Chromatin assembly factor 1 subunit A

Overview
NameChromatin assembly factor 1 subunit A
Smed IDSMED30016021
Length (bp)1901
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Chromatin assembly factor 1 subunit A (SMED30016021) t-SNE clustered cells

Violin plots show distribution of expression levels for Chromatin assembly factor 1 subunit A (SMED30016021) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Chromatin assembly factor 1 subunit A (SMED30016021) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Chromatin assembly factor 1 subunit A (SMED30016021) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016021

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016021SMESG000061926.1 SmedASXL_015983SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016021SMESG000061926.1 SmedASXL_015983SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
nervous systemSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016021SMESG000061926.1 Contig51169newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016021SMESG000061926.1 Contig51169uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
zeta neoblastSMED30016021SMESG000061926.1 dd_Smed_v4_8919_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30016021SMESG000061926.1 SMED_03189_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30016021SMESG000061926.1 SMED_03189_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Human
Match: CHAF1A (chromatin assembly factor 1 subunit A [Source:HGNC Symbol;Acc:HGNC:1910])

HSP 1 Score: 56.6102 bits (135), Expect = 1.248e-7
Identity = 99/422 (23.46%), Postives = 171/422 (40.52%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIE----------------KKLINSLKDL-----LVNSETYLEELSANKTGSGKC--EKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFR------MFWEYNLSKKLPDVTF--------ENDLQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQ 1625
            A +  FF K K  Q           + G F P EIK+ M ++P  R                      + LKDL     L +  T++   +A+   S     E+      PE +     +L    L F EN RP Y+GTW K + +I    P A+D    DYE+DSD+EWE E   +  S    +++D+  ++E ED  F VPHGYLS+ E   +   D             P  ++ RQ +   +  +F A+ K++   + P+  G  + ++ D         G+  +++ +    F  +  L +  +     +K +    + + Q++ L+H N      +  EF+      +   +  S + P  T+        +  +  K   +  I +   +EK  +        W V P+V+Q +Q
Sbjct:  443 AEITRFFQKPKTPQAPKTLAG----SCGKFAPFEIKEHMVLAPRRRTAFHPDLCSQLDQLLQQQSGEFSFLKDLKGRQPLRSGPTHVSTRNADIFNSDVVIVERGKGDGVPERRKFGRMKL----LQFCENHRPAYWGTWNKKTALIRARDPWAQDTKLLDYEVDSDEEWEEEEPGESLSHSEGDDDDDMGEDEDEDDGFFVPHGYLSEDEGVTEECAD-------------PENHKVRQKLKAKEWDEFLAKGKRF-RVLQPVKIGCVWAADRD-------CAGDDLKVLQQFAACF--LETLPAQEEQTPKASKRERRDEQILAQLLPLLHGNVNGSKVIIREFQEHCRRGLLSNHTGSPRSPSTTYLHTPTPSEDAAIPSKSRLKRLISENSVYEKRPDFR----MCWYVHPQVLQSFQ 829          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Celegans
Match: chaf-1 (CHromatin Assembly Factor [Source:UniProtKB/TrEMBL;Acc:Q9U380])

HSP 1 Score: 66.2402 bits (160), Expect = 2.990e-11
Identity = 60/178 (33.71%), Postives = 84/178 (47.19%), Query Frame = 3
Query:  744 IQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYE--SGEDIAS--SDNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQ---AERKQYVHQ---------------INPIVTGPCF 1211
            I+ + +  +K+K   F  N RP YYGTWRK S+I++   PLAE+ G  DY + SD EWE E   GE+  S     +++++     ED  F VP  YLSDGE   D   D + I       K+P     ++I I+  D +     AERK  + Q               + P   GP F
Sbjct:  290 IESSKARNMKAKLFQFHGNRRPQYYGTWRKKSKIVSGSCPLAEEIG-IDYNVVSDDEWEDEPSDGEECNSDDDAEKDNDDDDGGEEDDGFFVPPCYLSDGEGDEDSTSDND-IAGDKKKEKQP-----KRITIDSDDDENSTDAAERKARLAQRAEDWAKRTGKKELAMKPRAVGPVF 460          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Fly
Match: Caf1-180 (gene:FBgn0030054 transcript:FBtr0071228)

HSP 1 Score: 79.7221 bits (195), Expect = 4.923e-15
Identity = 78/249 (31.33%), Postives = 113/249 (45.38%), Query Frame = 3
Query:  762 TRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDNXXXXXXXXXXXXXSF---MVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDY-----------DNPTNHTKIKSVPPEAVP---------QIIRLVHCNQMSRVKLCYEF 1439
            TR+K+K L F +N RPPYYGTWRK S  I+   PLA+D   FDYE+DSD EWE E   +  S+  +E E+  EE  +  +    VPHG+LSD E   D D  E+             T E ++  +++  ++F  E K+   +I   + GP +   +D N       GN   +       FP I     D            + P    +    P + VP         Q++RL H N+ S+  L  E+
Sbjct:  765 TRMKAKYLHFADNRRPPYYGTWRKKSSSISARRPLAQDKVLFDYEVDSDCEWEEEEPGESLSASEDEKEKESEEESEEEYNEWYVPHGHLSDEELQNDGDGMEDG-----------HTREAQKAKLQVLQQEFAQEMKKQTKKIKARLLGPVW---LDEN-------GNKSEL-------FPAIFAHTIDMYACWQVEPLSLEPPPEPERQDQTPEQPVPLQLDDRLMQQLVRLTHGNRNSKTFLINEY 985          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 70.0922 bits (170), Expect = 5.619e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  318 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 510          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 69.707 bits (169), Expect = 6.389e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  304 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 496          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 69.707 bits (169), Expect = 7.437e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  383 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 575          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 69.3218 bits (168), Expect = 8.459e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  367 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 559          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 69.3218 bits (168), Expect = 8.671e-12
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  336 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 528          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Xenopus
Match: CHAF1A (chromatin assembly factor 1 subunit A [Source:NCBI gene;Acc:100485264])

