Neuroglian

Overview
NameNeuroglian
Smed IDSMED30016017
Length (bp)4285
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuroglian (SMED30016017) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuroglian (SMED30016017) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuroglian (SMED30016017) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuroglian (SMED30016017) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016017

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016017SMESG000077377.1 SMESG000076900.1 SMESG000063429.1 SMESG000060686.1 SMESG000043019.1 SMESG000031308.1 SMESG000028811.1 SMESG000023833.1 SMESG000023573.1 SMESG000019820.1 SMESG000011532.1 SMESG000052813.1 Contig116GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016017SMESG000080152.1 SMESG000067264.1 SMESG000047874.1 SMESG000005684.1 Contig20766newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016017SMESG000080152.1 SMESG000067264.1 SMESG000047874.1 SMESG000005684.1 Contig20766uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30016017SMESG000005684.1 Contig116GPL15192PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
dorsal-ventral muscle cellSMED30016017SMESG000005684.1 dd_Smed_v4_4031_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuroglian vs. Ensembl Human
Match: CHL1 (cell adhesion molecule L1 like [Source:HGNC Symbol;Acc:HGNC:1939])

HSP 1 Score: 321.242 bits (822), Expect = 3.205e-90
Identity = 273/1087 (25.11%), Postives = 471/1087 (43.33%), Query Frame = 3
Query:   57 MQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPP------KGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI----ENLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            M+P LL        M  LL FS+A   PS +QQ P      K +  +  D    + C AK  P   + W K+G+        +I + + G+ RI  E  I   +G Y+C A N LG A+S + E  +  +  +   K   ++V      +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + ++D    Y C +    LRT+ +    K+ +   S S    KP + L  +   +   +        +   F+ G     V W    +K     PK R      G TL+I N+  +D G Y C       T    F + V E P +  +P     +  S+ I  C+A GEP+P I+W  NG  +  +   GD +     ++   NL      V QC ASN++G +  NA I+V + +PL+     +    V+  +  ++C  F+ P   + W+K    +  +   +Y + +NG L I      DAG Y C   N  G+T   + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y C+A   +D      ++ V   P+P  ++ +  ++   +R   LTW  G  +N+ I+ +I EF   + +P  W  +  V     T+I P           + P+++Y FR+ +VN++G SQPS  + ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y +T       + P  +  +     W+   +    +    ++    +Y  Y+V +Q+ N +G S   P     +SGE YP   P    +D I    VK+ WS + ++   R++G  +GY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P       +  ++ +   ++W  P   NG LTGY +   ++ + ++     +      I  P +    +S+L + TKY   + A T QG GK
Sbjct:    1 MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVN-SSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDW----NKIGGDLPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPR--EISFTNLQPNHTAVYQCEASNVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVE-EVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQ---NRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILP-----------LAPFVRYQFRVIAVNEVGRSQPSQPS-DHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVT-------WKPQGAPVE-----WEEETVTNHTL----RVMTPAVYAPYDVKVQAINQLG-SGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKD---RVHGRLKGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDAFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDI----NITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGK 1003          
BLAST of Neuroglian vs. Ensembl Human
Match: CHL1 (cell adhesion molecule L1 like [Source:HGNC Symbol;Acc:HGNC:1939])

HSP 1 Score: 317.775 bits (813), Expect = 3.790e-89
Identity = 278/1115 (24.93%), Postives = 477/1115 (42.78%), Query Frame = 3
Query:   57 MQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPP------KGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI----ENLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKP-----DSISSHLL----------KPLITLYXXXXXXXXXXXXXXXXXCI---FSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESK 3272
            M+P LL        M  LL FS+A   PS +QQ P      K +  +  D    + C AK  P   + W K+G+        +I + + G+ RI  E  I   +G Y+C A N LG A+S + E  +  +  +   K   ++V      +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + ++D    Y C +    LRT+ +    K+ +       DS SS  +          KP + L  +   +   +        +   F+ G     V W    +K     PK R      G TL+I N+  +D G Y C       T    F + V E P +  +P     +  S+ I  C+A GEP+P I+W  NG  +  +   GD +     ++   NL      V QC ASN++G +  NA I+V + +PL+     +    V+  +  ++C  F+ P   + W+K    +  +   +Y + +NG L I      DAG Y C   N  G+T   + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y C+A   +D      ++ V   P+P  ++ +  ++   +R   LTW  G  +N+ I+ +I EF   + +P  W  +  V     T+I P           + P+++Y FR+ +VN++G SQPS  + ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y +T       + P  +  +     W+   +    +    ++    +Y  Y+V +Q+ N +G S   P     +SGE YP   P    +D I    VK+ WS + ++   R++G  +GY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P       +  ++ +   ++W  P   NG LTGY +   ++ + ++     +      I  P +    +S+L + TKY   + A T QG GK       T  E K
Sbjct:    1 MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIGSKANSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDW----NKIGGDLPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPR--EISFTNLQPNHTAVYQCEASNVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVE-EVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQ---NRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILP-----------LAPFVRYQFRVIAVNEVGRSQPSQPS-DHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVT-------WKPQGAPVE-----WEEETVTNHTL----RVMTPAVYAPYDVKVQAINQLG-SGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKD---RVHGRLKGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDAFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDI----NITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGKPITEESSTLGEGK 1032          
BLAST of Neuroglian vs. Ensembl Human
Match: CHL1 (cell adhesion molecule L1 like [Source:HGNC Symbol;Acc:HGNC:1939])

HSP 1 Score: 316.62 bits (810), Expect = 1.354e-88
Identity = 283/1103 (25.66%), Postives = 478/1103 (43.34%), Query Frame = 3
Query:   57 MQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPP------KGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI----ENLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRT-------------MKRGAD----TKIKIKPDSISSHLLKPLI--TLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            M+P LL        M  LL FS+A   PS +QQ P      K +  +  D    + C AK  P   + W K+G+        +I + + G+ RI  E  I   +G Y+C A N LG A+S + E  +  +  +   K   ++V      +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + ++D    Y C +    LRT             +K   D    T+I  K +SI     K L+  T   S    T+L    +LL C F+ G     V W    +K     PK R      G TL+I N+  +D G Y C       T    F + V E P +  +P     +  S+ I  C+A GEP+P I+W  NG  +  +   GD +     ++   NL      V QC ASN++G +  NA I+V + +PL+     +    V+  +  ++C  F+ P   + W+K    +  +   +Y + +NG L I      DAG Y C   N  G+T   + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y C+A   +D      ++ V   P+P  ++ +  ++   +R   LTW  G  +N+ I+ +I EF   + +P  W  +  V     T+I P           + P+++Y FR+ +VN++G SQPS  + ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y +T       + P  +  +     W+   +    +    ++    +Y  Y+V +Q+ N +G S   P     +SGE YP   P    +D I    VK+ WS + ++   R++G  +GY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P       +  ++ +   ++W  P   NG LTGY +   ++ + ++     +      I  P +    +S+L + TKY   + A T QG GK
Sbjct:    1 MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVNSLKHANDSSSSTEIGSKANSIKQRKPKLLLPPTESGSESSITILKGEILLLEC-FAEGLPTPQVDW----NKIGGDLPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPR--EISFTNLQPNHTAVYQCEASNVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVE-EVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQ---NRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILP-----------LAPFVRYQFRVIAVNEVGRSQPSQPS-DHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVT-------WKPQGAPVE-----WEEETVTNHTL----RVMTPAVYAPYDVKVQAINQLG-SGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKD---RVHGRLKGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDAFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDI----NITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGK 1019          
BLAST of Neuroglian vs. Ensembl Human
Match: NFASC (neurofascin [Source:HGNC Symbol;Acc:HGNC:29866])

HSP 1 Score: 294.664 bits (753), Expect = 1.558e-81
Identity = 255/1048 (24.33%), Postives = 462/1048 (44.08%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKP-KERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFIT-QYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            PP+  +Q  K   +   D  I++ C AK  P+ ++ W +N           + + +  G+L I+        E EG YQC A N  G A+S++  L+++    +       + V       L+C+ P   P   I W++      +    +D R    +NG+L+ + ++ +D    YSC +  +F  T+++     +K+      +      +    +     VL    +LL CI S      + W++   K  ++   K +F+   K   L I+N+  +D+G+Y C    +  ++    ++ V   P ++++P +  +A        C+A+G P+P ++W  NG+ +          + G+ +   +       V QCN SN +GY+  NAF++V +  P +L P  + I+ +L    +++C  F  P P + W K+    NL   N Y + +NG+L IK +   D G+Y C+A+NI G+ +N+  + +++PT+I  +  ++  + G  V LEC  + D      L + W K +E L +   +        L +  +  RD G Y C AS  +D DL K  L V G+P+   D+++ D       R   LTW+ G  NN+ IT ++ +F   Q+ P  W      +  +   +       N+  + + PY+ Y FR+ ++N++G+S P S+     +     P  NP DV   GT  N + I W  +   +  GPNL Y +  R  +      T +    +T W +  +V           +  +Y  YE+ +Q++N  G     P    G+SGE YP   P+ +++  +   ++ LQW+ +Y +    + G  R YR  +   E+S     + KN    + +    ++ S+    P  R    V R    S Y ++ M  + G                +  GP+SE     T EG P     F +    +  I + W  P   NGI+ GY +   +   F+ +   ++  +   P+Q +  +      ++Y  ++ A T+ G G+
Sbjct:   34 PPTITKQSAKDHIVDPRDN-ILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSS----MEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYK---KGGDLPSDKAKFENFNKA--LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGN-YHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHD--PSLKLTVSWLKDDEPLYI--GNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLA----ERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWH----DHSKYPGSV-------NSAVLRLSPYVNYQFRVIAINEVGSSHP-SLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRE------TREAWNNVTVWGSRYVV----------GQTPVYVPYEIRVQAENDFGKGPE-PESVIGYSGEDYPRAAPTEVKVRVMNSTAISLQWNRVYSDT---VQGQLREYRA-YYWRESS-----LLKN----LWVSQKRQQASF----PGDRLRGVVSRLFPYSNY-KLEMVVVNG----------------RGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMIGYTL---KYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGE 996          

HSP 2 Score: 54.6842 bits (130), Expect = 1.483e-6
Identity = 85/412 (20.63%), Postives = 152/412 (36.89%), Query Frame = 3
Query:   87 FTINMLNLLMFSEASFPPSFIQQPPKGEFLYQM---DTTIILPCYAKAIPSANYEWLKNGHSI--ENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG---SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEP--RPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNR 1292
            FT+ +L     +E +  PSF+   P+G    QM      ++L C A  +P+ +  W K G  +  +         +LRI     E+ G Y C+A N +G +I H   +R+     +  L E    +   G       R N  P  ++QW+ V       +    NR V  +      T+I       +Y C ++N     +     + + + P  +S       + LY               L C F      ++RWF+  +          +     G +LEI  I ++D G Y C           +  + V +       P D+     ++   EC+   +P  +  + W  + + +  Y+ G+R+    + L +  +  +D     C AS         A++ V  R
Sbjct:  223 FTLKVLTTRGVAERT--PSFMY--PQGTASSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSDKAKFENFNKALRITNVSEEDSGEYFCLASNKMG-SIRHTISVRVKAAPYW--LDEPKNLILAPGEDGRLVCRANGNPKPTVQWM-VNGEPLQSAPPNPNREVAGDTIIFRDTQISSR---AVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILY-----------NRTRLDCPFFGSPIPTLRWFK--NGQGSNLDGGNYHVYENG-SLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHDPSLKLTVSWLKDDEPL--YI-GNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGR 606          
BLAST of Neuroglian vs. Ensembl Human
Match: NFASC (neurofascin [Source:HGNC Symbol;Acc:HGNC:29866])

HSP 1 Score: 292.352 bits (747), Expect = 1.118e-80
Identity = 254/1065 (23.85%), Postives = 462/1065 (43.38%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGA-------------DTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXX----XCIFS---RGSVRWFRQLDKNAEIKP-KERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFIT-QYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            PP+  +Q  K   +   D  I++ C AK  P+ ++ W +N           + + +  G+L I+        E EG YQC A N  G A+S++  L+++    +       + V       L+C+ P   P   I W++      +    +D R    +NG+L+ + ++ +D    YSC +  +F  T+++               D+ ++  PD  S+  +      +               +     CI S      + W++   K  ++   K +F+   K   L I+N+  +D+G+Y C    +  ++    ++ V   P ++++P +  +A        C+A+G P+P ++W  NG+ +          + G+ +   +       V QCN SN +GY+  NAF++V +  P +L P  + I+ +L    +++C  F  P P + W K+    NL   N Y + +NG+L IK +   D G+Y C+A+NI G+ +N+  + +++PT+I  +  ++  + G  V LEC  + D      L + W K +E L +   +        L +  +  RD G Y C AS  +D DL K  L V G+P+   D+++ D       R   LTW+ G  NN+ IT ++ +F   Q+ P  W      +  +   +       N+  + + PY+ Y FR+ ++N++G+S P S+     +     P  NP DV   GT  N + I W  +   +  GPNL Y +  R  +      T +    +T W +  +V           +  +Y  YE+ +Q++N  G     P    G+SGE YP   P+ +++  +   ++ LQW+ +Y +    + G  R YR  +   E+S     + KN    + +    ++ S+    P  R    V R    S Y ++ M  + G                +  GP+SE     T EG P     F +    +  I + W  P   NGI+ GY +   +   F+ +   ++  +   P+Q +  +      ++Y  ++ A T+ G G+
Sbjct:   34 PPTITKQSAKDHIVDPRDN-ILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSS----MEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNHPYNDSSLRNHPDMYSARGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYK---KGGDLPSDKAKFENFNKA--LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGN-YHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHD--PSLKLTVSWLKDDEPLYI--GNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLGRPDRPRDLELTDLA----ERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWH----DHSKYPGSV-------NSAVLRLSPYVNYQFRVIAINEVGSSHP-SLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRE------TREAWNNVTVWGSRYVV----------GQTPVYVPYEIRVQAENDFG-KGPEPESVIGYSGEDYPRAAPTEVKVRVMNSTAISLQWNRVYSDT---VQGQLREYRA-YYWRESS-----LLKN----LWVSQKRQQASF----PGDRLRGVVSRLFPYSNY-KLEMVVVNG----------------RGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMIGYTL---KYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGE 1013          
BLAST of Neuroglian vs. Ensembl Celegans
Match: lad-2 (L1 CAM ADhesion molecule homolog [Source:UniProtKB/TrEMBL;Acc:H2L0R2])

