%), Query Frame = 1
Query:  220 LSNIFTL--LSTVICVCFDPEKELKKCSDEYKFVLPNRDI-GYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPML---------TNYINSDYYKNRQNAIIDT 930
            L NIF +  L+T    CF+ E EL  CS ++K  +P   + GY+FG+GS+NDTE MC+T+WHI +  CM  +A+  C ++ ++     IW  +LD  KF+  A Y+C   NL++   H+ +CL QQE  A QCA  ++ TI+E + AL N+S  L S   +Y + +K  L +YECK L+ +L CLYNILH  C  NAV LI+ YF+E LP  C + YE  L         T  IN+D Y + +N +  T
Sbjct:    5 LINIFLIQYLTTARKQCFNLEHELDYCSRKHKVHIPTSQLSGYSFGYGSLNDTEYMCRTRWHILVFHCMRKRAEESCNHSDEEKFRQIIWSISLDTRKFEKAAAYICHEHNLRILREHQYKCLKQQEKLAEQCAVHRNETIKEVVLALHNQSSRLLSSPNEYYSIIKHTLTSYECKSLRTKLDCLYNILHNACPSNAVRLIMNYFKETLPDGCTFNYETRLSKHLESVQMTQLINNDEYIDERNIMKQT 253          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Match: A0A4E0RRR4 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_000407 PE=4 SV=1)

HSP 1 Score: 195.282 bits (495), Expect = 1.912e-55
Identity = 88/224 (39.29%), Postives = 138/224 (61.61%), Query Frame = 1
Query:  229 IFTLLSTVICV---CFDPEKELKKCSDEYKFVLP-NRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYIN 888
            + TL+  V+C+   CF+ EKEL+ C+ +Y+  +P N   GY+FG+GS+NDTE MC+++WHI +  CM  +++ +C    ++     IW  +L+  KF+  A Y+C   NL++   HK +CL +QE  A QC   ++ TI E + AL N+S  L +   +Y   ++  L++YECK L  +L+CLY +LH  C PNAV L++ YF+E LP  C + YE  L  +I+
Sbjct:   16 VITLVYPVMCLRKHCFNLEKELEYCARKYRVQIPTNPMAGYSFGYGSLNDTEYMCRSKWHILVFQCMRNRSEEMCHKTEEEKFRQLIWSISLETRKFERAAAYMCHEHNLRILNEHKSKCLARQEKVAEQCNVHRNDTIREVVAALQNQSSRLSTSSNEYYGLMRNTLSHYECKSLLAKLECLYAVLHTTCPPNAVRLVMNYFKETLPDGCTFNYEVRLQKHID 239          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Match: A0A183LXH6 (Uncharacterized protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS8501 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 3.130e-55
Identity = 105/256 (41.02%), Postives = 148/256 (57.81%), Query Frame = 1
Query:  226 NIFTLLSTVICV--CFDPEKELKKCSDEYKFVLPNRDI-GYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQ 984
            NIF +   +I    CF+ E EL  CS ++K  +P   + GY+FG+GS+NDTE MC+T+WHI +  CM  +A+  C ++ ++     IW  +LD  KF+  A Y+C   NL++   H+ RCL QQE  A QCA  ++ TI+E + AL N+S  L S   +Y + +K  L +YECK L+ +L CLYNILH  C  NAV LI+ YF+E LP  C + YE  L+ ++ S    N  N   D     +   K   INN NQ
Sbjct:    3 NIFLIQYLIIARKQCFNLEHELDYCSTKHKVHIPTSQLSGYSFGYGSLNDTEYMCRTRWHILVFHCMRKRAEESCNHSDEEKFRQIIWSISLDTRKFEKAAAYICHEHNLRILREHQYRCLKQQEKLAEQCAVHRNETIKEVVLALHNQSSRLLSSPNEYYSIIKHTLTSYECKSLRTKLDCLYNILHNACPSNAVRLIMNYFKETLPDGCTFNYETRLSKHLESLQMTNLINN--DENIDEMNIRKQTIINNLNQ 256          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Match: A0A3Q0KFJ8 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 193.741 bits (491), Expect = 4.614e-55
Identity = 97/227 (42.73%), Postives = 140/227 (61.67%), Query Frame = 1
Query:  220 LSNIFTL--LSTVICVCFDPEKELKKCSDEYKFVLPNRDI-GYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINS 891
            L NIF +  L+T    CF+ E EL  CS ++K  +P   + GY+FG+GS+NDTE MC+T+WHI +  CM  +A+  C ++ ++     IW  +LD  KF+  A Y+C   NL++   H+ +CL QQE  A QCA  ++ TI+E + AL N+S  L S   +Y + +K  L +YECK L+ +L CLYNILH  C  NAV LI+ YF+E LP  C + YE  L+ ++ S
Sbjct:   22 LINIFLIQYLTTARKQCFNLEHELDYCSRKHKVHIPTSQLSGYSFGYGSLNDTEYMCRTRWHILVFHCMRKRAEESCNHSDEEKFRQIIWSISLDTRKFEKAAAYICHEHNLRILREHQYKCLKQQEKLAEQCAVHRNETIKEVVLALHNQSSRLLSSPNEYYSIIKHTLTSYECKSLRTKLDCLYNILHNECPSNAVRLIMNYFKETLPDGCTFNYETRLSKHLES 248          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Match: SMESG000000812.1 (SMESG000000812.1)