HSP 1 Score: 76.6406 bits (187), Expect = 7.411e-14
Identity = 74/237 (31.22%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERI--EKKLINSLKDLL--VNSET-YLEELSANK-----------TGSGKCEKTWPMSEPEIQLATSTRL----------------KSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDN----XXXXXXXXXXXXXSFMVPHGYLSDGEDSID---LDPDEEQI 1070
            A +  FF K K  Q    +     ++ G F P EIKKDM ++P+ RI  E +    L   L   NS + +L+E+   K             S + +    + EP+  L ++  +                + K L F EN RP Y+GTW + S++I P  P  +D G  DYE DSD+EWE E   +  S       ++D + ++E +D  F VPHGYLSD E   D    DP+ +++
Sbjct:  311 AEITRFFQKPKTPQAPKTFA----RSCGKFAPFEIKKDMALAPLCRIDFEPEASEELDKFLQEQNSRSNFLDEIKKRKPRKMGQTIVPTINSIEVDGVQVLEEPDPVLGSNMVIEGHVKDIGVPERIKFGRMKLLQFCENYRPAYWGTWNRRSRVINPRQPWIQDTGILDYEADSDEEWEEEEPGESLSHSEGENEDDDPKEEDEEDDDGFFVPHGYLSDDEGVSDEECTDPENQKV 543          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Xenopus
Match: CHAF1A (chromatin assembly factor 1 subunit A [Source:NCBI gene;Acc:100485264])

HSP 1 Score: 76.2554 bits (186), Expect = 9.157e-14
Identity = 74/237 (31.22%), Postives = 111/237 (46.84%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERI--EKKLINSLKDLL--VNSET-YLEELSANK-----------TGSGKCEKTWPMSEPEIQLATSTRL----------------KSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDN----XXXXXXXXXXXXXSFMVPHGYLSDGEDSID---LDPDEEQI 1070
            A +  FF K K  Q    +     ++ G F P EIKKDM ++P+ RI  E +    L   L   NS + +L+E+   K             S + +    + EP+  L ++  +                + K L F EN RP Y+GTW + S++I P  P  +D G  DYE DSD+EWE E   +  S       ++D + ++E +D  F VPHGYLSD E   D    DP+ +++
Sbjct:  357 AEITRFFQKPKTPQAPKTFA----RSCGKFAPFEIKKDMALAPLCRIDFEPEASEELDKFLQEQNSRSNFLDEIKKRKPRKMGQTIVPTINSIEVDGVQVLEEPDPVLGSNMVIEGHVKDIGVPERIKFGRMKLLQFCENYRPAYWGTWNRRSRVINPRQPWIQDTGILDYEADSDEEWEEEEPGESLSHSEGENEDDDPKEEDEEDDDGFFVPHGYLSDDEGVSDEECTDPENQKV 589          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Mouse
Match: Chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:MGI Symbol;Acc:MGI:1351331])

HSP 1 Score: 54.6842 bits (130), Expect = 3.782e-7
Identity = 65/216 (30.09%), Postives = 101/216 (46.76%), Query Frame = 3
Query:  492 FFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKDLLVN-----SETYLEELSAN---KTGSGK-CEKTWPMSEPEIQLATSTRL----------KSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID--LDPDEEQI 1070
            FF K K  Q           + G F P EIK+ M ++P  R         +   +      + T+L +L +    ++G  + C     +   ++ +  S+++          + K L F EN RP Y+GTW K + II P  P A+D    DYE+DSD EWE E   +  S    +E+D+  ++E ED  F VPHGYLS+ E   +   DP+  ++
Sbjct:  427 FFQKPKTPQAPKTLAG----SCGKFAPFEIKEHMVLAPRCRAALDQDLCDQLDQLLQQQSVASTFLSDLKSRLPLRSGPTRVCGHDTDIMNRDVVIVESSKVDGVSERKKFGRMKLLQFSENHRPAYWGTWNKKTAIIRPRNPWAQDKDLLDYEVDSDDEWEEEEPGESLSHSEGDEDDDVGEDEDEDDGFFVPHGYLSEDEGVTEECADPENHKV 638          
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Match: sp|A0JMK9|CAF1A_DANRE (Chromatin assembly factor 1 subunit A OS=Danio rerio OX=7955 GN=chaf1a PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 5.614e-11
Identity = 59/193 (30.57%), Postives = 92/193 (47.67%), Query Frame = 3
Query:  558 GSFKPIEIKKDMKISPIERIE----------------KKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID----LDPDEEQI 1070
            G F P EIK  M ++P+ R++                   +N LKD   +            +  G C       + +     S   + K L F +N RP Y+GTW K S  I+P  PL  D    DYE+DSD+EWE E   +  S    +++DE  +++ +D  F VPHGYLS+GE +++     DP+++++
Sbjct:  383 GKFAPFEIKAHMSLAPLTRVQCEDSVLEDLDRYLAQPDSTLNGLKDWTGHKPRSSGPTRPRHSAQGDCVVITESQKADDGPDRSRYGRMKLLHFHDNYRPAYWGTWSKKSTHISPRCPLRLDKDLLDYEVDSDEEWEEEEPGESLSHSEGDDDDEAGEDDDDDDGFFVPHGYLSEGEGALEDEEGGDPEKQKV 575          
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Match: sp|Q5R1T0|CAF1A_CHICK (Chromatin assembly factor 1 subunit A OS=Gallus gallus OX=9031 GN=CHAF1A PE=1 SV=1)