HSP 1 Score: 277.33 bits (708), Expect = 3.992e-76
Identity = 276/1073 (25.72%), Postives = 449/1073 (41.85%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMD------TTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDE---------GSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWV-NVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE---IYSCISTNNFLRTMKRGAD-TKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRK-----GTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIF-INQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHL--HGNKLYLNNLTTK-DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLE--CSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKP-EPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTS------QPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDA-ITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGN-SEKNHKI-RDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            PP  ++Q  + E  Y +D        + L C A    +  Y WLK+G   E  +++ ++         GS+   +    ++G YQC A N  G A+S+K  LR+  +  +     + + V    S  L C  P   P   I W+    D   +I         +DN G+LH + + +  DG+   +Y C +T+  LR   R  D  ++ I+P    SH   P+  +  S  E TV     + L CIF    +        + E+ PK R + +       G +L + N+   DAG Y C      +T+N++    V+  P +  + P D ++   S+   EC A G+P P I W+ NG+ +       R  L  HG  L + NL    D  V QCNASN  GYV+ NAF++V    P   +P  ++ K VL   V ++C   + P   + W         ++  K  +  N   ++ ++NS D G+Y C  SN +G  +  + + + +PT  + +   KR  +    T E  C A  D +    ++ +W    ++L   +S    IL   L+  S+  R SG  +C A   +D  L  ++L V+  P  PV +       + + R A + WV    +   I  +I E  T +    W VI   NE         NK      +T+ P++ Y FR+ +VN  G S      QP    +  CQ R   P  NP  V   GT P+ L I WK +     N PN+ Y +              K    I  W T  +V  ++ + + +     +++Y + +QS N++G S V P  + G+SGE  P   P +  ID  I   ++   W+ +  N    +NG F GY IE+                              ++ ++ + +++ ++  +    +    H  T              R  N +     S+ V     EG PG V    + ++    I + W  PL  NG + GY I       F N  N +E+ + I R    L E+    + +T Y +S+WA T+ G+G
Sbjct:   24 PPKLLEQSGE-EVWYHLDDEDLLKNRLTLRCEADE-NTDRYSWLKDG---EPFVIDSEDVLWEKESQSGSIVFTKPHASHQGYYQCFASNIFGTALSNKMHLRLGSLEHFPKRDVKLLRVKEGESLTLNCTPPRGTPDPKIVWLYRSLDDSSVIETIRSRHITVDNEGHLHFSSV-ELSDGKATLVYECAATSPVLRGEYRSGDRIQLDIEPSQDKSH---PVKKMSVSPSEVTVRAGGQLKLQCIFGGRPLPTIFWSKIDGEL-PKSRIKDLTSHESDFGRSLIVENVHPDDAGAYECRGRHLVHTVNVR----VMAAPFWEFDPPRDISLPEESTGELECLAGGQPTPIITWSMNGKFLHELAEDSRRVLLDHGRILRVRNLNHDLDTGVYQCNASNPLGYVFANAFVHVRAHAPFFRMPAARHWKVVLHSTVVLDCDVDAAPEAMVRWVDADDRPLQVVEGKNKLFPNHTFMVYDVNSADEGLYYCNVSNKYGINRATNRLQVFKPTYFVRIPTPKRLILEAGETAEVFCEAVADPRLP--IRYQWTINGKVL--TESQYYEILPDRLRFRSVRGRHSGIIDCAAITDVDVKLASMQLIVKDVPAHPVVETA-----HCSERKATVKWVAASDHGDSIKKYIVEMFTDFKKNEWEVI---NEEVNV-----NKETFEVDITLTPWVNYTFRVVAVNSHGRSDMKIDGQPKEDWL-TCQTRPSFPYTNPTGVKGEGTEPDNLVISWKPLDRYYWNAPNMQYLVRY------------KLDEPIHGW-TEFLVEDSLANFTIIRDQPTFRKYLIQVQSVNSVGPSIVEPEIHHGWSGEDVPDEAPRDFHIDTQINFTTINFTWNPVDANT---VNGHFVGYEIEY------------------------------WKAENTIRKYSIKIPANSTYKVINSFHAVT--------NYSAHIRTRNKRLRSAPSDYVSFAMPEGPPGKVHNLRVYSVGSTAILLQWDAPLQPNGRIRGYFI------SFQNEKNETEETYVIHRQKHYLHEK---SEPDTGYKVSVWAETRAGEG 1001          
BLAST of Neuroglian vs. Ensembl Celegans
Match: sax-7 (Sensory AXon guidance [Source:UniProtKB/TrEMBL;Acc:W6RTH3])

HSP 1 Score: 246.514 bits (628), Expect = 6.318e-66
Identity = 290/1163 (24.94%), Postives = 478/1163 (41.10%), Query Frame = 3
Query:  207 CYAKAIPSANYEWLKNGHSI------ENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNV-KDYGRLISFEEDNRRVLDNN--GNL--HITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSV---RWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIF-INQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTK-----DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKY-IKGVLKMNVQINCLAFSVPPPRIIWRK---DSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSP--NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL---KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVD-CKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQY------DPKNWLVILPVNETFQTIIRPNNKIKNN-------TWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRI---VLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPV------AXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKN--HKIRDPDQLRERISDLKSETKYDISIWALTKQGKG----KEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDS--GWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV 3512
            CYA   P  +Y W K+G +       E ++    EGSL   R    + G YQC A N  G A+     ++  +I  + + +   + V         C  P   P A + W+ + K+ G    FE  +   + +N  G L  H     D      Y+C + N  L+  K G    ++I  +   S    P    Y +      L      L C FS       RWF    + +E      F+    G TL + N+ +  AG+Y C    +Q+ ++  F + V   P + +  P +   +     IF+C   G+P P++ +  NG EI      DR  + G +L + ++        D  V QC + N +G+++TN ++N+   KP LL+ P K  ++ V    V + C  F+ P   + W          N I  + Y +   G L+   + + + G YEC+ +N +GQ     T+ +R+PT I+   P   +    G ++ L C A  D Q    +K EW    + L   ++   H        L + + T  D+  Y C  S  +D   ++I++Q +  P  V    V  C + S          +  H  A I     EF  QY      +   W    PV     +   PN+KI NN         V++ P+ KY FR+ + N +G S  + +  + C+   ++P+ NPD+V   GT+P  + ++WK +     NG +  Y +  R  D D          ++  WK   +       +T N    K ++ ++ YEV +Q+ N+ G + V+P    G +GE  P+  PS LR+   +  +V L W+ +        NG F GY+I + ++E   +  D  ++ +D+       R+  ++    V R +   K  V+     Q    TLT +   T    + ++ N  + G  S+ +  QT EG P PV         +    E   + + W KP  TNG L  Y++   E  +  N    EK+   K  D D    RI+ L++ET Y   + A T  G+G     +     +T A   +  +  L    I    FN+S        K  D S +  G  + +Q++      WE  +       + V  L P   Y VR  
Sbjct:   67 CYANGNPRPSYRWKKDGKTFLPSMFPEKVVQKPGEGSLVFSRLDESDAGLYQCEAENSNGTAVDRPVRVQETWIRHFKTAEPEVVVVEVGDPYQRNCSPPASNPYARVYWILMGKEPGH---FETISSSHISSNEQGTLFFHYVNETDFKSDRYYTCTAENIELKDYKFGNQFSLQITNNKRRSLQQMPPTEQYVNQSSPIALQGNQHKLHCFFSGYPAPKPRWFHNGREISEDSDAAGFRFESYGKTL-VFNVTQDKAGKYDCRFATQQD-IDRTFNVVVEAAPYWPLGPPPNTNTSEGEKVIFDCTTYGKPTPKVTFYKNGVEI-ESQKDDRYLIEGTRLTIFDVKKGTYGKGDNAVYQCKSENKHGWLWTNFYLNLLAFKPQLLIDPGKEEVEAVAGKKVTLECKFFASPNAAVKWEAPMISGSKGNQIPADAYGV---GKLVFSEVTAAEEGEYECIGTNKYGQATGLITLKVRKPT-IVQPFPRVEEVRMAGEEMRLACDATADNQL--EVKYEWLVDGKSLPEDRISSGHYKIDDDHSLVISNPTQDDTAKYKCVVSTKLDQVEKEIKIQFKDVPVAVHSAWVQTCDKNSLTAFIKFEHYESIHTIAPIK----EFWVQYQIDSETEGSQWRT-HPV----PSAAHPNDKIDNNLRHTTGDATVSLQPFGKYVFRVIARNSVGDSA-ARLAKDQCETPAKQPDKNPDEVAAKGTSPENIIVQWKPMSREEWNGADFHYVVKYRPKDEDQ---------RVGDWKEVAVEDPFADRVTVNLDDEKDVKPFQPYEVQVQAVNSEGRTNVVPETVEGRTGEGVPSSIPSGLRVLEKSGTTVTLAWNGV---DPQTANGNFTGYKITYWVDEADQDSDDSSEDDEDDEK-----RKFRWKRSIRVKRQSGIRKTVVFGPSATQ---GTLTDLKPATLNHAYIQVTNGAHEGSASDTIDFQTDEGVPSPVRSLRAYPMNSKVGGEKGVVVLVWKKPRQTNGKLARYEV---EYCKTQNGKLVEKSCPRKQIDADSKEIRITGLENETPYRFILRAHTSAGEGDPNSSDATTLPETTAAGVDPGVPSLVENAIGDKYFNVSFR----PAKYDDESRAPVGNTYEVQYKPQDADEWETVKPADDGLTVHVDGLSPGTKYDVRVA 1180          
BLAST of Neuroglian vs. Ensembl Celegans
Match: sax-7 (Sensory AXon guidance [Source:UniProtKB/TrEMBL;Acc:W6RTH3])

HSP 1 Score: 246.128 bits (627), Expect = 7.204e-66
Identity = 290/1163 (24.94%), Postives = 479/1163 (41.19%), Query Frame = 3
Query:  207 CYAKAIPSANYEWLKNGHSI------ENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNV-KDYGRLISFEEDNRRVLDNN--GNL--HITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSV---RWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIF-INQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTK-----DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKY-IKGVLKMNVQINCLAFSVPPPRIIWRK---DSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSP--NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL---KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVD-CKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQY------DPKNWLVILPVNETFQTIIRPNNKIKNN-------TWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRI---VLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPV------AXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKN--HKIRDPDQLRERISDLKSETKYDISIWALTKQGKG----KEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDS--GWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV 3512
            CYA   P  +Y W K+G +       E ++    EGSL   R    + G YQC A N  G A+     ++  +I  + + +   + V         C  P   P A + W+ + K+ G    FE  +   + +N  G L  H     D      Y+C + N  L+  K G    ++I  +   S    P    Y +      L      L C FS       RWF    + +E      F+    G TL + N+ +  AG+Y C    +Q+ ++  F + V   P + +  P +   +     IF+C   G+P P++ +  NG EI    + DR  + G +L + ++        D  V QC + N +G+++TN ++N+   KP LL+ P K  ++ V    V + C  F+ P   + W          N I  + Y +   G L+   + + + G YEC+ +N +GQ     T+ +R+PT I+   P   +    G ++ L C A  D Q    +K EW    + L   ++   H        L + + T  D+  Y C  S  +D   ++I++Q +  P  V    V  C + S          +  H  A I     EF  QY      +   W    PV     +   PN+KI NN         V++ P+ KY FR+ + N +G S  + +  + C+   ++P+ NPD+V   GT+P  + ++WK +     NG +  Y +  R  D D          ++  WK   +       +T N    K ++ ++ YEV +Q+ N+ G + V+P    G +GE  P+  PS LR+   +  +V L W+ +        NG F GY+I + ++E   +  D  ++ +D+       R+  ++    V R +   K  V+     Q    TLT +   T    + ++ N  + G  S+ +  QT EG P PV         +    E   + + W KP  TNG L  Y++   E  +  N    EK+   K  D D    RI+ L++ET Y   + A T  G+G     +     +T A   +  +  L    I    FN+S        K  D S +  G  + +Q++      WE  +       + V  L P   Y VR  
Sbjct:   67 CYANGNPRPSYRWKKDGKTFLPSMFPEKVVQKPGEGSLVFSRLDESDAGLYQCEAENSNGTAVDRPVRVQETWIRHFKTAEPEVVVVEVGDPYQRNCSPPASNPYARVYWILMGKEPGH---FETISSSHISSNEQGTLFFHYVNETDFKSDRYYTCTAENIELKDYKFGNQFSLQITNNKRRSLQQMPPTEQYVNQSSPIALQGNQHKLHCFFSGYPAPKPRWFHNGREISEDSDAAGFRFESYGKTL-VFNVTQDKAGKYDCRFATQQD-IDRTFNVVVEAAPYWPLGPPPNTNTSEGEKVIFDCTTYGKPTPKVTFYKNGVEIESQKD-DRYLIEGTRLTIFDVKKGTYGKGDNAVYQCKSENKHGWLWTNFYLNLLAFKPQLLIDPGKEEVEAVAGKKVTLECKFFASPNAAVKWEAPMISGSKGNQIPADAYGV---GKLVFSEVTAAEEGEYECIGTNKYGQATGLITLKVRKPT-IVQPFPRVEEVRMAGEEMRLACDATADNQL--EVKYEWLVDGKSLPEDRISSGHYKIDDDHSLVISNPTQDDTAKYKCVVSTKLDQVEKEIKIQFKDVPVAVHSAWVQTCDKNSLTAFIKFEHYESIHTIAPIK----EFWVQYQIDSETEGSQWRT-HPV----PSAAHPNDKIDNNLRHTTGDATVSLQPFGKYVFRVIARNSVGDSA-ARLAKDQCETPAKQPDKNPDEVAAKGTSPENIIVQWKPMSREEWNGADFHYVVKYRPKDEDQ---------RVGDWKEVAVEDPFADRVTVNLDDEKDVKPFQPYEVQVQAVNSEGRTNVVPETVEGRTGEGVPSSIPSGLRVLEKSGTTVTLAWNGV---DPQTANGNFTGYKITYWVDEADQDSDDSSEDDEDDEK-----RKFRWKRSIRVKRQSGIRKTVVFGPSATQ---GTLTDLKPATLNHAYIQVTNGAHEGSASDTIDFQTDEGVPSPVRSLRAYPMNSKVGGEKGVVVLVWKKPRQTNGKLARYEV---EYCKTQNGKLVEKSCPRKQIDADSKEIRITGLENETPYRFILRAHTSAGEGDPNSSDATTLPETTAAGVDPGVPSLVENAIGDKYFNVSFR----PAKYDDESRAPVGNTYEVQYKPQDADEWETVKPADDGLTVHVDGLSPGTKYDVRVA 1180          
BLAST of Neuroglian vs. Ensembl Celegans
Match: sax-7 (Sensory AXon guidance [Source:UniProtKB/TrEMBL;Acc:W6RTH3])