HSP 1 Score: 608.986 bits (1569), Expect = 0.000e+0
Identity = 292/293 (99.66%), Postives = 293/293 (100.00%), Query Frame = 1
Query:  184 MMSIKIRNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI 1062
            MMSIK+RNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI
Sbjct:    1 MMSIKVRNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI 293          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Match: SMESG000000812.1 (SMESG000000812.1)

HSP 1 Score: 605.52 bits (1560), Expect = 0.000e+0
Identity = 291/292 (99.66%), Postives = 292/292 (100.00%), Query Frame = 1
Query:  187 MSIKIRNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI 1062
            MSIK+RNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI
Sbjct:    1 MSIKVRNFAGFLSNIFTLLSTVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPENGFQKQSCIVYRVSVYLQVFLTI 292          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Match: SMESG000038428.1 (SMESG000038428.1)

HSP 1 Score: 206.838 bits (525), Expect = 4.454e-64
Identity = 101/213 (47.42%), Postives = 134/213 (62.91%), Query Frame = 1
Query:  256 CVCFDPEKELKKCSDEYKFV-LPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINS 891
            C CF+PEKE   C++   F  +P   IGY FG+GSINDTE MC+++WHIK+ DCM    K+ C+   +   +  IWEFTLD  +   G  Y+C+  NL++F  HK +CL+Q E  A  C K K++ I E I A++N+SQ   S   +Y   +K ILN YECK LK +L CLY +LH  C P+AV LIL YF E LPSNC Y Y+  L  +I+S
Sbjct:   22 CSCFNPEKEKINCTNSNNFTKVPKLGIGYDFGYGSINDTEDMCRSKWHIKVYDCMKKLVKIRCE---KIAFYKIIWEFTLDTGRLLKGVKYICEDHNLRIFNEHKSKCLLQNEREAESCMKFKASAINETIMAISNKSQTSFSSQEEYYANIKAILNKYECKALKMKLGCLYELLHSRCSPDAVTLILNYFIETLPSNCYYHYQIQLQKFIDS 231          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Match: SMESG000013347.1 (SMESG000013347.1)

HSP 1 Score: 139.428 bits (350), Expect = 1.439e-38
Identity = 76/203 (37.44%), Postives = 112/203 (55.17%), Query Frame = 1
Query:  262 CFDPEKELKKCSD-----EYKFVLPNRDIGYAFGFGSINDTETMCKTQWHIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQNLQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEY 855
            CF+P+  +  C       EY + L     GY FGFGSI D E MCKT+WHI ++ CM   ++  C  + +      +WEFTL + +++  A+Y+CK  NL +F  +K  C  + E +A  C+  +    ++ I+ L   S    +  Y  +  V+ +L  YEC GLK +L CL  +L  +C PNAV L++ YFRE LPSNC Y
Sbjct:    3 CFEPKIAMNYCIKLNNFPEYDWTLK----GYDFGFGSIEDLENMCKTKWHIVIVKCMQKISQQNCSYSDETKFQKVVWEFTLSSDRYEKAAEYICKEFNLNIFEQYKINCFQKNEKSAEICSIKRKEASDQGIQFLRLNSTINKNQPYHIN--VQNVLIIYECLGLKNKLNCLQEVLAKDCAPNAVELLINYFRETLPSNCNY 199          
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Match: SMESG000060842.1 (SMESG000060842.1)