HSP 1 Score: 68.9366 bits (167), Expect = 1.053e-10
Identity = 72/227 (31.72%), Postives = 108/227 (47.58%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYV-SCGLKNIGSFKPIEIKKDMKISPIERIE--KKLINSLKDLLV--NSE-TYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRL---------------------KSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSD-QEWEYESGEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGEDSI-DLDPDEEQI 1070
            A +  FF K K  Q       SCG      F P EIK++M ++P+ RI      +  L  LL   NSE ++L +L        KC K        +  +T T                       + K L F EN RP Y+GTW K + +I P  P ++D    DYE+DSD +  E E GE ++ S+ +++EE ++E +D  F +PHGYLS+ E    + DP+ +++
Sbjct:  420 AEITRFFQKPKTPQAPKILAGSCG-----KFAPFEIKENMVLAPLCRIALYPDFLEQLDRLLRAQNSEVSFLRDL--------KCRKPRKTGPTFVNSSTDTVNSDVVVVDNCKTDAVPERGKFGRMKLLQFCENHRPAYWGTWNKKTTMIRPRNPWSKDSKLLDYEVDSDEEWEEEEPGESLSHSEGDDEEEGEDEDDDDGFFIPHGYLSEDEGVTEECDPENQKV 633          
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Match: sp|Q9SXY0|FAS1_ARATH (Chromatin assembly factor 1 subunit FAS1 OS=Arabidopsis thaliana OX=3702 GN=FAS1 PE=1 SV=1)

HSP 1 Score: 67.781 bits (164), Expect = 1.987e-10
Identity = 83/332 (25.00%), Postives = 135/332 (40.66%), Query Frame = 3
Query:  753 ATSTRLKSKT----LSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEW----------EYESGEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGE----DSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTG---EGFP------VICNLLSDYD-----------NPTNHTKIKSVPPEAVPQIIRLVH-CNQ-MSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQL 1628
            ++S R KS+     L F ++ RP +YG W   SQ++ P  PL +DP   DYE+DSD+EW          + E  ED  S +    +   E+  +  FMVP GYLS+ E    D +D+DP E+     N T+ +          +  + K  Q      + +  P++        +   +     G      IC        FP      +  N + D D            P +++K K +P   +  ++  +  C+Q ++RV             L +K PDV                 K +  +K++EI+D +D  W VK EV+ +  L
Sbjct:  469 SSSNRKKSRRVKQLLQFDKSCRPGFYGIWPSQSQVVKPRRPLQKDPE-LDYEVDSDEEWEEEEAGESLSDCEKDED-ESLEEGCSKADDEDDSEDDFMVPDGYLSEDEGVQVDRMDIDPSEQDA---NTTSSKQDQESPEFCALLQQQKHLQNLTDHALKKTQPLIICNLTHEKVSLLAAKDLEGTQKVEQICLRALMVRQFPWSSLIEISINDIQDEDQEASKFSCSQSTPPSNSKAKIIPDSDLLTVVSTIQSCSQGINRVV----------ETLQQKFPDVP----------------KTKLRQKVREISDFEDSRWQVKKEVLTKLGL 769          
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Match: sp|A0JMT0|CA1AB_XENLA (Chromatin assembly factor 1 subunit A-B OS=Xenopus laevis OX=8355 GN=chaf1a-b PE=2 SV=2)