HSP 1 Score: 211.846 bits (538), Expect = 2.415e-55
Identity = 252/1009 (24.98%), Postives = 419/1009 (41.53%), Query Frame = 3
Query:  636 YSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSV---RWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIF-INQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTK-----DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKY-IKGVLKMNVQINCLAFSVPPPRIIWRK---DSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSP--NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL---KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVD-CKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQY------DPKNWLVILPVNETFQTIIRPNNKIKNN-------TWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRI---VLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPV------AXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKN--HKIRDPDQLRERISDLKSETKYDISIWALTKQGKG----KEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDS--GWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV 3512
            Y+C + N  L+  K G    ++I  +   S    P    Y +      L      L C FS       RWF    + +E      F+    G TL + N+ +  AG+Y C    +Q+ ++  F + V   P + +  P +   +     IF+C   G+P P++ +  NG EI      DR  + G +L + ++        D  V QC + N +G+++TN ++N+   KP LL+ P K  ++ V    V + C  F+ P   + W          N I  + Y +   G L+   + + + G YEC+ +N +GQ     T+ +R+PT I+   P   +    G ++ L C A  D Q    +K EW    + L   ++   H        L + + T  D+  Y C  S  +D   ++I++Q +  P  V    V  C + S          +  H  A I     EF  QY      +   W    PV     +   PN+KI NN         V++ P+ KY FR+ + N +G S  + +  + C+   ++P+ NPD+V   GT+P  + ++WK +     NG +  Y +  R  D D          ++  WK   +       +T N    K ++ ++ YEV +Q+ N+ G + V+P    G +GE  P+  PS LR+   +  +V L W+ +        NG F GY+I + ++E   +  D  ++ +D+       R+  ++    V R +   K  V+     Q    TLT +   T    + ++ N  + G  S+ +  QT EG P PV         +    E   + + W KP  TNG L  Y++   E  +  N    EK+   K  D D    RI+ L++ET Y   + A T  G+G     +     +T A   +  +  L    I    FN+S        K  D S +  G  + +Q++      WE  +       + V  L P   Y VR  
Sbjct:   34 YTCTAENIELKDYKFGNQFSLQITNNKRRSLQQMPPTEQYVNQSSPIALQGNQHKLHCFFSGYPAPKPRWFHNGREISEDSDAAGFRFESYGKTL-VFNVTQDKAGKYDCRFATQQD-IDRTFNVVVEAAPYWPLGPPPNTNTSEGEKVIFDCTTYGKPTPKVTFYKNGVEI-ESQKDDRYLIEGTRLTIFDVKKGTYGKGDNAVYQCKSENKHGWLWTNFYLNLLAFKPQLLIDPGKEEVEAVAGKKVTLECKFFASPNAAVKWEAPMISGSKGNQIPADAYGV---GKLVFSEVTAAEEGEYECIGTNKYGQATGLITLKVRKPT-IVQPFPRVEEVRMAGEEMRLACDATADNQL--EVKYEWLVDGKSLPEDRISSGHYKIDDDHSLVISNPTQDDTAKYKCVVSTKLDQVEKEIKIQFKDVPVAVHSAWVQTCDKNSLTAFIKFEHYESIHTIAPIK----EFWVQYQIDSETEGSQWRT-HPV----PSAAHPNDKIDNNLRHTTGDATVSLQPFGKYVFRVIARNSVGDSA-ARLAKDQCETPAKQPDKNPDEVAAKGTSPENIIVQWKPMSREEWNGADFHYVVKYRPKDEDQ---------RVGDWKEVAVEDPFADRVTVNLDDEKDVKPFQPYEVQVQAVNSEGRTNVVPETVEGRTGEGVPSSIPSGLRVLEKSGTTVTLAWNGV---DPQTANGNFTGYKITYWVDEADQDSDDSSEDDEDDEK-----RKFRWKRSIRVKRQSGIRKTVVFGPSATQ---GTLTDLKPATLNHAYIQVTNGAHEGSASDTIDFQTDEGVPSPVRSLRAYPMNSKVGGEKGVVVLVWKKPRQTNGKLARYEV---EYCKTQNGKLVEKSCPRKQIDADSKEIRITGLENETPYRFILRAHTSAGEGDPNSSDATTLPETTAAGVDPGVPSLVENAIGDKYFNVSFR----PAKYDDESRAPVGNTYEVQYKPQDADEWETVKPADDGLTVHVDGLSPGTKYDVRVA 996          
BLAST of Neuroglian vs. Ensembl Celegans
Match: sax-7 (Sensory AXon guidance [Source:UniProtKB/TrEMBL;Acc:W6RTH3])

HSP 1 Score: 211.075 bits (536), Expect = 4.393e-55
Identity = 252/1009 (24.98%), Postives = 419/1009 (41.53%), Query Frame = 3
Query:  636 YSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSV---RWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIF-INQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTK-----DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKY-IKGVLKMNVQINCLAFSVPPPRIIWRK---DSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSP--NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL---KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVD-CKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQY------DPKNWLVILPVNETFQTIIRPNNKIKNN-------TWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRI---VLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPV------AXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKN--HKIRDPDQLRERISDLKSETKYDISIWALTKQGKG----KEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDS--GWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV 3512
            Y+C + N  L+  K G    ++I  +   S    P    Y +      L      L C FS       RWF    + +E      F+    G TL + N+ +  AG+Y C    +Q+ ++  F + V   P + +  P +   +     IF+C   G+P P++ +  NG EI      DR  + G +L + ++        D  V QC + N +G+++TN ++N+   KP LL+ P K  ++ V    V + C  F+ P   + W          N I  + Y +   G L+   + + + G YEC+ +N +GQ     T+ +R+PT I+   P   +    G ++ L C A  D Q    +K EW    + L   ++   H        L + + T  D+  Y C  S  +D   ++I++Q +  P  V    V  C + S          +  H  A I     EF  QY      +   W    PV     +   PN+KI NN         V++ P+ KY FR+ + N +G S  + +  + C+   ++P+ NPD+V   GT+P  + ++WK +     NG +  Y +  R  D D          ++  WK   +       +T N    K ++ ++ YEV +Q+ N+ G + V+P    G +GE  P+  PS LR+   +  +V L W+ +        NG F GY+I + ++E   +  D  ++ +D+       R+  ++    V R +   K  V+     Q    TLT +   T    + ++ N  + G  S+ +  QT EG P PV         +    E   + + W KP  TNG L  Y++   E  +  N    EK+   K  D D    RI+ L++ET Y   + A T  G+G     +     +T A   +  +  L    I    FN+S        K  D S +  G  + +Q++      WE  +       + V  L P   Y VR  
Sbjct:   34 YTCTAENIELKDYKFGNQFSLQITNNKRRSLQQMPPTEQYVNQSSPIALQGNQHKLHCFFSGYPAPKPRWFHNGREISEDSDAAGFRFESYGKTL-VFNVTQDKAGKYDCRFATQQD-IDRTFNVVVEAAPYWPLGPPPNTNTSEGEKVIFDCTTYGKPTPKVTFYKNGVEI-ESQKDDRYLIEGTRLTIFDVKKGTYGKGDNAVYQCKSENKHGWLWTNFYLNLLAFKPQLLIDPGKEEVEAVAGKKVTLECKFFASPNAAVKWEAPMISGSKGNQIPADAYGV---GKLVFSEVTAAEEGEYECIGTNKYGQATGLITLKVRKPT-IVQPFPRVEEVRMAGEEMRLACDATADNQL--EVKYEWLVDGKSLPEDRISSGHYKIDDDHSLVISNPTQDDTAKYKCVVSTKLDQVEKEIKIQFKDVPVAVHSAWVQTCDKNSLTAFIKFEHYESIHTIAPIK----EFWVQYQIDSETEGSQWRT-HPV----PSAAHPNDKIDNNLRHTTGDATVSLQPFGKYVFRVIARNSVGDSA-ARLAKDQCETPAKQPDKNPDEVAAKGTSPENIIVQWKPMSREEWNGADFHYVVKYRPKDEDQ---------RVGDWKEVAVEDPFADRVTVNLDDEKDVKPFQPYEVQVQAVNSEGRTNVVPETVEGRTGEGVPSSIPSGLRVLEKSGTTVTLAWNGV---DPQTANGNFTGYKITYWVDEADQDSDDSSEDDEDDEK-----RKFRWKRSIRVKRQSGIRKTVVFGPSATQ---GTLTDLKPATLNHAYIQVTNGAHEGSASDTIDFQTDEGVPSPVRSLRAYPMNSKVGGEKGVVVLVWKKPRQTNGKLARYEV---EYCKTQNGKLVEKSCPRKQIDADSKEIRITGLENETPYRFILRAHTSAGEGDPNSSDATTLPETTAAGVDPGVPSLVENAIGDKYFNVSFR----PAKYDDESRAPVGNTYEVQYKPQDADEWETVKPADDGLTVHVDGLSPGTKYDVRVA 996          
BLAST of Neuroglian vs. Ensembl Fly
Match: Nrg (gene:FBgn0264975 transcript:FBtr0301762)

HSP 1 Score: 352.058 bits (902), Expect = 6.878e-101
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. Ensembl Fly
Match: Nrg (gene:FBgn0264975 transcript:FBtr0071207)

HSP 1 Score: 352.058 bits (902), Expect = 6.878e-101
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. Ensembl Fly
Match: Nrg (gene:FBgn0264975 transcript:FBtr0071209)

HSP 1 Score: 352.058 bits (902), Expect = 6.878e-101
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. Ensembl Fly
Match: Nrg (gene:FBgn0264975 transcript:FBtr0333522)

HSP 1 Score: 352.058 bits (902), Expect = 6.878e-101
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. Ensembl Fly
Match: Nrg (gene:FBgn0264975 transcript:FBtr0301764)

HSP 1 Score: 352.058 bits (902), Expect = 6.878e-101
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. Ensembl Zebrafish
Match: chl1b (cell adhesion molecule L1-like b [Source:ZFIN;Acc:ZDB-GENE-091105-1])

HSP 1 Score: 313.538 bits (802), Expect = 1.541e-87
Identity = 256/1047 (24.45%), Postives = 453/1047 (43.27%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIR----DPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+  +  P     +  + +  + C A   P   + W KNG   +      LI   D G+  I     + E +G Y+C A N LG A+S + E  +  +  +       I+V    S ILEC+ P   PP  I W+ +     L   E+D R  +  NGNL+ +  ++ D    Y C +    +RT+ +     + +K  +        L+          ++    + L CI   F    V W     K    K  ER      G  L +  +  +D G+Y+C        +   F + V E P F  +P  + V I +  + +C   G P+P + W  NG+ +      +R  L    + ++N   ++  V QC A+N +G +  NA I + N +PL+L         V   +V ++C  FS P   I W K + + N +   ++++  NG+L I N+   D G Y C A N  G+    +T+ +++PT+I+    + R   G  +   C    D   G++ ++ W K    L   +     +   VL++ +++  D GFY C A   +D D+   +L V   P+P  D+ +      N R   L W  G  +N+ IT  + EF  +Q++P +W  ++ V         P N   ++  + ++ ++ Y FR+ ++N++G  +PS  T    +     P+ NP+++ I    P+ + I W+ +  + HNGP L Y ++ R    D              W T R+V      +S L K    +  YE+ IQ+KN  G+    P     +SGE +P+  P ++ ++ + +  VK++W  ++++   +I+G   GYR+ W    +   L D KK   D+  +                            +  G+ + A +TG+   +   +     N +  GP S  V  +T EG PG  A F+   I+ + + + W+ P+  NG+L GY +     +Q  N  N+E+   +       D  ++ + +L++ +KY   +   T+ G G
Sbjct:   42 PTITEYSPASLIAFPFEESFPVKCEATGNPEPEFRWTKNGQDFDPYQDTRLITLDDSGTFIIPNTGNLTEFQGIYRCFATNKLGTAMSEEIEFIIPNVPKFPKEIIDPIEVMEGQSVILECNPPTGIPPLQIYWMTIS----LQHIEQDERVSVGLNGNLYFSNTVETDSRRDYCCFAAFPRIRTIVQKTAMSMVVKSTNSLLERKPSLLAPTGMESHTRLVKGEDLQLECIAEGFPTPKVEWV----KIGFNKLPERVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGEVVHHFHVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGRPLNEVPTSNRKILKDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSK-ADSANAVEGERFTVHQNGSLEIHNVMKEDMGEYSCFAQNTEGKVAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEKDGIALNGSEDGRYILEDGVLEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDPPEDVILS---EHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHEPGSWREMMRV---------PGN--HHSAPLKLYGHVDYRFRVSAINEVGKGRPSQST-ERYKTPASAPDKNPENIKIEAHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRHGSD------------EDW-TERMV----KRHSFLVKNTPTFVLYEIKIQAKNHAGWGPD-PKIITAYSGEDFPSAAPDDVAVEVLNNTMVKVRWEHVHKD---KIHGHLGGYRVSWWRLRS---LLDSKKTHGDKHTL----------------------------TFSGERNHAVVTGLKPFSEYSLIVMAFNSRGNGPGSHSVNFKTPEGVPGQAAAFSATNIQKHKVTLTWSPPVDANGVLIGYIL----QYQLIN--NTEELGPLMTLNISADSNKQHLENLEALSKYKFYLRCCTRVGCG 1006          
BLAST of Neuroglian vs. Ensembl Zebrafish
Match: nrcama (neuronal cell adhesion molecule a [Source:ZFIN;Acc:ZDB-GENE-041210-235])