HSP 1 Score: 93.2041 bits (230), Expect = 1.164e-22
Identity = 49/103 (47.57%), Postives = 64/103 (62.14%), Query Frame = 1
Query:  613 KLKSATIEEAIKALANESQNLHSGHYQYSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPSNCEYVYEPMLTNYINSDYYKNRQNAI 921
            K K++ I E I A++N+SQ   S   +Y   +K ILN YECK LK +L CLY +LH  C P+AV LIL YF E LPSNC Y Y+  L  +I+S   K+  + I
Sbjct:    2 KFKASAINETIMAISNKSQTSFSSQEEYYANIKAILNKYECKALKMKLGCLYELLHSRCSPDAVTLILNYFIETLPSNCYYHYQIQLQKFIDSLKIKSIHSTI 104          
The following BLAST results are available for this feature:
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V8I91.455e-5542.73Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A183QQF41.569e-5541.37Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
A0A4E0RRR41.912e-5539.29Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A183LXH63.130e-5541.02Uncharacterized protein OS=Schistosoma margrebowie... [more]
A0A3Q0KFJ84.614e-5542.73Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase S1 S6 chymotrypsin Hap active site isoform 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000000812.10.000e+099.66SMESG000000812.1[more]
SMESG000000812.10.000e+099.66SMESG000000812.1[more]
SMESG000038428.14.454e-6447.42SMESG000038428.1[more]
SMESG000013347.11.439e-3837.44SMESG000013347.1[more]
SMESG000060842.11.164e-2247.57SMESG000060842.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016027 ID=SMED30016027|Name=Peptidase S1 S6 chymotrypsin Hap active site isoform 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1185bp
AAAAACTGTGATTGCAGAAATTTCCAAAAACAAATCAACCAATCAAAATG
AAGATTAATATTAACCTATTAGAATTGGATACACTAACAATACATGTACA
ATGTTTACAATAACGTGGTTATTAGAAGGAAGATTAGAAATTATCAAAAA
ACTATCAAAGCTAAAAGATGGTTAGGAACAATAATGATGTCAATTAAAAT
ACGGAATTTTGCCGGATTTTTATCAAATATTTTTACACTGCTCTCAACTG
TGATTTGTGTTTGCTTCGATCCAGAAAAAGAGCTAAAAAAATGTTCGGAT
GAATATAAATTTGTTTTACCAAATCGTGATATCGGATATGCTTTTGGATT
TGGTTCAATAAACGACACAGAAACCATGTGCAAAACGCAATGGCACATTA
AGTTATTAGACTGCATGAGTACAAAAGCCAAACTATTGTGTAAAAATAAT
CCTCAAGACAACATTTTTCTTACAATTTGGGAATTTACATTGGATAATAC
GAAATTTAAGAGTGGAGCAGATTATTTGTGCAAACCCCAAAATTTACAAG
TATTTTACACTCATAAGGACCGGTGCTTGGTCCAACAAGAAACGGCTGCA
AATCAATGTGCAAAACTTAAATCTGCCACCATTGAAGAAGCGATCAAAGC
TCTTGCAAATGAATCTCAAAATTTACATTCCGGACACTATCAATATTCCA
ATTACGTAAAGAAAATCTTGAACAATTATGAATGCAAAGGATTAAAACGA
CAACTGAAATGCCTTTACAACATTCTTCACATCAATTGCCACCCGAATGC
TGTCCATCTCATTCTAGGCTATTTCAGAGAAATCCTTCCATCTAATTGTG
AATATGTATATGAACCTATGCTCACGAACTATATAAATAGTGATTACTAT
AAAAATAGGCAAAATGCAATAATTGATACCGGTACCCCTTCAGTAGTTTC
ATTGAAAAATCGGCAAATTAATAATGACAATCAAGAACCGGAAAATGGTT
TTCAGAAACAATCTTGTATAGTTTATAGAGTTTCGGTTTATCTTCAAGTT
TTTTTAACAATTTTTCAACGGTTTCTGTTTTTTGAAATATTTTGATTTTA
TTTTTCCAAGCCAACACACAAATCAATCATGATGTATTAGATAGAACATA
ATTAAAATTCTTTTATGGATTAAAATAAATTGTGA
back to top

protein sequence of SMED30016027-orf-1

>SMED30016027-orf-1 ID=SMED30016027-orf-1|Name=SMED30016027-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=334bp
MYNVYNNVVIRRKIRNYQKTIKAKRWLGTIMMSIKIRNFAGFLSNIFTLL
STVICVCFDPEKELKKCSDEYKFVLPNRDIGYAFGFGSINDTETMCKTQW
HIKLLDCMSTKAKLLCKNNPQDNIFLTIWEFTLDNTKFKSGADYLCKPQN
LQVFYTHKDRCLVQQETAANQCAKLKSATIEEAIKALANESQNLHSGHYQ
YSNYVKKILNNYECKGLKRQLKCLYNILHINCHPNAVHLILGYFREILPS
NCEYVYEPMLTNYINSDYYKNRQNAIIDTGTPSVVSLKNRQINNDNQEPE
NGFQKQSCIVYRVSVYLQVFLTIFQRFLFFEIF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..25
score: 0.629