HSP 1 Score: 63.929 bits (154), Expect = 3.341e-9
Identity = 69/238 (28.99%), Postives = 110/238 (46.22%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERI--EKKLINSLKDLLVNSET----YLEELSANK-----------TGSGKCEKTWPMSEPEIQLATSTRL----------------KSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDN----XXXXXXXXXXXXXSFMVPHGYLSDGEDSID---LDPDEEQI 1070
            A +  F  K K  Q    +     ++ G F P EIKK M ++P+ RI  E++    L D+ +  +T    +L+E+   +             S + +    + E +  L ++  L                + K L F EN RP Y+GT  K S++I P  P A+D    DYE+DSD+EWE E   +  S       ++D + +E+ +D  F VPHGYLS+ E   D    DP+ +++
Sbjct:  368 AEITRFLQKPKTPQAPKTFA----RSCGKFAPFEIKKGMALAPLCRIDFEQEASEEL-DIFLQEQTSESSFLDEIKKRRPRKMGQTTVPTINSVEVDDVQVLGETDPVLGSNMVLEEHIKDIGVPERKKFGRMKLLQFCENHRPAYWGTSNKRSRVINPRKPWAQDTDMLDYEVDSDEEWEEEEPGESLSHSEGENEDDDPKEEEDEDDDGFFVPHGYLSNDEGVSDEECTDPENQKV 600          
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Match: sp|Q98TA5|CA1AA_XENLA (Chromatin assembly factor 1 subunit A-A OS=Xenopus laevis OX=8355 GN=chaf1a-a PE=1 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 8.343e-9
Identity = 72/234 (30.77%), Postives = 103/234 (44.02%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERI--EKKLINSLKDLLV--NSETYLEELSANKTGSGKCEKTWP-----------------------MSEPEIQ-LATSTRLK---SKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDN--XXXXXXXXXXXXXSFMVPHGYLSDGEDSID---LDPDEEQI 1070
            A +  FF K K  Q    +     ++ G F P EIKK M ++P+ RI  E +    L   L   NS+ Y  +    +      + T P                       M E  I+ +    R K    K L F EN RP Y+GT  + S++I    P A+D G  DYE+DSD+EWE E   +  S      +D+  +++ +D  F VPHGYLSD E   D    DP+ ++ 
Sbjct:  384 AEITRFFQKPKTPQAPKTFS----RSCGKFAPFEIKKGMALAPLCRIDFEPEASEELDRFLQEQNSKIYFFDEIKKRKPRKMGQTTVPTVNSFEVDDVQVLGESDPVLGSNMLEGHIKDIGVPERKKFGRMKLLQFCENHRPAYWGTCNRRSRVINSRKPWAQDTGMLDYEVDSDEEWEEEEPGESLSHSEGENDDDPKEDDEDDDGFFVPHGYLSDDEGVSDEECTDPENQKF 613          
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Match: T1JHB3 (Uncharacterized protein OS=Strigamia maritima OX=126957 PE=4 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 3.170e-37
Identity = 138/459 (30.07%), Postives = 217/459 (47.28%), Query Frame = 3
Query:  477 AILLGFFNKEKND----QESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIE----KKLINSLKDLLVN-SET--YLEELSANKTGSGKCEKTWPMSEP---EIQLATSTR------LKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSD-QEWEYESGEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPV----ICNLLSDYDNPTNHT-------KIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDWDE---------FSIGKKRF---------FEKLKEIADRKDGMWVVKPEVIQEYQLCCINDDPEKPCAEKWKYVSDVVNID 1703
            A    FF K+ ++    ++  D +SC       F+  E+K++ +++P  R++    +KL+  L + + N +ET  YL EL   K    K ++TWP+S+    E+Q+            ++K L F EN+RPPY+GTWRK SQII    P  +D  +FDYE+DSD +  E E GE ++ +++E ++   E   D  F+VPHGYLSDGE       DEE    L+   ++          + +++K F AERK+   QI P + GP +  +  P           + M+    +  P+    IC   SD +   +         ++K VP EA+P  IRL+H N   R+ +  EF  FW+ +          + D   +D DE         F I K +          FEK  E   +K  MWVVK E +++Y L  +      P    W+Y++ +  ID
Sbjct:  277 ASFASFFVKKDSNISTPRKDRDELSC------LFRAFEVKENQRLAPTNRLKLEERQKLVKDLNECIRNQAETNLYLTELRCKKRIPCKTDRTWPLSDEADDELQVVDGEESCKKKNARAKLLKFHENVRPPYWGTWRKKSQIILSRNPFRKDIKYFDYEVDSDEEWEEEEPGESLSGTEDEMEKSDGEYDVDNEFVVPHGYLSDGEQ------DEEDTECLSIDGQK--------TKLRLQEKAFLAERKEKCLQIKPKLFGPIWCDDQTPGDEEILKLFKKFEMVLLCAD-LPIKINKICPAPSDVNKTEDQNTCKSTSRRLKYVPEEAMPHFIRLLHGNTHKRIFIVKEFSTFWDAH----------QEDFNKEDNDEIVPTTPVKKFWIPKVKLNKCLHQIASFEKSAEAGGKK--MWVVKSEFLEKYSLTDL------PLTNDWQYLTKIDKID 696          
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Match: G7YF74 (Chromatin assembly factor 1 subunit A-A (Fragment) OS=Clonorchis sinensis OX=79923 GN=CLF_106458 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 3.078e-34
Identity = 141/531 (26.55%), Postives = 230/531 (43.31%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKD-----------------------LLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQL----------------------ATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYES-GEDIASS--DNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGN------------------AYRMICRTG---EGFPVICNLLSDY-----DN-----------PTNHTK--IKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQ-------------------GKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEY-----------QLCCINDDPEKPCAEK-----WKYVSDVVNID 1703
            A+LLGF  K +  +E+S  +S      G F   E++KDM+++P+ R+ K L+ + +D                       L     +Y+ EL   +     C  TWP   PE+ L                        +  L++K   FVEN RP YYG+WR+ S+I+T   P A+D    DY +DSD EWE +  GE I  S  + EE+E+ +EE ED +F VPHGYLSD E     D  EE        N R      R++ +     +++   ++ + ++ P+V GP ++    PN   S++ GN                    R+   T        ++ + LS Y     D+           PT  T+   + +P EAVP +I+LVH + + ++KL +EFR+FW  + +  +P+ T   D +                   G  WD+  + +     KL E+A  ++G W V P ++++Y           +L  +  +P+           W++++DVV I 
Sbjct:  120 AVLLGFLVKGEQKKETSTPLSA---PCGPFMQFELRKDMRMAPLHRVPKSLLTTKRDNLDKVVQSWSHESSSVPGSSLGLLKFGRSSYIHELKTKQHVPLSCPSTWPTEPPEVMLMGEGLCSTLNSPTLKYHGSRGSGGTVWLRAKLFQFVENYRPAYYGSWRRRSRIVTGRRPFAQDVRQLDYSVDSDDEWEEDEPGESITQSENEEEEEEKDEEEEEDDTFFVPHGYLSDDEGVAAEDVGEEDAAAEEMKNLR------RRLSV----VEYETAHRRGLQRLIPLVLGPVWL----PNPVESSSAGNVLSSNDQLDEDKENIETVGVRVADSTSVDKSSMQLVRSALSIYRIHLWDSAVPIAIQMNMLPTQSTRRTRRELPEEAVPYLIQLVHKSPLGKLKLAFEFRVFWHKHTTGTVPECTQYMDYKRHTSAAAQTCSQRTKTVFGGPAWDDLPLSQTLVLSKLTELAVFEEGRWAVHPNMLRKYRPKLVTLFGLNELSTLGMEPDDAALSAVTFPPWEFLTDVVAIS 633          
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Match: A0A419Q8W1 (Chromatin assembly factor 1 subunit FSM OS=Clonorchis sinensis OX=79923 GN=FSM PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 2.195e-33
Identity = 140/531 (26.37%), Postives = 228/531 (42.94%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKD-----------------------LLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQL----------------------ATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYES-GEDIASS--DNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYR--------------MICRTGEGFPV-------ICNLLSDYD----------------NPTNHTK--IKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQ-------------------GKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEY-----------QLCCINDDPEKPCAEK-----WKYVSDVVNID 1703
            A+LLGF  K +  +E+S  +S      G F   E++KDM+++P+ R+ K L+ + +D                       L     +Y+ EL   +     C  TWP   PE+ L                        +  L++K   FVEN RP YYG+WR+ S+I+T   P A+D    DY +DSD EWE +  GE I  S  + EE+E+ +EE ED +F VPHGYLSD E     D  EE        N R      R++ +     +++   ++ + ++ P+V GP ++    PN   S++ GN                 +  R  +   V       + + LS Y                  PT  T+   + +P EAVP +I+LVH + + ++KL +EFR+FW  + +  +P+ T   D +                   G  WD+  + +     KL E+A  ++G W V P ++++Y           +L  +  +P+           W++++DVV I 
Sbjct:  328 AVLLGFLVKGEQKKETSTPLSA---PCGPFMQFELRKDMRMAPLHRVPKSLLTTKRDNLDKVVQSWSHESSSVPGSSLGLLKFGRSSYIHELKTKQHVPLSCPSTWPTEPPEVMLMGEGLCSTLNSPTLKYHGSRGSGGTVWLRAKLFQFVENYRPAYYGSWRRRSRIVTGRRPFAQDVRQLDYSVDSDDEWEEDEPGESITQSENEEEEEEKDEEEEEDDTFFVPHGYLSDDEGVAAEDVGEEDAAAEEMKNLR------RRLSV----VEYETAHRRGLQRLIPLVLGPVWL----PNPVESSSAGNVLSSNDQLDEDKENIETVGVRVADSTSVDKSSMQLVRSALSIYRIHLWDSAVPIAIQMNMLPTQSTRRTRRELPEEAVPYLIQLVHKSPLGKLKLAFEFRVFWHKHTTGTVPECTQYMDYKRHTSAAAQTCSQRTKTVFGGPAWDDLPLSQTLVLSKLTELAVFEEGRWAVHPNMLRKYRPKLVTLFGLNELSTLGMEPDDAALSAVTFPPWEFLTDVVAIS 841          
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Match: A0A4S2MCH4 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001028 PE=4 SV=1)