HSP 1 Score: 312.768 bits (800), Expect = 3.169e-87
Identity = 260/990 (26.26%), Postives = 439/990 (44.34%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERAIRENE---GSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGY 3068
            PP+   Q PK +++      I + C AK  P  ++ W +NG   +      +++    G+L I+ +  + E   G YQC+A N  G A+S+   +R +    +S  K   I V    S IL+C  P   PP  I W++  ++ RL    +++R     NG+L+ + +I ED    Y C +     +T+++     +K+  +S S   +   +          VL   T+ L CI       ++ W +    N E+ P  RF       TL+I  +   D G Y C       +     T+ V   P +I+ P +  +A   +    C   G P+P I W+ NG  I    N     +    + L+++ T    V QCNASN YGY+  NAF++V    P +L         +      ++C +F  P P+I W KDS   +++ ++ Y +  NG L I      ++G Y C+ASN  G  +N   + ++EPT+II     K  Q       EC  + D     ++   W K N  L         + S  L +  +T  D G Y C  +  +D D     L V  +P+P +D+++  +R    R   LTW  G  +N+ I   + ++  + ++P  WL +  V+ T  T             + + PY+ Y+FR+ ++N +G S+ SS      +    +P++NP DV + GT+P+T+TI W+ +  L  NGP L Y ++ R  D +              W T  + L+N+ S   +T    +  YEVT+Q+ N  G     P    G+SGE+ PT+ P N+++   +    ++ W  +    LS + G  +GY++      T  ++  + K   D    + +P+ L +  ++ V R       D++   + ++++    G                   GP S + + QT EG PGP    NI  + ++ + + W  PL  NG LTGY
Sbjct:   39 PPTITNQSPK-DYIIDPRENINIFCEAKGKPHPSFSWTRNGTHFDVEKDPKVVMMPGTGNLVIDISGEKAEVYEGVYQCIARNEHGSAVSNNIVIRQSRSPLWSKEKNEPITVQRGTSLILQCRPPAGLPPPIIFWMD-NNFQRL---PQNSRVSQALNGDLYFSNVIMEDTRNDYICYARFPHTQTIQQKQPITVKVLDNSPSGERVPSFLHPPGMESTTMVLKGDTLELECIADGLPTPNISWTK---VNGEL-PSGRFSFYSFQKTLKIKEVTEADGGDYRCIAKNRMGSSQHTITVVVRAAPFWISAPQNLILAPKETGNLTCDVDGNPKPTITWSVNGNPIESSHNDPSRKVSDGVITLSDVQTGSSAVYQCNASNDYGYLLANAFVSVLAEPPRVLTSLNHEYSVISNSRALLDCASFGSPLPKITWFKDSQ--SILNSDLYHIHKNGTLEINVAQPQNSGKYTCIASNNLGNKENHVHLQVKEPTRIIRQPEYKEVQRNSIAVFECKVKHDPTLIPSMI--WLKDNGELP--DDPRFEVGSDSLTIHDVTEDDEGTYTCIRNTTLDQDSASATLTVVEQPDPPTDLELTDQR---ERSVRLTWTPGDEHNSPIKLFLIQYEDSLHEPGVWLNMTEVSGTSTT-----------AQLELSPYVYYSFRVLALNGVGLSE-SSDPSRQYRTNPAKPDVNPSDVEVSGTSPDTMTISWRELSGLESNGPGLQYKVSWRMKDAE-------------QWTT--VTLANV-SQHVVTGTPTFTLYEVTVQAVNDYG-EGPRPEVVLGYSGENSPTVAPENVKVSVQSGTEAEVHWEAV---PLSSVRGRLKGYKV------TYQKMRSLHKQDYD----RENPQVLIFSGEETVGRL-----PDLHPYSHYRLNIRAFNG----------------HGDGPSSTDQQFQTPEGVPGPPTNVNIRNLNLDSLLVEWTPPLEDNGHLTGY 947          
BLAST of Neuroglian vs. Ensembl Zebrafish
Match: chl1b (cell adhesion molecule L1-like b [Source:ZFIN;Acc:ZDB-GENE-091105-1])

HSP 1 Score: 310.842 bits (795), Expect = 1.309e-86
Identity = 260/1062 (24.48%), Postives = 460/1062 (43.31%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSI------------SSHLL--KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIR----DPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+  +  P     +  + +  + C A   P   + W KNG   +      LI   D G+  I     + E +G Y+C A N LG A+S + E  +  +  +       I+V    S ILEC+ P   PP  I W+ +     L   E+D R  +  NGNL+ +  ++ D    Y C +    +RT+ +     + +K + +            ++ LL  KP L+          ++    + L CI   F    V W     K    K  ER      G  L +  +  +D G+Y+C        +   F + V E P F  +P  + V I +  + +C   G P+P + W  NG+ +      +R  L    + ++N   ++  V QC A+N +G +  NA I + N +PL+L         V   +V ++C  FS P   I W K + + N +   ++++  NG+L I N+   D G Y C A N  G+    +T+ +++PT+I+    + R   G  +   C    D   G++ ++ W K    L   +     +   VL++ +++  D GFY C A   +D D+   +L V   P+P  D+ +      N R   L W  G  +N+ IT  + EF  +Q++P +W  ++ V         P N   ++  + ++ ++ Y FR+ ++N++G  +PS  T    +     P+ NP+++ I    P+ + I W+ +  + HNGP L Y ++ R    D              W T R+V      +S L K    +  YE+ IQ+KN  G+    P     +SGE +P+  P ++ ++ + +  VK++W  ++++   +I+G   GYR+ W    +   L D KK   D+  +                            +  G+ + A +TG+   +   +     N +  GP S  V  +T EG PG  A F+   I+ + + + W+ P+  NG+L GY +     +Q  N  N+E+   +       D  ++ + +L++ +KY   +   T+ G G
Sbjct:   42 PTITEYSPASLIAFPFEESFPVKCEATGNPEPEFRWTKNGQDFDPYQDTRLITLDDSGTFIIPNTGNLTEFQGIYRCFATNKLGTAMSEEIEFIIPNVPKFPKEIIDPIEVMEGQSVILECNPPTGIPPLQIYWMTIS----LQHIEQDERVSVGLNGNLYFSNTVETDSRRDYCCFAAFPRIRTIVQKTAMSMVVKSNKLMKDSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVKGEDLQLECIAEGFPTPKVEWV----KIGFNKLPERVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGEVVHHFHVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGRPLNEVPTSNRKILKDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSK-ADSANAVEGERFTVHQNGSLEIHNVMKEDMGEYSCFAQNTEGKVAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEKDGIALNGSEDGRYILEDGVLEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDPPEDVILS---EHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHEPGSWREMMRV---------PGN--HHSAPLKLYGHVDYRFRVSAINEVGKGRPSQST-ERYKTPASAPDKNPENIKIEAHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRHGSD------------EDW-TERMV----KRHSFLVKNTPTFVLYEIKIQAKNHAGWGPD-PKIITAYSGEDFPSAAPDDVAVEVLNNTMVKVRWEHVHKD---KIHGHLGGYRVSWWRLRS---LLDSKKTHGDKHTL----------------------------TFSGERNHAVVTGLKPFSEYSLIVMAFNSRGNGPGSHSVNFKTPEGVPGQAAAFSATNIQKHKVTLTWSPPVDANGVLIGYIL----QYQLIN--NTEELGPLMTLNISADSNKQHLENLEALSKYKFYLRCCTRVGCG 1021          
BLAST of Neuroglian vs. Ensembl Zebrafish
Match: chl1b (cell adhesion molecule L1-like b [Source:ZFIN;Acc:ZDB-GENE-091105-1])

HSP 1 Score: 310.457 bits (794), Expect = 1.502e-86
Identity = 260/1062 (24.48%), Postives = 460/1062 (43.31%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSI------------SSHLL--KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIR----DPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+  +  P     +  + +  + C A   P   + W KNG   +      LI   D G+  I     + E +G Y+C A N LG A+S + E  +  +  +       I+V    S ILEC+ P   PP  I W+ +     L   E+D R  +  NGNL+ +  ++ D    Y C +    +RT+ +     + +K + +            ++ LL  KP L+          ++    + L CI   F    V W     K    K  ER      G  L +  +  +D G+Y+C        +   F + V E P F  +P  + V I +  + +C   G P+P + W  NG+ +      +R  L    + ++N   ++  V QC A+N +G +  NA I + N +PL+L         V   +V ++C  FS P   I W K + + N +   ++++  NG+L I N+   D G Y C A N  G+    +T+ +++PT+I+    + R   G  +   C    D   G++ ++ W K    L   +     +   VL++ +++  D GFY C A   +D D+   +L V   P+P  D+ +      N R   L W  G  +N+ IT  + EF  +Q++P +W  ++ V         P N   ++  + ++ ++ Y FR+ ++N++G  +PS  T    +     P+ NP+++ I    P+ + I W+ +  + HNGP L Y ++ R    D              W T R+V      +S L K    +  YE+ IQ+KN  G+    P     +SGE +P+  P ++ ++ + +  VK++W  ++++   +I+G   GYR+ W    +   L D KK   D+  +                            +  G+ + A +TG+   +   +     N +  GP S  V  +T EG PG  A F+   I+ + + + W+ P+  NG+L GY +     +Q  N  N+E+   +       D  ++ + +L++ +KY   +   T+ G G
Sbjct:   42 PTITEYSPASLIAFPFEESFPVKCEATGNPEPEFRWTKNGQDFDPYQDTRLITLDDSGTFIIPNTGNLTEFQGIYRCFATNKLGTAMSEEIEFIIPNVPKFPKEIIDPIEVMEGQSVILECNPPTGIPPLQIYWMTIS----LQHIEQDERVSVGLNGNLYFSNTVETDSRRDYCCFAAFPRIRTIVQKTAMSMVVKSNKLMKDSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVKGEDLQLECIAEGFPTPKVEWV----KIGFNKLPERVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGEVVHHFHVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGRPLNEVPTSNRKILKDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSK-ADSANAVEGERFTVHQNGSLEIHNVMKEDMGEYSCFAQNTEGKVAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEKDGIALNGSEDGRYILEDGVLEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDPPEDVILS---EHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHEPGSWREMMRV---------PGN--HHSAPLKLYGHVDYRFRVSAINEVGKGRPSQST-ERYKTPASAPDKNPENIKIEAHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRHGSD------------EDW-TERMV----KRHSFLVKNTPTFVLYEIKIQAKNHAGWGPD-PKIITAYSGEDFPSAAPDDVAVEVLNNTMVKVRWEHVHKD---KIHGHLGGYRVSWWRLRS---LLDSKKTHGDKHTL----------------------------TFSGERNHAVVTGLKPFSEYSLIVMAFNSRGNGPGSHSVNFKTPEGVPGQAAAFSATNIQKHKVTLTWSPPVDANGVLIGYIL----QYQLIN--NTEELGPLMTLNISADSNKQHLENLEALSKYKFYLRCCTRVGCG 1021          
BLAST of Neuroglian vs. Ensembl Zebrafish
Match: chl1b (cell adhesion molecule L1-like b [Source:ZFIN;Acc:ZDB-GENE-091105-1])