HSP 1 Score: 146.747 bits (369), Expect = 5.621e-33
Identity = 131/529 (24.76%), Postives = 220/529 (41.59%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKD-----------------------LLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQL----------------------ATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYES-----GEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCF--------------------------VSNIDPNSPNSTAGGNAYRMICRTG----------EGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFEND-------------------LQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEY-----------QLCCINDDPEKPCAEK-----WKYVSDVVNI 1700
            A+LLGF  K +  +E+S  +S      G F   E++KDM+++P+ R+ K L+ + +D                       L     +Y+ EL   +     C  TWP   PE+ L                        +  L++K   FVEN RP YYG+WR+ S+I+T   P A+D    DY +DSD EWE E       +     ++EE +E +EE ED +F VPHGYLSD E     D  EE        N R      R++ +     +++   ++ + ++ P++ GP +                          + NI     +ST+   +   + R+              P+    ++     +     + +P EAVP +I+LVH + + ++KL +EFR+FW  + +  +P+ T   D                   L G  WD+  + +     KL E+A  ++G W V P V+++Y           +L  +  +P+           W++++DVV I
Sbjct:  134 AVLLGFLVKGEQKKETSTPLSA---PCGPFMQFELRKDMRMAPLHRVPKSLLTTKRDNLDKVVQSWSHESSSVPGSSLGLLKFGRSSYIHELKTKQHVPLSCPSTWPTEPPEVMLIGEGLCSTLNSPTLKYHGSRGSGGTVWLRAKLFQFVENYRPAYYGSWRRRSRIVTGRRPFAQDVRQLDYSVDSDDEWEEEEPGESITQSENEEEDEEKDEEEEEEEDDTFFVPHGYLSDDEGVAAEDVGEEDAAAEEMKNLR------RRLSV----VEYETAHRRGLQRLIPLILGPVWLPNPVESISAVNVLSSNDQLDEDKENIENIGVRVADSTSVDKSSLQLVRSALSIYRIHLWDSAVPIAIQ-VNMPTTQSTRRTRRELPEEAVPYLIQLVHRSPLGKLKLAFEFRVFWHKHTTGTVPECTQYMDYKRHTSAAAQACSQRTKAVLGGPAWDDLPLSQTLVLSKLTELAVFEEGRWAVHPNVLRKYRPKLTTLFGLNELSTLGMEPDDAALSAITFPPWEFLTDVVAI 648          
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Match: A0A5J4NI52 (Chromatin assembly factor 1 subunit A OS=Paragonimus westermani OX=34504 GN=DEA37_0000024 PE=4 SV=1)