HSP 1 Score: 310.071 bits (793), Expect = 3.081e-86
Identity = 260/1062 (24.48%), Postives = 460/1062 (43.31%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSI------------SSHLL--KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTK-IEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIR----DPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+  +  P     +  + +  + C A   P   + W KNG   +      LI   D G+  I     + E +G Y+C A N LG A+S + E  +  +  +       I+V    S ILEC+ P   PP  I W+ +     L   E+D R  +  NGNL+ +  ++ D    Y C +    +RT+ +     + +K + +            ++ LL  KP L+          ++    + L CI   F    V W     K    K  ER      G  L +  +  +D G+Y+C        +   F + V E P F  +P  + V I +  + +C   G P+P + W  NG+ +      +R  L    + ++N   ++  V QC A+N +G +  NA I + N +PL+L         V   +V ++C  FS P   I W K + + N +   ++++  NG+L I N+   D G Y C A N  G+    +T+ +++PT+I+    + R   G  +   C    D   G++ ++ W K    L   +     +   VL++ +++  D GFY C A   +D D+   +L V   P+P  D+ +      N R   L W  G  +N+ IT  + EF  +Q++P +W  ++ V         P N   ++  + ++ ++ Y FR+ ++N++G  +PS  T    +     P+ NP+++ I    P+ + I W+ +  + HNGP L Y ++ R    D              W T R+V      +S L K    +  YE+ IQ+KN  G+    P     +SGE +P+  P ++ ++ + +  VK++W  ++++   +I+G   GYR+ W    +   L D KK   D+  +                            +  G+ + A +TG+   +   +     N +  GP S  V  +T EG PG  A F+   I+ + + + W+ P+  NG+L GY +     +Q  N  N+E+   +       D  ++ + +L++ +KY   +   T+ G G
Sbjct:   42 PTITEYSPASLIAFPFEESFPVKCEATGNPEPEFRWTKNGQDFDPYQDTRLITLDDSGTFIIPNTGNLTEFQGIYRCFATNKLGTAMSEEIEFIIPNVPKFPKEIIDPIEVMEGQSVILECNPPTGIPPLQIYWMTIS----LQHIEQDERVSVGLNGNLYFSNTVETDSRRDYCCFAAFPRIRTIVQKTAMSMVVKSNKLMKDSSSGSGRGYANSLLERKPSLLAPTGMESHTRLVKGEDLQLECIAEGFPTPKVEWV----KIGFNKLPERVVVESHGKLLTVEMVNEEDEGKYMCRAKNPHGEVVHHFHVTVEEPPEFEIEPQSQLVTIGADVLIKCVVKGNPQPTVGWRVNGRPLNEVPTSNRKILKDGTISIHNANPENSAVYQCEATNKHGTILANANIMIMNIQPLILTENNLQYMAVEGKSVVMHCKVFSSPASSITWSK-ADSANAVEGERFTVHQNGSLEIHNVMKEDMGEYSCFAQNTEGKVAIAATLEVKDPTRIVDPPRDLRVLAGTTIQFSCQPEFDPSFGDDFEVLWEKDGIALNGSEDGRYILEDGVLEIINVSFGDQGFYACVARTPVDQDVAVAQLSVVDVPDPPEDVILS---EHNGRSVKLQWTPGDDHNSSITEFVLEFEESQHEPGSWREMMRV---------PGN--HHSAPLKLYGHVDYRFRVSAINEVGKGRPSQST-ERYKTPASAPDKNPENIKIEAHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRHGSD------------EDW-TERMV----KRHSFLVKNTPTFVLYEIKIQAKNHAGWGPD-PKIITAYSGEDFPSAAPDDVAVEVLNNTMVKVRWEHVHKD---KIHGHLGGYRVSWWRLRS---LLDSKKTHGDKHTL----------------------------TFSGERNHAVVTGLKPFSEYSLIVMAFNSRGNGPGSHSVNFKTPEGVPGQAAAFSATNIQKHKVTLTWSPPVDANGVLIGYIL----QYQLIN--NTEELGPLMTLNISADSNKQHLENLEALSKYKFYLRCCTRVGCG 1021          
BLAST of Neuroglian vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 319.316 bits (817), Expect = 1.966e-89
Identity = 290/1089 (26.63%), Postives = 465/1089 (42.70%), Query Frame = 3
Query:  114 MFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE---RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIH---LHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKK-NELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVN-ETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNI----NPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWK----TSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIE 3302
            +  E  +PP   +Q P+   LY  D  I+L C AK    A Y W K+G + +      +   +D G+L I     ++++ +G Y+C A N LG AISH+  +       +     R +D+    S IL C+ P    P  + W+N      L+   +D R  +  NGNL+ + +  +D+   Y C +     RT+ +     IK++P + S    KP + L   ++   + L    L     + G     + W   L         ER Q      TL I  ++ +D G Y C     Q + +  FT+ V   P +IN+P D   A     I  C+  G+P+P++ W  NG+ +    + D  H   L    L LNN+   D +V+QC A N +G +  NAF+ V    P +L    +    V K NV ++C AF  P P I W  D  + NL   +++SM  NG L I  +   D G+Y C ASN  G     + + +R  TKII+    +  + G     +C    D +  + + I+W K  NE+ +   +    I    L + ++   D G Y C A   +D      EL V   PE   D+++   + ++     LTW  G  NN+ I   I E+    ++P  W  +  V+ + F            N  + + PY+ Y FR+ +VN++G S  S     N   R E P      NP +V   GT P  + I WK +  ++ NGP   Y +  R             Q+    WK     S  VL + TS        I++ YE+ +QS N +G +T  P    G SGE  P I P N+ ++A+ + ++K+ W  + +N L   NG  +G+ + +                                     TR N   +      ++G    A +TG+   +   +   IIN +  G  SE   I+T EG P P +   +E      + + W  P   NGILTGY+I   +    +++G    +  I DP Q    +S++ S+  Y   ++A T  G+ +   +   T  E +   ++ + IE
Sbjct:   32 VMQEIMYPPVITEQSPEKYVLYPNDD-IVLKCEAKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSGTLNISGNGNSMKDFQGKYRCYATNDLGTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIWMN----SNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPTN-SVKFRKPEMMLPEGSMSTVLALRDQPLQLECIAEGLPTPEIEWIPLLGSTY----NERIQFDDFKKTLHIDKVQDEDDGDYQCIAKNTQGSSSHTFTVVVESAPYWINKPEDGIYAPGEDIILHCEVGGKPKPKVTWKINGKSLK---DSDLYHNWKLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANAFVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTIQWESDLED-NLFALDQFSMHTNGTLTITGVAKEDEGIYRCTASNNQGNVSISAYLDVRNATKIITPPMEQHARKGGKAIFQCKVEFDPKMSDKI-IQWRKNGNEIKEDADNDKYFIEDYTLSISNVQESDHGMYTCAAHTELDAVELTAELVVIDLPEAPFDLELSNAQETS---ITLTWTPGNDNNSPIEEFIIEYEEDSFEPGVWHELTRVDGDMF------------NVDLDLSPYVNYQFRVIAVNEVGPSNGS-----NPSDRYETPAFAPAKNPREVKGEGTEPQNMYISWKPLKGIDWNGPGFKYLVKWR-------------QLGKEEWKEVVADSPPVLVSGTS--------IFEPYEIIVQSVNDIGRATE-PKPVIGHSGEDMPDITPENVGLEAMNESAIKVAWLPVQKNGL---NGHLKGFMVYY-------------------------------------TRHNGHNRHPGKLLVHGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEI-YHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQEIEVPPVLNVSIE 1022          
BLAST of Neuroglian vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 319.316 bits (817), Expect = 2.205e-89
Identity = 290/1089 (26.63%), Postives = 465/1089 (42.70%), Query Frame = 3
Query:  114 MFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE---RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIH---LHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKK-NELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVN-ETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNI----NPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWK----TSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIE 3302
            +  E  +PP   +Q P+   LY  D  I+L C AK    A Y W K+G + +      +   +D G+L I     ++++ +G Y+C A N LG AISH+  +       +     R +D+    S IL C+ P    P  + W+N      L+   +D R  +  NGNL+ + +  +D+   Y C +     RT+ +     IK++P + S    KP + L   ++   + L    L     + G     + W   L         ER Q      TL I  ++ +D G Y C     Q + +  FT+ V   P +IN+P D   A     I  C+  G+P+P++ W  NG+ +    + D  H   L    L LNN+   D +V+QC A N +G +  NAF+ V    P +L    +    V K NV ++C AF  P P I W  D  + NL   +++SM  NG L I  +   D G+Y C ASN  G     + + +R  TKII+    +  + G     +C    D +  + + I+W K  NE+ +   +    I    L + ++   D G Y C A   +D      EL V   PE   D+++   + ++     LTW  G  NN+ I   I E+    ++P  W  +  V+ + F            N  + + PY+ Y FR+ +VN++G S  S     N   R E P      NP +V   GT P  + I WK +  ++ NGP   Y +  R             Q+    WK     S  VL + TS        I++ YE+ +QS N +G +T  P    G SGE  P I P N+ ++A+ + ++K+ W  + +N L   NG  +G+ + +                                     TR N   +      ++G    A +TG+   +   +   IIN +  G  SE   I+T EG P P +   +E      + + W  P   NGILTGY+I   +    +++G    +  I DP Q    +S++ S+  Y   ++A T  G+ +   +   T  E +   ++ + IE
Sbjct:   32 VMQEIMYPPVITEQSPEKYVLYPNDD-IVLKCEAKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSGTLNISGNGNSMKDFQGKYRCYATNDLGTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIWMN----SNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPTN-SVKFRKPEMMLPEGSMSTVLALRDQPLQLECIAEGLPTPEIEWIPLLGSTY----NERIQFDDFKKTLHIDKVQDEDDGDYQCIAKNTQGSSSHTFTVVVESAPYWINKPEDGIYAPGEDIILHCEVGGKPKPKVTWKINGKSLK---DSDLYHNWKLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANAFVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTIQWESDLED-NLFALDQFSMHTNGTLTITGVAKEDEGIYRCTASNNQGNVSISAYLDVRNATKIITPPMEQHARKGGKAIFQCKVEFDPKMSDKI-IQWRKNGNEIKEDADNDKYFIEDYTLSISNVQESDHGMYTCAAHTELDAVELTAELVVIDLPEAPFDLELSNAQETS---ITLTWTPGNDNNSPIEEFIIEYEEDSFEPGVWHELTRVDGDMF------------NVDLDLSPYVNYQFRVIAVNEVGPSNGS-----NPSDRYETPAFAPAKNPREVKGEGTEPQNMYISWKPLKGIDWNGPGFKYLVKWR-------------QLGKEEWKEVVADSPPVLVSGTS--------IFEPYEIIVQSVNDIGRATE-PKPVIGHSGEDMPDITPENVGLEAMNESAIKVAWLPVQKNGL---NGHLKGFMVYY-------------------------------------TRHNGHNRHPGKLLVHGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEI-YHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQEIEVPPVLNVSIE 1022          
BLAST of Neuroglian vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 318.161 bits (814), Expect = 4.600e-89
Identity = 289/1083 (26.69%), Postives = 463/1083 (42.75%), Query Frame = 3
Query:  132 FPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE---RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIH---LHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKK-NELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVN-ETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNI----NPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWK----TSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIE 3302
            +PP   +Q P+   LY  D  I+L C AK    A Y W K+G + +      +   +D G+L I     ++++ +G Y+C A N LG AISH+  +       +     R +D+    S IL C+ P    P  + W+N      L+   +D R  +  NGNL+ + +  +D+   Y C +     RT+ +     IK++P + S    KP + L   ++   + L    L     + G     + W   L         ER Q      TL I  ++ +D G Y C     Q + +  FT+ V   P +IN+P D   A     I  C+  G+P+P++ W  NG+ +    + D  H   L    L LNN+   D +V+QC A N +G +  NAF+ V    P +L    +    V K NV ++C AF  P P I W  D  + NL   +++SM  NG L I  +   D G+Y C ASN  G     + + +R  TKII+    +  + G     +C    D +  + + I+W K  NE+ +   +    I    L + ++   D G Y C A   +D      EL V   PE   D+++   + ++     LTW  G  NN+ I   I E+    ++P  W  +  V+ + F            N  + + PY+ Y FR+ +VN++G S  S     N   R E P      NP +V   GT P  + I WK +  ++ NGP   Y +  R             Q+    WK     S  VL + TS        I++ YE+ +QS N +G +T  P    G SGE  P I P N+ ++A+ + ++K+ W  + +N L   NG  +G+ + +                                     TR N   +      ++G    A +TG+   +   +   IIN +  G  SE   I+T EG P P +   +E      + + W  P   NGILTGY+I   +    +++G    +  I DP Q    +S++ S+  Y   ++A T  G+ +   +   T  E +   ++ + IE
Sbjct:   33 YPPVITEQSPEKYVLYPNDD-IVLKCEAKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSGTLNISGNGNSMKDFQGKYRCYATNDLGTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIWMN----SNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPTN-SVKFRKPEMMLPEGSMSTVLALRDQPLQLECIAEGLPTPEIEWIPLLGSTY----NERIQFDDFKKTLHIDKVQDEDDGDYQCIAKNTQGSSSHTFTVVVESAPYWINKPEDGIYAPGEDIILHCEVGGKPKPKVTWKINGKSLK---DSDLYHNWKLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANAFVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTIQWESDLED-NLFALDQFSMHTNGTLTITGVAKEDEGIYRCTASNNQGNVSISAYLDVRNATKIITPPMEQHARKGGKAIFQCKVEFDPKMSDKI-IQWRKNGNEIKEDADNDKYFIEDYTLSISNVQESDHGMYTCAAHTELDAVELTAELVVIDLPEAPFDLELSNAQETS---ITLTWTPGNDNNSPIEEFIIEYEEDSFEPGVWHELTRVDGDMF------------NVDLDLSPYVNYQFRVIAVNEVGPSNGS-----NPSDRYETPAFAPAKNPREVKGEGTEPQNMYISWKPLKGIDWNGPGFKYLVKWR-------------QLGKEEWKEVVADSPPVLVSGTS--------IFEPYEIIVQSVNDIGRATE-PKPVIGHSGEDMPDITPENVGLEAMNESAIKVAWLPVQKNGL---NGHLKGFMVYY-------------------------------------TRHNGHNRHPGKLLVHGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEI-YHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQEIEVPPVLNVSIE 1017          
BLAST of Neuroglian vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 318.161 bits (814), Expect = 5.743e-89
Identity = 291/1095 (26.58%), Postives = 465/1095 (42.47%), Query Frame = 3
Query:  114 MFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE---RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPD------SISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIH---LHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKK-NELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVN-ETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNI----NPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWK----TSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIE 3302
            +  E  +PP   +Q P+   LY  D  I+L C AK    A Y W K+G + +      +   +D G+L I     ++++ +G Y+C A N LG AISH+  +       +     R +D+    S IL C+ P    P  + W+N      L+   +D R  +  NGNL+ + +  +D+   Y C +     RT+ +     IK++P       S S    KP + L   ++   + L    L     + G     + W   L         ER Q      TL I  ++ +D G Y C     Q + +  FT+ V   P +IN+P D   A     I  C+  G+P+P++ W  NG+ +    + D  H   L    L LNN+   D +V+QC A N +G +  NAF+ V    P +L    +    V K NV ++C AF  P P I W  D  + NL   +++SM  NG L I  +   D G+Y C ASN  G     + + +R  TKII+    +  + G     +C    D +  + + I+W K  NE+ +   +    I    L + ++   D G Y C A   +D      EL V   PE   D+++   + ++     LTW  G  NN+ I   I E+    ++P  W  +  V+ + F            N  + + PY+ Y FR+ +VN++G S  S     N   R E P      NP +V   GT P  + I WK +  ++ NGP   Y +  R             Q+    WK     S  VL + TS        I++ YE+ +QS N +G +T  P    G SGE  P I P N+ ++A+ + ++K+ W  + +N L   NG  +G+ + +                                     TR N   +      ++G    A +TG+   +   +   IIN +  G  SE   I+T EG P P +   +E      + + W  P   NGILTGY+I   +    +++G    +  I DP Q    +S++ S+  Y   ++A T  G+ +   +   T  E +   ++ + IE
Sbjct:   32 VMQEIMYPPVITEQSPEKYVLYPNDD-IVLKCEAKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSGTLNISGNGNSMKDFQGKYRCYATNDLGTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIWMN----SNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPSNNAAMFSNSVKFRKPEMMLPEGSMSTVLALRDQPLQLECIAEGLPTPEIEWIPLLGSTY----NERIQFDDFKKTLHIDKVQDEDDGDYQCIAKNTQGSSSHTFTVVVESAPYWINKPEDGIYAPGEDIILHCEVGGKPKPKVTWKINGKSLK---DSDLYHNWKLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANAFVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTIQWESDLED-NLFALDQFSMHTNGTLTITGVAKEDEGIYRCTASNNQGNVSISAYLDVRNATKIITPPMEQHARKGGKAIFQCKVEFDPKMSDKI-IQWRKNGNEIKEDADNDKYFIEDYTLSISNVQESDHGMYTCAAHTELDAVELTAELVVIDLPEAPFDLELSNAQETS---ITLTWTPGNDNNSPIEEFIIEYEEDSFEPGVWHELTRVDGDMF------------NVDLDLSPYVNYQFRVIAVNEVGPSNGS-----NPSDRYETPAFAPAKNPREVKGEGTEPQNMYISWKPLKGIDWNGPGFKYLVKWR-------------QLGKEEWKEVVADSPPVLVSGTS--------IFEPYEIIVQSVNDIGRATE-PKPVIGHSGEDMPDITPENVGLEAMNESAIKVAWLPVQKNGL---NGHLKGFMVYY-------------------------------------TRHNGHNRHPGKLLVHGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEI-YHQIVNKTHTGAKYFSETINDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQEIEVPPVLNVSIE 1029          
BLAST of Neuroglian vs. Ensembl Xenopus
Match: l1cam (L1 cell adhesion molecule [Source:NCBI gene;Acc:100124734])