HSP 1 Score: 142.51 bits (358), Expect = 1.053e-31
Identity = 125/491 (25.46%), Postives = 207/491 (42.16%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINS----LKDLLVN-------------------SETYLEELSANKTGSGKCEKTWPMSEPEIQL----------------------ATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYES-----GEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGED-SIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVS---NIDPNSPNST----------------AGGNAYRMICRTGEGFPVICNLLSDY---------------DNPTNHTKIKS----VPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFEND-------------------LQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQ 1625
            A+LLGF  K +  +E +          G F    ++KDMK++P+ R+   L+ S    L +LL++                     +YL EL   +     C  TWP+  P+ QL                        +  L++K L FVEN RP YYGTWR+ S+I+    P A+D    DY +DSD EWE E       +     + ++ +  +EE ED  F VPHGYLSD E  +++    EE++             E +++   +   +++   ++ + ++ P+V GP ++    ++  NS +++                AG   +        G  +I   LS Y               D P   +  +     +P +AVP +I LVH + + ++KL +EFR+FW  + +  +P+     +                   L G  WD  ++ +     KL EIA  +DG W + PEVI+ +Q
Sbjct:   95 AVLLGFLVKSEQRREVTPSAPA---PGGPFMQFVLRKDMKMAPLHRVPPALLKSKQSNLDELLLSWSGSANEHTASSLGLTKFGRTSYLHELKTKQHVPLSCPSTWPIEPPDAQLLGDGLCSIANSPTLKYHGSRGSGGTVWLRAKWLQFVENYRPAYYGTWRRRSRIVNGRRPFAQDHTKLDYTVDSDDEWEEEEPGESITQSENDEEEDDKDAEEEEDEDDHFFVPHGYLSDDEGVAVEEACGEEEVG----------AEEMKKLRRCLSVAEYEVAHRRGMQRLKPLVFGPVWLQDPCDLGINSADTSCVNDLDEDDDKENVENAGVYGFTSASTEKMGLKIIRAALSVYRAYLWEELVPIAVRLDAPATPSSTRRPRRELPEDAVPYLIHLVHKSPLGKLKLAFEFRVFWHKHTTGSMPECVQYAEFKRYNATGCNAHLQRGGPVLTGPAWDSLALSQNLVLSKLSEIAVFEDGRWAIHPEVIRRFQ 572          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Sea Lamprey
Match: chaf1a (chromatin assembly factor 1, subunit A (p150) [Source:NCBI gene;Acc:563212])

HSP 1 Score: 82.0333 bits (201), Expect = 1.646e-16
Identity = 116/432 (26.85%), Postives = 186/432 (43.06%), Query Frame = 3
Query:  492 FFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKDLLVNSET----YLEELSANKTGSGKCEKTWP-----------------MSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDS-DQEWEYESGEDIASSDNXX-XXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQF-QAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFW-EYNLSKKLPDVTFENDLQGKD---WDEFSIGKKRFFEKLKEIA------DRKDGMWVVKPEVIQEYQLCCINDDPEKPCAEKWKYVS 1685
            FF K K  Q             G F P EIK +M+++P+ R+E  ++ S  D  + S+     YL EL   K  + K  KT+P                 M E +  +      + K L F EN RP Y+GTW K S+ I P  PLA+D    DYE+DS D+  E E GE I+ S+ E+ DEE  ++ +D  F VPHG+LSDGE   D               +  L+ ET+++   +K K++    R     ++ P+V G C       +S          +++   G+ F +      + +N     +++ +  + +  ++ LVH N      +  EF+ +W +    ++ P      D + +    WD     K R    +KE A      + K   W V  +V+ +Y L  +      P   +W YV+
Sbjct:  347 FFTKGKTPQAPKTLTG----TCGPFAPFEIKNNMRVAPVRRVE--VLISAVDEAIESQAAQNLYLHELKRRKPKTSK--KTYPYANSICTAQLESIIVSNMLECKKDIERKRFGRMKLLQFNENNRPAYWGTWSKCSKHINPRNPLAKDKELLDYEVDSDDEWEEEEPGESISHSEGEQDDEEEDDDDDDDGFFVPHGHLSDGEGVSD--------------GEGKLSAETKKLRERLKAKEWDDLTRTHRCQRLEPVVIG-CVWEGEGADS------AALQKLLPYKGQRFNLGAEEEEEKENAQETKQLRDI--QILRDLLPLVHGNINCSKFMIDEFQAWWLQREAQEESPPKETPLDTKKRHRNRWDTALPSKMRLKRLIKESAVYRKRNELKRVCWYVHADVLLKYGLQDL------PVPSRWNYVT 741          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Nematostella
Match: EDO37231 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGE4])

HSP 1 Score: 57.7658 bits (138), Expect = 4.630e-10
Identity = 42/89 (47.19%), Postives = 56/89 (62.92%), Query Frame = 3
Query:  768 LKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD---NXXXXXXXXXXXXXSFMVPHGYLS 1025
            +K+  L F EN RP YYGT RK S+ I+P  P  +D    DYE+DSD+EWE E   +  S+    +E++E+  E+ ED  F VPHGYLS
Sbjct:   40 MKAILLQFAENYRPAYYGTHRKKSKKISPKNPFKKDEVLLDYEVDSDEEWEEEEPGESLSNSEGEDEDNEDNDEDDEDEGFFVPHGYLS 128          
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Medaka
Match: chaf1a (chromatin assembly factor 1 subunit A [Source:NCBI gene;Acc:101159182])

HSP 1 Score: 69.707 bits (169), Expect = 6.026e-12
Identity = 64/211 (30.33%), Postives = 96/211 (45.50%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKK----------------LINSLKDLLVNSETYLEELSANKTGSGKC---EKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSD--NXXXXXXXXXXXXXSFMVPHGYLSDGEDSID 1046
            A +  F  K K  Q      +      G F P EIK++M ++P+ R++ K                  N+LKD +             +T S  C   E   P   P+ +     +L    L F EN RP Y+GTW K +  I+P  P  +D    DYE+DSD+EWE E   +  S     +E+E  +++ +D  F VPHGYLS+ E +++
Sbjct:  282 AEITRFLQKSKTQQVPKTLAAA----CGKFAPFEIKENMALAPLTRVQCKDSVLEELDHCLLNPVEKANALKDWIGRKPRQSGATKPRRTDSLDCIVAEGAKPDGVPDRKRYGPMKL----LQFHENYRPAYWGTWSKKTSSISPRCPFKQDKDLLDYEVDSDEEWEEEEPGESLSHSEGEDEEEGGEDDDDDDGFFVPHGYLSEDEGALE 484          
BLAST of Chromatin assembly factor 1 subunit A vs. Planmine SMEST
Match: SMESG000061926.1 (SMESG000061926.1)

HSP 1 Score: 872.078 bits (2252), Expect = 0.000e+0
Identity = 447/447 (100.00%), Postives = 447/447 (100.00%), Query Frame = 3
Query:  477 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDNXXXXXXXXXXXXXSFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQLCCINDDPEKPCAEKWKYVSDVVNIDTXXXXXXXXXXXAENKHVNEKLLKCESDDTKPLLEKSK 1817
            AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDNEEDEEIKEEPEDISFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQLCCINDDPEKPCAEKWKYVSDVVNIDTKKLPKNPKKRKAENKHVNEKLLKCESDDTKPLLEKSK
Sbjct:  144 AILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERIEKKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTRLKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEWEYESGEDIASSDNEEDEEIKEEPEDISFMVPHGYLSDGEDSIDLDPDEEQIPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVSNIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPPEAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDWDEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQLCCINDDPEKPCAEKWKYVSDVVNIDTKKLPKNPKKRKAENKHVNEKLLKCESDDTKPLLEKSK 590          

HSP 2 Score: 81.6481 bits (200), Expect = 5.666e-16
Identity = 41/44 (93.18%), Postives = 42/44 (95.45%), Query Frame = 3
Query:   48 LFN*DIGDHLSCSNQEKEKNINNKRELKKQQLQERNQQKLMEKI 179
            + N DIGDHLSCSNQEKEKNINNKRELKKQQLQERNQQKLMEKI
Sbjct:    1 MANEDIGDHLSCSNQEKEKNINNKRELKKQQLQERNQQKLMEKI 44          
The following BLAST results are available for this feature:
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CHAF1A1.248e-723.46chromatin assembly factor 1 subunit A [Source:HGNC... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chaf-12.990e-1133.71CHromatin Assembly Factor [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Caf1-1804.923e-1531.33gene:FBgn0030054 transcript:FBtr0071228[more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chaf1a5.619e-1230.57chromatin assembly factor 1, subunit A (p150) [Sou... [more]
chaf1a6.389e-1230.57chromatin assembly factor 1, subunit A (p150) [Sou... [more]
chaf1a7.437e-1230.57chromatin assembly factor 1, subunit A (p150) [Sou... [more]
chaf1a8.459e-1230.57chromatin assembly factor 1, subunit A (p150) [Sou... [more]
chaf1a8.671e-1230.57chromatin assembly factor 1, subunit A (p150) [Sou... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CHAF1A7.411e-1431.22chromatin assembly factor 1 subunit A [Source:NCBI... [more]
CHAF1A9.157e-1431.22chromatin assembly factor 1 subunit A [Source:NCBI... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Chaf1a3.782e-730.09chromatin assembly factor 1, subunit A (p150) [Sou... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A0JMK9|CAF1A_DANRE5.614e-1130.57Chromatin assembly factor 1 subunit A OS=Danio rer... [more]
sp|Q5R1T0|CAF1A_CHICK1.053e-1031.72Chromatin assembly factor 1 subunit A OS=Gallus ga... [more]
sp|Q9SXY0|FAS1_ARATH1.987e-1025.00Chromatin assembly factor 1 subunit FAS1 OS=Arabid... [more]
sp|A0JMT0|CA1AB_XENLA3.341e-928.99Chromatin assembly factor 1 subunit A-B OS=Xenopus... [more]
sp|Q98TA5|CA1AA_XENLA8.343e-930.77Chromatin assembly factor 1 subunit A-A OS=Xenopus... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1JHB33.170e-3730.07Uncharacterized protein OS=Strigamia maritima OX=1... [more]
G7YF743.078e-3426.55Chromatin assembly factor 1 subunit A-A (Fragment)... [more]
A0A419Q8W12.195e-3326.37Chromatin assembly factor 1 subunit FSM OS=Clonorc... [more]
A0A4S2MCH45.621e-3324.76Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NI521.053e-3125.46Chromatin assembly factor 1 subunit A OS=Paragonim... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chaf1a1.646e-1626.85chromatin assembly factor 1, subunit A (p150) [Sou... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO372314.630e-1047.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
chaf1a6.026e-1230.33chromatin assembly factor 1 subunit A [Source:NCBI... [more]
back to top
BLAST of Chromatin assembly factor 1 subunit A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000061926.15.666e-16100.00SMESG000061926.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016021 ID=SMED30016021|Name=Chromatin assembly factor 1 subunit A|organism=Schmidtea mediterranea sexual|type=transcript|length=1901bp
ATAAAATGGCCAATGAAGTAAGAAGGTTTTATATAAATAAAATATATCTT
TTTAATTAGGATATTGGAGATCACCTATCATGTTCAAATCAAGAAAAAGA
AAAAAATATTAACAATAAGAGGGAACTAAAAAAGCAACAATTACAAGAAA
GAAATCAACAAAAACTAATGGAAAAGATCAAAAAAGATACTGAAAGGAAG
CAAAAAGAAGAAGAAAAAAAACGAAAAGAAATCGAAAGAAAAAAGAAAGA
ATTTGAGAAGGAAGAAGATCGTAAAAGGCGGGAGGCTGAAAAAAAACAAA
AGGATGAAGAAAAGAGAAAGAAGGAAGAAGAAAAAAAAATTAAAGAGGAA
GAACGACGACTCAAGGAAATTGAAAAGGAAGAAGAAAAACGTAAAAAAGA
AGAAGAAAGAAAAAGAAAAGACGAAGAGAAACGAAAAGAAGAAGAAGAGA
AGGATAAACAACTTCAAAAGCAACGTGCAATCTTATTGGGATTTTTTAAC
AAGGAGAAAAATGATCAGGAGTCATCAGATTATGTTTCATGTGGTTTAAA
AAATATCGGAAGTTTTAAGCCAATTGAAATAAAGAAGGATATGAAAATAT
CGCCTATAGAACGAATTGAGAAAAAACTTATTAATTCACTCAAAGATTTG
TTAGTCAACTCTGAAACATATCTCGAGGAGTTATCAGCAAATAAGACTGG
GAGTGGAAAATGTGAAAAAACTTGGCCAATGTCAGAACCTGAAATTCAAT
TGGCAACGTCAACAAGGTTAAAATCGAAAACTTTATCATTCGTGGAAAAT
ATTCGACCACCATATTACGGTACTTGGAGGAAACACAGCCAAATCATTAC
TCCTCTGACACCACTGGCTGAGGATCCGGGATTTTTCGATTATGAGCTGG
ACTCTGACCAGGAATGGGAATACGAATCTGGCGAGGACATTGCATCATCT
GATAATGAGGAGGATGAGGAAATCAAAGAGGAACCAGAAGACATCTCATT
CATGGTACCACACGGCTACCTTTCGGATGGCGAGGATTCAATTGATCTTG
ATCCCGACGAGGAGCAGATCCCTACATTAAATGCCACAAATAAACGGCCG
CTGACGAATGAGACCCGACAGATAATGATCGAAATCAAAGACAAACAGTT
CCAAGCCGAACGCAAGCAATATGTGCATCAAATCAACCCGATAGTAACCG
GACCTTGTTTTGTCAGTAATATCGACCCGAATTCCCCCAACAGCACAGCC
GGAGGTAACGCATATCGCATGATATGCCGCACTGGTGAGGGCTTCCCGGT
CATTTGTAATTTGCTGTCAGACTACGACAACCCGACAAACCATACGAAAA
TCAAATCGGTTCCCCCTGAGGCAGTGCCCCAAATCATCAGATTGGTTCAT
TGCAACCAGATGAGCCGTGTCAAGCTTTGCTATGAATTCCGCATGTTCTG
GGAATACAATCTATCGAAAAAACTTCCCGATGTGACGTTTGAAAACGATT
TGCAAGGCAAAGATTGGGACGAGTTTTCAATTGGGAAGAAAAGATTTTTC
GAAAAATTGAAAGAGATTGCAGACCGGAAAGACGGAATGTGGGTTGTGAA
ACCGGAAGTTATCCAAGAATATCAATTGTGTTGCATTAATGACGATCCAG
AAAAGCCCTGTGCAGAGAAATGGAAATACGTTTCCGATGTTGTAAATATC
GATACAAAGAAACTACCAAAAAATCCCAAAAAACGGAAAGCTGAAAATAA
GCACGTGAATGAAAAATTGTTAAAATGTGAAAGTGATGATACGAAACCTT
TATTAGAGAAAAGTAAATAAAATGCGAGAAGTTGATATGTATATATAAAT
TGTTATACTAGTTATTTCATTTATAAAATGGATAATACTATTTGAATTTT
T
back to top