HSP 1 Score: 316.62 bits (810), Expect = 8.021e-89
Identity = 289/1081 (26.73%), Postives = 454/1081 (42.00%), Query Frame = 3
Query:  132 FPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE---RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKK-NELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE---PVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVN-ETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNI----NPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWK----TSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKI 3299
            +PP   +Q P+   LY  D  I+L C AK    A Y W K+G + +      +   +D G+L I     ++++ +G Y+C A N LG AISH+  +       +     R +D+    S IL C+ P    P  + W+N      L+   +D R  +  NGNL+ + +  +D+   Y C +     RT+ +     IK++P    S     ++    S      L +  + L CI        + W   L         ER Q      TL I  ++ +D G Y C     Q + +  FT+ V   P +IN+P D   A     I  C+  G+P+P++ W  N    G+ L G+  HL    L LNN+   D +V+QC A N +G +  NAF+ V    P +L    +    V K NV ++C AF  P P I   +     NL   +++SM  NG L I  +   D G+Y C ASN  G     + + +R  TKII+    +  + G     +C    D +  + + I+W K  NE+ +   +    I    L + ++   D G Y C A   +D      EL V G+     PVS   ++        +  LTW  G  NN+ I   IF +    ++P  W  +  V+ + F            N  + + PY+ Y FR+ +VN++G S  S     N   R E P      NP +V   GT P  + I WK +  ++ NGP   Y +  R             Q+    WK     S  VL + TS        I++ YE+ +QS N +G +T  P    G SGE  P I P N+ ++A+ + ++K+ W  + +N L   NG  +G+ + +                                     TR N   +      ++G    A +TG+   +   +   IIN +  G  SE   I+T EG P P +   +E      + + W  P   NGILTGY+I  +    FS +        I DP Q    +S++ S+  Y   ++A T  G+ +   +   T  E  E+    +K+
Sbjct:   31 YPPVITEQSPEKYVLYPNDD-IVLKCEAKRNAKAKYTWKKDGETFQPDNDPRVSRKKDSGTLNISGNGNSMKDFQGKYRCYATNDLGTAISHEIHVITESTPKWQKELIRPLDIEEGASLILPCNPPKSAVPPRVIWMN----SNLLHITQDERVSMGVNGNLYFSNVQKQDEHPDYICHAQFVGARTIVQKEAISIKVRPSKGRS-----VLRYSGSMSTVLALRDQPLQLECIAEGLPTPEIEWIPLLGSTY----NERIQFDDFKKTLHIDKVQDEDDGDYQCIAKNTQGSSSHTFTVVVESAPYWINKPEDGIYAPGEDIILHCEVGGKPKPKVTWKIN----GKSLKGE-FHLIDGSLVLNNMQLNDTSVVQCEARNKHGNLLANAFVYVVELPPQILTRNDEQYIVVEKTNVSMDCRAFGTPFPTI---QCDLEDNLFALDQFSMHTNGTLTITGVAKEDEGIYRCTASNNQGNVSISAYLDVRNATKIITPPMEQHARKGGKAIFQCKVEFDPKMSDKI-IQWRKNGNEIKEDADNDKYFIEDYTLSISNVQESDHGMYTCAAHTELDAVELTAELVVIGENSLMCPVSPFDLELSNAQETSIT-LTWTPGNDNNSPIEGRIFYWPEDSFEPGVWHELTRVDGDMF------------NVDLDLSPYVNYQFRVIAVNEVGPSNGS-----NPSDRYETPAFAPAKNPREVKGEGTEPQNMYISWKPLKGIDWNGPGFKYLVKWR-------------QLGKEEWKEVVADSPPVLVSGTS--------IFEPYEIIVQSVNDIGRATE-PKPVIGHSGEDMPDITPENVGLEAMNESAIKVAWLPVQKNGL---NGHLKGFMVYY-------------------------------------TRHNGHNRHPGKLLVHGNTTHALITGLKPYSNYSVEVAIINGKGEGEHSESRMIRTDEGVPSPPSFLRLERQSDTSLTLIWGPPETPNGILTGYEIYHQIAKYFSET--------INDPTQQNWTLSNISSKDTYRFYLYATTSVGQSEAVMVEGSTMQEIGETIPTHIKL 1000          
BLAST of Neuroglian vs. Ensembl Mouse
Match: Chl1 (cell adhesion molecule L1-like [Source:MGI Symbol;Acc:MGI:1098266])

HSP 1 Score: 308.145 bits (788), Expect = 6.052e-86
Identity = 255/1041 (24.50%), Postives = 456/1041 (43.80%), Query Frame = 3
Query:  168 EFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE----NLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNH-KIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            +  +  D    + C AK  P   + W K+    +     +I   + G+ +I  E  I   +G Y+C A N LG A+S + E  +  +  +   K   IDV    S +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + + D    Y C +    LRT+ +    K+ +   S S    KP + L  + + +          + +   F+ G      Q  K     P+ R        TL+I NI  +D G Y C         +  F + V E P +  +P     +  SS I  C+A GEP+P I+W  NG  I ++   GD   +   ++   NL      V QC ASNI+G +  NA I+V +  PL+    ++    V+  +  ++C  F+ P   ++W   +   + +  ++Y   +NG L I      DAG Y C   N  G+    + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y+C+A   +D    K ++ V G P+P  ++ +  ++   +R   L+W  G  +N++I+ +I EF   + +P  W  +  V      ++           +++ PY++Y FR+ +VN++G S  +S+  ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y ++ +        +  +++ +I +  T R++              +Y  Y+V +Q+ N +G S+  P     +SGE YP+  P   R+D +    VK+ WS I +     ++G  RGY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P   +   +  ++ +   ++W  P   NG LTGY +   ++ + ++       E N   +  P +    +S+L S TKY   + A T +G GK
Sbjct:   44 QVAFPFDEYFQIECEAKGNPEPIFSWTKDDKPFDLSDPRIIAANNSGTFKIPNEGHISHFQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQRGDLYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVN-SSNSIKQRKPKLLLPPAQMGSLSAKTVLKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGILLCEAEGEPQPTIKWRLNGLPIEKHPFPGD--FMFPREISFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVVGYSAFLHCEYFASPKATVVWEV-ADETHPLEGDRYHTHENGTLEIYRTTEEDAGSYSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDSTSEKTQVTVLGVPDPPGNLHLSERQ---NRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWEELTRVQGEETDVV-----------LSLAPYVRYQFRVTAVNEVGRSH-ASLPSDHHETPPAAPDKNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYKVSWKPQG-----APEEWEEEIVTNHTLRVMTPT-----------VYAPYDVKVQAINQLG-SSPDPQPVTLYSGEDYPSTAPVIQRVDVMNSTLVKVTWSSIPKET---VHGLLRGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDPFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEL-----GELNEINVTTPSKSSWHLSNLNSTTKYKFYLRACTSRGCGK 1003          
BLAST of Neuroglian vs. Ensembl Mouse
Match: Chl1 (cell adhesion molecule L1-like [Source:MGI Symbol;Acc:MGI:1098266])

HSP 1 Score: 308.145 bits (788), Expect = 6.052e-86
Identity = 255/1041 (24.50%), Postives = 456/1041 (43.80%), Query Frame = 3
Query:  168 EFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE----NLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNH-KIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            +  +  D    + C AK  P   + W K+    +     +I   + G+ +I  E  I   +G Y+C A N LG A+S + E  +  +  +   K   IDV    S +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + + D    Y C +    LRT+ +    K+ +   S S    KP + L  + + +          + +   F+ G      Q  K     P+ R        TL+I NI  +D G Y C         +  F + V E P +  +P     +  SS I  C+A GEP+P I+W  NG  I ++   GD   +   ++   NL      V QC ASNI+G +  NA I+V +  PL+    ++    V+  +  ++C  F+ P   ++W   +   + +  ++Y   +NG L I      DAG Y C   N  G+    + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y+C+A   +D    K ++ V G P+P  ++ +  ++   +R   L+W  G  +N++I+ +I EF   + +P  W  +  V      ++           +++ PY++Y FR+ +VN++G S  +S+  ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y ++ +        +  +++ +I +  T R++              +Y  Y+V +Q+ N +G S+  P     +SGE YP+  P   R+D +    VK+ WS I +     ++G  RGY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P   +   +  ++ +   ++W  P   NG LTGY +   ++ + ++       E N   +  P +    +S+L S TKY   + A T +G GK
Sbjct:   44 QVAFPFDEYFQIECEAKGNPEPIFSWTKDDKPFDLSDPRIIAANNSGTFKIPNEGHISHFQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQRGDLYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVN-SSNSIKQRKPKLLLPPAQMGSLSAKTVLKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGILLCEAEGEPQPTIKWRLNGLPIEKHPFPGD--FMFPREISFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVVGYSAFLHCEYFASPKATVVWEV-ADETHPLEGDRYHTHENGTLEIYRTTEEDAGSYSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDSTSEKTQVTVLGVPDPPGNLHLSERQ---NRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWEELTRVQGEETDVV-----------LSLAPYVRYQFRVTAVNEVGRSH-ASLPSDHHETPPAAPDKNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYKVSWKPQG-----APEEWEEEIVTNHTLRVMTPT-----------VYAPYDVKVQAINQLG-SSPDPQPVTLYSGEDYPSTAPVIQRVDVMNSTLVKVTWSSIPKET---VHGLLRGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDPFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEL-----GELNEINVTTPSKSSWHLSNLNSTTKYKFYLRACTSRGCGK 1003          
BLAST of Neuroglian vs. Ensembl Mouse
Match: Chl1 (cell adhesion molecule L1-like [Source:MGI Symbol;Acc:MGI:1098266])

HSP 1 Score: 306.22 bits (783), Expect = 1.427e-85
Identity = 260/1069 (24.32%), Postives = 462/1069 (43.22%), Query Frame = 3
Query:  168 EFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE----NLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKI-----KPDSISSHLL----------KPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNH-KIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESK 3272
            +  +  D    + C AK  P   + W K+    +     +I   + G+ +I  E  I   +G Y+C A N LG A+S + E  +  +  +   K   IDV    S +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + + D    Y C +    LRT+ +    K+ +       DS SS  +          KP + L  + + +          + +   F+ G      Q  K     P+ R        TL+I NI  +D G Y C         +  F + V E P +  +P     +  SS I  C+A GEP+P I+W  NG  I ++   GD   +   ++   NL      V QC ASNI+G +  NA I+V +  PL+    ++    V+  +  ++C  F+ P   ++W   +   + +  ++Y   +NG L I      DAG Y C   N  G+    + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y+C+A   +D    K ++ V G P+P  ++ +  ++   +R   L+W  G  +N++I+ +I EF   + +P  W  +  V      ++           +++ PY++Y FR+ +VN++G S  +S+  ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y ++ +        +  +++ +I +  T R++              +Y  Y+V +Q+ N +G S+  P     +SGE YP+  P   R+D +    VK+ WS I +     ++G  RGY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P   +   +  ++ +   ++W  P   NG LTGY +   ++ + ++       E N   +  P +    +S+L S TKY   + A T +G GK       T  E K
Sbjct:   44 QVAFPFDEYFQIECEAKGNPEPIFSWTKDDKPFDLSDPRIIAANNSGTFKIPNEGHISHFQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQRGDLYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVNSLKHASDSSSSTEICSQANSIKQRKPKLLLPPAQMGSLSAKTVLKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGILLCEAEGEPQPTIKWRLNGLPIEKHPFPGD--FMFPREISFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVVGYSAFLHCEYFASPKATVVWEV-ADETHPLEGDRYHTHENGTLEIYRTTEEDAGSYSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDSTSEKTQVTVLGVPDPPGNLHLSERQ---NRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWEELTRVQGEETDVV-----------LSLAPYVRYQFRVTAVNEVGRSH-ASLPSDHHETPPAAPDKNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYKVSWKPQG-----APEEWEEEIVTNHTLRVMTPT-----------VYAPYDVKVQAINQLG-SSPDPQPVTLYSGEDYPSTAPVIQRVDVMNSTLVKVTWSSIPKET---VHGLLRGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDPFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEL-----GELNEINVTTPSKSSWHLSNLNSTTKYKFYLRACTSRGCGKPISEEGATLGEGK 1032          
BLAST of Neuroglian vs. Ensembl Mouse
Match: Nfasc (neurofascin [Source:MGI Symbol;Acc:MGI:104753])

HSP 1 Score: 296.204 bits (757), Expect = 3.064e-82
Identity = 254/1048 (24.24%), Postives = 456/1048 (43.51%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKP-KERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFIT-QYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            PP+  +Q  K   +   D  I++ C AK  P+ ++ W +N           + + +  G+L I+        E EG YQC A N  G A+S++  L+++    +       + V       L+C+ P   P   I W++      +    +D R    +NG+L+ + ++ +D    YSC +  +F  T+++     +K+      +      +    ++    VL    +LL CI S      + W++   K  ++   K +F+   K   L I+N+  +D+G+Y C    +  ++    ++ V   P ++++P +  +A        C+A+G P+P ++W  NG+ +          + G+ +   +       V QCN SN +GY+  NAF++V +  P +L    + I+ +L    +++C  F  P P + W K+    NL   N Y + +NG+L IK +   D G+Y C+A+NI G+ +N+  + +++PT+I  +  ++  + G  V LEC  + D      L + W K +E L +   +        L +  +  RD G Y C AS  +D DL K  L V G+P+   D+++ D       R   LTW+ G  NN+ IT ++ +F   Q+ P  W      +  F   +       N+  + + PY+ Y FR+ +VN++G+S P S+     +     P  NP DV   GT  N + I W  +   +  GPNL Y +  R  +      T +    +T W +  +V           +  +Y  YE+ +Q++N  G     P    G+SGE YP   P+ ++I  +   ++ LQW+ +Y +    + G  R YR  +    +  +   + +  Q        PR +  RL  P + +              ++ M  + G                +  GP+SE     T EG P     F +    +  I + W  P   NGIL GY   +     F+ +   ++  +   P+Q +  +      ++Y  S+ A T+ G G+
Sbjct:   34 PPTITKQSVKDHIVDPRDN-ILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSS----MEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTSSSQMVLRGMDLLLECIASGVPTPDIAWYK---KGGDLPSNKAKFENFNKA--LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSARNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGN-YHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQLECRVKHD--PSLKLTVSWLKDDEPLYI--GNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQDLAKAYLTVLGRPDRPRDLELTDLA----ERSVRLTWIPGDDNNSPITDYVVQFEEDQFQPGVWH----DHSRFPGSV-------NSAVLHLSPYVNYQFRVIAVNEVGSSHP-SLPSERYRTSGAPPESNPSDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRE------TRETWNNVTVWGSRYVV----------GQTPVYVPYEIRVQAENDFG-KGPEPDTIIGYSGEDYPRAAPTEVKIRVLNSTAISLQWNRVYSDT---VQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRPRGVVARLF-PYSNY--------------KLEMVVVNG----------------RGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGILIGY---ILRYVPFNGTKLGKQMVENFSPNQTKFSVQRADPVSRYRFSLSARTQVGSGE 996          

HSP 2 Score: 55.8398 bits (133), Expect = 4.920e-7
Identity = 85/412 (20.63%), Postives = 154/412 (37.38%), Query Frame = 3
Query:   87 FTINMLNLLMFSEASFPPSFIQQPPKGEFLYQM---DTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDE--GSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG---SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEP--RPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNR 1292
            FT+ +L     +E +  PSF+   P+G    QM      ++L C A  +P+ +  W K G  + +     +    +LRI     E+ G Y C+A N +G +I H   +R+     +  L E    +   G       R N  P  ++QW+ V       +    NR V  +      T+I       +Y C ++N     +     + + + P  +S+      + LY               L C F      ++RWF+  +          +     G +LEI  I ++D G Y C           +  + V +       P D+     ++   EC+   +P  +  + W  + + +  Y+ G+R+    + L +  +  +D     C AS         A++ V  R
Sbjct:  223 FTLKVLTTRGVAERT--PSFMY--PQGTSSSQMVLRGMDLLLECIASGVPTPDIAWYKKGGDLPSNKAKFENFNKALRITNVSEEDSGEYFCLASNKMG-SIRHTISVRVKAAPYW--LDEPKNLILAPGEDGRLVCRANGNPKPTVQWM-VNGEPLQSAPPNPNREVAGDTIIFRDTQISSR---AVYQCNTSNEHGYLLANAFVSVLDVPPRMLSARNQLIRVILY-----------NRTRLDCPFFGSPIPTLRWFK--NGQGSNLDGGNYHVYENG-SLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQLECRVKHDPSLKLTVSWLKDDEPL--YI-GNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQDLAKAYLTVLGR 606          
BLAST of Neuroglian vs. Ensembl Mouse
Match: Nfasc (neurofascin [Source:MGI Symbol;Acc:MGI:104753])