protein sequence of SMED30016021-orf-1

>SMED30016021-orf-1 ID=SMED30016021-orf-1|Name=SMED30016021-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=551bp
MEKIKKDTERKQKEEEKKRKEIERKKKEFEKEEDRKRREAEKKQKDEEKR
KKEEEKKIKEEERRLKEIEKEEEKRKKEEERKRKDEEKRKEEEEKDKQLQ
KQRAILLGFFNKEKNDQESSDYVSCGLKNIGSFKPIEIKKDMKISPIERI
EKKLINSLKDLLVNSETYLEELSANKTGSGKCEKTWPMSEPEIQLATSTR
LKSKTLSFVENIRPPYYGTWRKHSQIITPLTPLAEDPGFFDYELDSDQEW
EYESGEDIASSDNEEDEEIKEEPEDISFMVPHGYLSDGEDSIDLDPDEEQ
IPTLNATNKRPLTNETRQIMIEIKDKQFQAERKQYVHQINPIVTGPCFVS
NIDPNSPNSTAGGNAYRMICRTGEGFPVICNLLSDYDNPTNHTKIKSVPP
EAVPQIIRLVHCNQMSRVKLCYEFRMFWEYNLSKKLPDVTFENDLQGKDW
DEFSIGKKRFFEKLKEIADRKDGMWVVKPEVIQEYQLCCINDDPEKPCAE
KWKYVSDVVNIDTKKLPKNPKKRKAENKHVNEKLLKCESDDTKPLLEKSK
*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000101muscle cell
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR022043CAF1A
Vocabulary: biological process
TermDefinition
GO:0006260DNA replication
GO:0006281DNA repair
GO:0006334nucleosome assembly
GO:0006974cellular response to DNA damage stimulus
GO:0007049cell cycle
GO:0031497chromatin assembly
Vocabulary: cellular component
TermDefinition
GO:0033186CAF-1 complex
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 1..103
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 252..272
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..98
NoneNo IPR availablePANTHERPTHR15272CHROMATIN ASSEMBLY FACTOR 1 SUBUNIT A CAF-1 SUBUNIT Acoord: 6..488
NoneNo IPR availablePANTHERPTHR15272:SF0CHROMATIN ASSEMBLY FACTOR 1 SUBUNIT Acoord: 6..488
IPR022043Chromatin assembly factor 1 subunit APFAMPF12253CAF1Acoord: 204..274
e-value: 3.7E-22
score: 78.3