HSP 1 Score: 292.738 bits (748), Expect = 5.190e-81
Identity = 253/1065 (23.76%), Postives = 456/1065 (42.82%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGA-------------DTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXX----XCIFS---RGSVRWFRQLDKNAEIKP-KERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFIT-QYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            PP+  +Q  K   +   D  I++ C AK  P+ ++ W +N           + + +  G+L I+        E EG YQC A N  G A+S++  L+++    +       + V       L+C+ P   P   I W++      +    +D R    +NG+L+ + ++ +D    YSC +  +F  T+++               D+ ++  PD  S+  +      +      +        +     CI S      + W++   K  ++   K +F+   K   L I+N+  +D+G+Y C    +  ++    ++ V   P ++++P +  +A        C+A+G P+P ++W  NG+ +          + G+ +   +       V QCN SN +GY+  NAF++V +  P +L    + I+ +L    +++C  F  P P + W K+    NL   N Y + +NG+L IK +   D G+Y C+A+NI G+ +N+  + +++PT+I  +  ++  + G  V LEC  + D      L + W K +E L +   +        L +  +  RD G Y C AS  +D DL K  L V G+P+   D+++ D       R   LTW+ G  NN+ IT ++ +F   Q+ P  W      +  F   +       N+  + + PY+ Y FR+ +VN++G+S P S+     +     P  NP DV   GT  N + I W  +   +  GPNL Y +  R  +      T +    +T W +  +V           +  +Y  YE+ +Q++N  G     P    G+SGE YP   P+ ++I  +   ++ LQW+ +Y +    + G  R YR  +    +  +   + +  Q        PR +  RL  P + +              ++ M  + G                +  GP+SE     T EG P     F +    +  I + W  P   NGIL GY   +     F+ +   ++  +   P+Q +  +      ++Y  S+ A T+ G G+
Sbjct:   34 PPTITKQSVKDHIVDPRDN-ILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMSSS----MEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTNNPYNDSSLRNHPDIYSARGVAERTPSFMYPQGTSSSQMVLRGMDLLLECIASGVPTPDIAWYK---KGGDLPSNKAKFENFNKA--LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSARNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGN-YHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVAKRGTTVQLECRVKHD--PSLKLTVSWLKDDEPLYI--GNRMKKEDDSLTIFGVAERDQGSYTCMASTELDQDLAKAYLTVLGRPDRPRDLELTDLA----ERSVRLTWIPGDDNNSPITDYVVQFEEDQFQPGVWH----DHSRFPGSV-------NSAVLHLSPYVNYQFRVIAVNEVGSSHP-SLPSERYRTSGAPPESNPSDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRE------TRETWNNVTVWGSRYVV----------GQTPVYVPYEIRVQAENDFG-KGPEPDTIIGYSGEDYPRAAPTEVKIRVLNSTAISLQWNRVYSDT---VQGQLREYRAYYWRESSLLKNLWVSQKRQQASFPGDRPRGVVARLF-PYSNY--------------KLEMVVVNG----------------RGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGILIGY---ILRYVPFNGTKLGKQMVENFSPNQTKFSVQRADPVSRYRFSLSARTQVGSGE 1013          
BLAST of Neuroglian vs. UniProt/SwissProt
Match: sp|P20241|NRG_DROME (Neuroglian OS=Drosophila melanogaster OX=7227 GN=Nrg PE=1 SV=2)

HSP 1 Score: 351.673 bits (901), Expect = 2.019e-99
Identity = 282/1066 (26.45%), Postives = 466/1066 (43.71%), Query Frame = 3
Query:  120 SEASFPPSFIQQPPKGEFLYQM-------DTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQ-DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGE--IYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLK-PLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEE-QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECS-ARTDIQEGENLKIEWWKKNELL------KVVKSHSAAI-LSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDH-SVKLQWSIIYENQLSRINGFFRGYRIE-WCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKE 3236
            S+ + PP   +QP  GE L+++       D   I+ C A   P   Y W+KNG      + +N ++ Q   G+L I     E+ G YQC A N  G A S+   +R A ++++     +T++       +L+C  P+ +P  ++ W+  +     I    ++R  LD  GNL  + +  ED      Y+C +T+ F    K G    + +K   +S+   K P +  Y S  ++  L    + L CI+    +           I+  +R      G +L I      DAG Y C+      N  +    +NV   P F  +P   T A +   +FEC+A+G P P+I W  NG+ I +     R  +  N + + NL   D     CNA+N  GYVY + ++NV    P +   P   +  V   NV I C     P P + W + S   N +   +Y++  NG+L I+++  +DAG Y C A N FG+ + + +++++E T+I     N     G   T  C+ A  D  E   ++I+WWK  + +      + VK++  ++ ++  ++L      DSG Y C A   +D    +  L V+  P       + C+       A + W     N + I  +  +F T + P +W      +  ++ +  PN    ++  V + P+  Y FR+ + NK+G S PS+ + ++C  + + P  NPD+V   GT PN L I W  +P + HN PN  Y+++ +  D    P+ +     I  W+ + IV+++  +         + +Y + + + N  G S V   +  G+SGE  P   P+N  +  IT   S  + W+ + E     + G F+GY+I+ W  NE    L +I                                       + G  H A +T     +         N ++ GP S  +   T EG P PV   +   +  +   + W KPL  NG LTGY I  +E  +       E +  I DP   R +++ LK  +KY ISI A TK G+G E
Sbjct:   23 SKGNRPPRITKQPAPGELLFKVAQQNKESDNPFIIECEADGQPEPEYSWIKNGKKFDWQAYDNRMLRQPGRGTLVITIPKDEDRGHYQCFASNEFGTATSNSVYVRKAELNAFKDEAAKTLEAVEGEPFMLKCAAPDGFPSPTVNWMIQESIDGSIKSINNSRMTLDPEGNLWFSNVTREDASSDFYYACSATSVFRSEYKIGNKVLLDVKQMGVSASQNKHPPVRQYVSRRQSLALRGKRMELFCIYGGTPLPQTVWSKDGQRIQWSDRITQGHYGKSLVIRQTNFDDAGTYTCDVSNGVGNAQSFSIILNVNSVPYFTKEPEIATAAEDEEVVFECRAAGVPEPKISWIHNGKPIEQSTPNPRRTVTDNTIRIINLVKGDTGNYGCNATNSLGYVYKDVYLNVQAEPPTISEAPAA-VSTVDGRNVTIKCRVNGSPKPLVKWLRAS---NWLTGGRYNVQANGDLEIQDVTFSDAGKYTCYAQNKFGEIQADGSLVVKEHTRITQEPQNYEVAAGQSATFRCNEAHDDTLE---IEIDWWKDGQSIDFEAQPRFVKTNDNSLTIAKTMEL------DSGEYTCVARTRLDEATARANLIVQDVPNAPKLTGITCQA----DKAEIHWEQQGDNRSPILHYTIQFNTSFTPASW------DAAYEKV--PN--TDSSFVVQMSPWANYTFRVIAFNKIGASPPSAHS-DSCTTQPDVPFKNPDNVVGQGTEPNNLVISWTPMPEIEHNAPNFHYYVSWK-RDI---PAAAWENNNIFDWRQNNIVIADQPT---------FVKYLIKVVAINDRGESNVAAEEVVGYSGEDRPLDAPTNFTMRQITSSTSGYMAWTPVSEES---VRGHFKGYKIQTWTENEGEEGLREIH--------------------------------------VKGDTHNALVTQFKPDSKNYARILAYNGRFNGPPSAVIDFDTPEGVPSPVQGLDAYPLGSSAFMLHWKKPLYPNGKLTGYKIYYEEVKESYVGERREYDPHITDPRVTRMKMAGLKPNSKYRISITATTKMGEGSE 1006          
BLAST of Neuroglian vs. UniProt/SwissProt
Match: sp|O00533|NCHL1_HUMAN (Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4)

HSP 1 Score: 321.242 bits (822), Expect = 1.539e-89
Identity = 273/1087 (25.11%), Postives = 471/1087 (43.33%), Query Frame = 3
Query:   57 MQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPP------KGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI----ENLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            M+P LL        M  LL FS+A   PS +QQ P      K +  +  D    + C AK  P   + W K+G+        +I + + G+ RI  E  I   +G Y+C A N LG A+S + E  +  +  +   K   ++V      +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + ++D    Y C +    LRT+ +    K+ +   S S    KP + L  +   +   +        +   F+ G     V W    +K     PK R      G TL+I N+  +D G Y C       T    F + V E P +  +P     +  S+ I  C+A GEP+P I+W  NG  +  +   GD +     ++   NL      V QC ASN++G +  NA I+V + +PL+     +    V+  +  ++C  F+ P   + W+K    +  +   +Y + +NG L I      DAG Y C   N  G+T   + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y C+A   +D      ++ V   P+P  ++ +  ++   +R   LTW  G  +N+ I+ +I EF   + +P  W  +  V     T+I P           + P+++Y FR+ +VN++G SQPS  + ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y +T       + P  +  +     W+   +    +    ++    +Y  Y+V +Q+ N +G S   P     +SGE YP   P    +D I    VK+ WS + ++   R++G  +GY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P       +  ++ +   ++W  P   NG LTGY +   ++ + ++     +      I  P +    +S+L + TKY   + A T QG GK
Sbjct:    1 MEPLLLGRGLIVYLMFLLLKFSKAIEIPSSVQQVPTIIKQSKVQVAFPFDEYFQIECEAKGNPEPTFSWTKDGNPFYFTDHRIIPSNNSGTFRIPNEGHISHFQGKYRCFASNKLGIAMSEEIEFIVPSVPKFPKEKIDPLEVEEGDPIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQKGDLYFANVEEKDSRNDYCCFAAFPRLRTIVQKMPMKLTVN-SSNSIKQRKPKLLLPPTESGSESSITILKGEILLLECFAEGLPTPQVDW----NKIGGDLPKGRETKENYGKTLKIENVSYQDKGNYRCTASNFLGTATHDFHVIVEEPPRWTKKPQSAVYSTGSNGILLCEAEGEPQPTIKWRVNGSPVDNHPFAGDVVFPR--EISFTNLQPNHTAVYQCEASNVHGTILANANIDVVDVRPLIQTKDGENYATVVGYSAFLHCEFFASPEAVVSWQKVE-EVKPLEGRRYHIYENGTLQINRTTEEDAGSYSCWVENAIGKTAVTANLDIRNATKLRVSPKNPRIPKLHMLELHCESKCDSHLKHSLKLSWSKDGEAFEINGTEDGRIIIDGANLTISNVTLEDQGIYCCSAHTALDSAADITQVTVLDVPDPPENLHLSERQ---NRSVRLTWEAGADHNSNISEYIVEFEGNKEEPGRWEELTRVQGKKTTVILP-----------LAPFVRYQFRVIAVNEVGRSQPSQPS-DHHETPPAAPDRNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYRVT-------WKPQGAPVE-----WEEETVTNHTL----RVMTPAVYAPYDVKVQAINQLG-SGPDPQSVTLYSGEDYPDTAPVIHGVDVINSTLVKVTWSTVPKD---RVHGRLKGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDAFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPTFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEIGELNDI----NITTPSKPSWHLSNLNATTKYKFYLRACTSQGCGK 1003          
BLAST of Neuroglian vs. UniProt/SwissProt
Match: sp|P70232|NCHL1_MOUSE (Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2)

HSP 1 Score: 308.145 bits (788), Expect = 4.234e-85
Identity = 255/1041 (24.50%), Postives = 456/1041 (43.80%), Query Frame = 3
Query:  168 EFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE----NLIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY-LNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAIL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSI--YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---VVKENFQFSNSGNSEKNH-KIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            +  +  D    + C AK  P   + W K+    +     +I   + G+ +I  E  I   +G Y+C A N LG A+S + E  +  +  +   K   IDV    S +L C+ P   PP  I W+N++    L   E+D R  +   G+L+   + + D    Y C +    LRT+ +    K+ +   S S    KP + L  + + +          + +   F+ G      Q  K     P+ R        TL+I NI  +D G Y C         +  F + V E P +  +P     +  SS I  C+A GEP+P I+W  NG  I ++   GD   +   ++   NL      V QC ASNI+G +  NA I+V +  PL+    ++    V+  +  ++C  F+ P   ++W   +   + +  ++Y   +NG L I      DAG Y C   N  G+    + + IR  TK+     N R      + L C ++ D     +LK+ W K  E  ++  +    I+   + L + ++T  D G Y+C+A   +D    K ++ V G P+P  ++ +  ++   +R   L+W  G  +N++I+ +I EF   + +P  W  +  V      ++           +++ PY++Y FR+ +VN++G S  +S+  ++ +     P+ NP ++ +  + P  + IKW+ +  +  NGP L Y ++ +        +  +++ +I +  T R++              +Y  Y+V +Q+ N +G S+  P     +SGE YP+  P   R+D +    VK+ WS I +     ++G  RGY+I W   ++   L D + +          P+E++      + RF+ +    +  S+  + + H+  L                N +  GP+SE    QT EG P   +   +  ++ +   ++W  P   NG LTGY +   ++ + ++       E N   +  P +    +S+L S TKY   + A T +G GK
Sbjct:   44 QVAFPFDEYFQIECEAKGNPEPIFSWTKDDKPFDLSDPRIIAANNSGTFKIPNEGHISHFQGKYRCFASNRLGTAVSEEIEFIVPGVPKFPKEKIEPIDVEEGDSIVLPCNPPKGLPPLHIYWMNIE----LEHIEQDERVYMSQRGDLYFANVEENDSRNDYCCFAAFPKLRTIVQKMPMKLTVN-SSNSIKQRKPKLLLPPAQMGSLSAKTVLKGDTLLLECFAEGLPTPHIQWSKPGSELPEGRATIEVHEKTLKIENISYQDRGNYRCTANNLLGKASHDFHVTVEEPPRWKKKPQSAVYSTGSSGILLCEAEGEPQPTIKWRLNGLPIEKHPFPGD--FMFPREISFTNLLPNHTGVYQCEASNIHGTILANANIDVIDVIPLIKTKNEENYATVVGYSAFLHCEYFASPKATVVWEV-ADETHPLEGDRYHTHENGTLEIYRTTEEDAGSYSCWVDNAMGKAVITANLDIRNATKLRVSPKNPRIPKSHVLELYCESQCDSHLKHSLKLSWSKDGEAFEMNGTEDGRIVIDGAYLTISNITAEDQGVYSCSAQTSLDSTSEKTQVTVLGVPDPPGNLHLSERQ---NRSVRLSWEAGDDHNSKISEYIVEFEGNREEPGKWEELTRVQGEETDVV-----------LSLAPYVRYQFRVTAVNEVGRSH-ASLPSDHHETPPAAPDKNPQNIRVQASQPKEMIIKWEPLKSMEQNGPGLEYKVSWKPQG-----APEEWEEEIVTNHTLRVMTPT-----------VYAPYDVKVQAINQLG-SSPDPQPVTLYSGEDYPSTAPVIQRVDVMNSTLVKVTWSSIPKET---VHGLLRGYQINWWKTKS---LLDGRTH----------PKEVN------ILRFSGQRNSGMVPSLDPFSEFHLTVLA--------------YNSKGAGPESEPYIFQTPEGVPEQPSFLKVIKVDKDTATLSWGLPKKLNGNLTGYLLQYQIINDTYEL-----GELNEINVTTPSKSSWHLSNLNSTTKYKFYLRACTSRGCGK 1003          
BLAST of Neuroglian vs. UniProt/SwissProt
Match: sp|P35331|NRCAM_CHICK (Neuronal cell adhesion molecule OS=Gallus gallus OX=9031 PE=1 SV=1)

HSP 1 Score: 288.886 bits (738), Expect = 1.741e-78
Identity = 254/1026 (24.76%), Postives = 437/1026 (42.59%), Query Frame = 3
Query:   78 LVNFTINMLNLL-------MFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSL--RIERAIREN--EGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKER--FQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQV----------EGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGY 3068
            LV F   M++ L       +  E S PP+  QQ PK +++      I++ C AK  P  ++ W +NG   +      + +  + G+L   I   ++    EG YQC A N  G AIS+   +R +    ++  K     V    S +L C  P   PP  I W++   + RL   E  ++ +   NG+L+ + +  ED    Y C +  N  +T+++     +K+      +     L+T   S      L    +LL CI +       R + +  E+ P  R  F+  +K  TL+I ++   D+G Y C       + +   ++ V   P +I  P +  ++        C+A+G P+P I W +NG  I          + G+ +  + +  +   V QCNASN YGY+  NAF+NV    P +L P  K  + +      I+C  F  P P I W +     +++  N+Y   DNG L I     +  G Y C+A N  G+T+NE  + +++PT II     K  Q     + EC  + D        + W K N  L         +    L + ++T +D G Y C  +  +D       L V            +P P  D+++  +     R   L+WV G  NN+ IT+ + E+    ++P  W     V  +  T+            + + PY+ Y+FR+ +VN++G SQPS  +      +   P+ NP +V   G+ P+ L I W+S+     NGP L Y ++ R  D D              W  + +V++N+ S   ++    +  YE+ +Q+ N +G++   P +  G SGE  P + P N+++  I     K+ W  +    L  + G  +GY++ +                              +++Q    R    V++ +  +  G      L G+   ++ ++  R++N +  GP S +   +T EG P P +   I    ++ + + W  P   NG+LT Y
Sbjct:   14 LVFFLCQMISALDVPLDSKLLEELSQPPTITQQSPK-DYIVDPRENIVIQCEAKGKPPPSFSWTRNGTHFDIDKDAQVTMKPNSGTLVVNIMNGVKAEAYEGVYQCTARNERGAAISNNIVIRPSRSPLWTKEKLEPNHVREGDSLVLNCRPPVGLPPPIIFWMD-NAFQRLPQSERVSQGL---NGDLYFSNVQPEDTRVDYICYARFNHTQTIQQKQPISVKVFSTKPVTERPPVLLTPMGSTSNKVELRGNVLLLECIAAGLPTPVIRWIKEGGEL-PANRTFFENFKK--TLKIIDVSEADSGNYKCTARNTLGSTHHVISVTVKAAPYWITAPRNLVLSPGEDGTLICRANGNPKPSISWLTNGVPIAIAPEDPSRKVDGDTIIFSAVQERSSAVYQCNASNEYGYLLANAFVNVLAEPPRILTPANKLYQVIADSPALIDCAYFGSPKPEIEWFR-GVKGSILRGNEYVFHDNGTLEIPVAQKDSTGTYTCVARNKLGKTQNEVQLEVKDPTMIIKQPQYKVIQRSAQASFECVIKHDPTLIPT--VIWLKDNNELP--DDERFLVGKDNLTIMNVTDKDDGTYTCIVNTTLDSVSASAVLTVVAAPPTPAIIYARPNPPLDLELTGQL---ERSIELSWVPGEENNSPITNFVIEYEDGLHEPGVWHYQTEVPGSHTTV-----------QLKLSPYVNYSFRVIAVNEIGRSQPSEPS-EQYLTKSANPDENPSNVQGIGSEPDNLVITWESLKGFQSNGPGLQYKVSWRQKDVD------------DEW--TSVVVANV-SKYIVSGTPTFVPYEIKVQALNDLGYAPE-PSEVIGHSGEDLPMVAPGNVQVHVINSTLAKVHWDPV---PLKSVRGHLQGYKVYY------------------------------WKVQSLSRRSKRHVEKKIL-TFRGNKTFGMLPGLEPYSSYKLNVRVVNGKGEGPASPDKVFKTPEGVPSPPSFLKITNPTLDSLTLEWGSPTHPNGVLTSY 961          
BLAST of Neuroglian vs. UniProt/SwissProt
Match: sp|O94856|NFASC_HUMAN (Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 SV=4)

HSP 1 Score: 286.96 bits (733), Expect = 9.409e-78
Identity = 256/1067 (23.99%), Postives = 465/1067 (43.58%), Query Frame = 3
Query:  123 EASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIE----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKP-KERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQV---------------EGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFIT-QYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            E + PP+  +Q  K   +   D  I++ C AK  P+ ++ W +N           + + +  G+L I+        E EG YQC A N  G A+S++  L+++    +       + V       L+C+ P   P   I W++      +    +D R    +NG+L+ + ++ +D    YSC +  +F  T+++     +K+      +      +    +     VL    +LL CI S      + W++   K  ++   K +F+   K   L I+N+  +D+G+Y C    +  ++    ++ V   P ++++P +  +A        C+A+G P+P ++W  NG+ +          + G+ +   +       V QCN SN +GY+  NAF++V +  P +L P  + I+ +L    +++C  F  P P + W K+    NL   N Y + +NG+L IK +   D G+Y C+A+NI G+ +N+  + +++PT+I  +  ++  + G  V LEC  + D      L + W K +E L +   +        L +  +  RD G Y C AS  +D DL K  L V               +G+P+   D+++ D       R   LTW+ G  NN+ IT ++ +F   Q+ P  W      +  +   +       N+  + + PY+ Y FR+ ++N++G+S P S+     +     P  NP DV   GT  N + I W  +   +  GPNL Y +  R  +      T +    +T W +  +V           +  +Y  YE+ +Q++N  G     P    G+SGE YP   P+ +++  +   ++ LQW+ +Y +    + G  R YR  +   E+S     + KN    + +    ++ S+    P  R    V R    S Y ++ M  + G                +  GP+SE     T EG P     F +    +  I + W  P   NGI+ GY +   +   F+ +   ++  +   P+Q +  +      ++Y  ++ A T+ G G+
Sbjct:   36 ELTQPPTITKQSAKDHIVDPRDN-ILIECEAKGNPAPSFHWTRNSRFFNIAKDPRVSMRRRSGTLVIDFRSGGRPEEYEGEYQCFARNKFGTALSNRIRLQVSKSPLWPKENLDPVVVQEGAPLTLQCNPPPGLPSPVIFWMS----SSMEPITQDKRVSQGHNGDLYFSNVMLQDMQTDYSCNARFHFTHTIQQKNPFTLKVLTTRGVAERTPSFMYPQGTASSQMVLRGMDLLLECIASGVPTPDIAWYK---KGGDLPSDKAKFENFNKA--LRITNVSEEDSGEYFCLASNKMGSIRHTISVRVKAAPYWLDEPKNLILAPGEDGRLVCRANGNPKPTVQWMVNGEPLQSAPPNPNREVAGDTIIFRDTQISSRAVYQCNTSNEHGYLLANAFVSVLDVPPRMLSPRNQLIRVILYNRTRLDCPFFGSPIPTLRWFKNGQGSNLDGGN-YHVYENGSLEIKMIRKEDQGIYTCVATNILGKAENQVRLEVKDPTRIYRMPEDQVARRGTTVQLECRVKHD--PSLKLTVSWLKDDEPLYI--GNRMKKEDDSLTIFGVAERDQGSYTCVASTELDQDLAKAYLTVLADQATPTNRLAALPKGRPDRPRDLELTDLA----ERSVRLTWIPGDANNSPITDYVVQFEEDQFQPGVWH----DHSKYPGSV-------NSAVLRLSPYVNYQFRVIAINEVGSSHP-SLPSERYRTSGAPPESNPGDVKGEGTRKNNMEITWTPMNATSAFGPNLRYIVKWRRRE------TREAWNNVTVWGSRYVV----------GQTPVYVPYEIRVQAENDFGKGPE-PESVIGYSGEDYPRAAPTEVKVRVMNSTAISLQWNRVYSDT---VQGQLREYRA-YYWRESS-----LLKN----LWVSQKRQQASF----PGDRLRGVVSRLFPYSNY-KLEMVVVNG----------------RGDGPRSETKEFTTPEGVPSAPRRFRVRQPNLETINLEWDHPEHPNGIMIGYTL---KYVAFNGTKVGKQIVENFSPNQTKFTVQRTDPVSRYRFTLSARTQVGSGE 1017          
BLAST of Neuroglian vs. TrEMBL
Match: Q1JUB3 (L1-like cell adhesion molecule OS=Dugesia japonica OX=6161 GN=DjLCAM PE=2 SV=1)

HSP 1 Score: 565.459 bits (1456), Expect = 9.573e-174
Identity = 395/1215 (32.51%), Postives = 610/1215 (50.21%), Query Frame = 3
Query:   78 LVNFTINML--NLLMFSEAS---FPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVN-------QDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC--EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKV--VKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHS--VKLQWSIIYENQL-SRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKP------------------DPRELS---------YR------LQDPVT-RFNERVKRDVYSSI----YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSE-EVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWK---FYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSG 3530
            +++F I +     LMF+      +PPSF+ QP K E +YQ    ++L C A   PS  Y WLKN + + +  +N        +EG++ +     +++G YQC+A N  G+A S K+ +R A I ++ +     I        +L+C+ P C+PP  + W  +K+ G     +E ++ V+D +GNL+IT +  EDD   +SC   N  +R  K   +  I + P    S+L  P++  + S       +   ++L CI S     + +W  +  ++  I  +  F T   G  L I+ +   D   + C  E       + I F +NV   PI   +  D  V  N S +F C+A G P P I WT NG  +  YLNG      GN +YL NL   D  V QCNASN  GY Y+N +INV   KP  +  PQ  +         INC AFS P   + W KD + +N     +Y + DNG+L+I  L + D+G Y C A+N++G       + +R+ T+++    N     G +V   C+A+TD  E +NLKI W+K N  + +   +  +  +  + L +    T D+G Y CNA+NG+D+D+    L V+GKP    DI+ DC R++N+R A+++W  G  N A I  ++ E+ TQ+D K W  +  V     T I  +     +  V + P+I+Y FR+R++N++G S+PS +T+N C +    PN NP +VF+YGT  + L I+W  + Y+ H  P L YH+T+ C+ C   P  +     I+ W  + +   N    S    +E +++++VTIQ+KN +G S+      +G+SG+  P I  + L + A       V L W+I+ + ++ S + GFFRGYRIEWCL   S   CD+    QD IL+                    D  EL+         YR      L  P+  +   R KR V ++     YGQ   A LT IPG T I+IW R +N  Y   +S+  ++I T E TPGPV +FN+ T+ IN++ + W  P  TNGI+TGY +  +E       G       + DP+QL+ ++S LK++T Y I IWALT QG G E  +  +T+            +  +  N   ++ITF+         SD+G K   FY Q+R      W+E+E QY   W+ + +L  + TY +R V    +G
Sbjct:    1 MISFHIILFCCGFLMFTPGDCVYYPPSFVYQPNKNE-VYQNLEALMLRCVATGSPSPTYTWLKN-NKVFDFSINVGRYTKWPNEGTMILALPNDDDDGIYQCIAENSHGKAYSIKSNVRRAEIQNFKNKDPEKITARQGEYLLLKCEVPVCFPPPIVVWQKIKN-GIAELIKESSKYVMDIDGNLYITGLTMEDDQAKFSCTVYNQRMRMTKSDKEHWITVIPGQ--SNL--PVVLRFRSLQPMNGRVGDKLVLRCILSGYPSPNYKWTVK-GQDKSILERPNFITDAGGAILIINPVTTADQDTFQCTGENAVSNIPIVIDFQVNVEMTPILTTKLSDANVPYNGSHVFSCEAIGRPNPVITWTVNGVGLDTYLNGQNKRKIGNTIYLTNLLPGDHAVFQCNASNYIGYDYSNGYINVLRDKPEFINGPQATLIKAENKPATINCQAFSAPKAIVTWTKDGFPIN---GGRYMIQDNGDLLITKLITADSGTYTCTATNLYGSISGTCVVFVRQRTELMIRPINTWVYFGQEVKFVCTAKTDRLETQNLKIVWYKDNSPITIGPYERTNTNLQDNSLIIMGAQTTDTGIYTCNATNGLDFDVAYATLIVQGKPHTPIDIKADCSRFANNREAVVSWNPGADNYAPIVMYLVEYSTQFDRKGWYEVQKV-----TKITGSTGETVDVKVAMQPFIQYQFRVRAINRVGVSEPSDVTLNPCSLPPTIPNKNPKEVFVYGTAKDNLVIQWTPMTYVEHCAPKLVYHITVICITCQSIPKNATNTTFISDWDQNIVTYYNFQLGSVTYDMESFQQFKVTIQAKNEIGLSSGNITVGYGYSGDDSPVITSAQLAMTAGAPGKGYVPLSWTILSQAEVKSSMKGFFRGYRIEWCLASLSDLECDVSTQYQDVILVAQNLPVLYGNKRRKRSVDENDENELNEVKYKYDTKYRQVIPDNLDSPMNFQVLSRRKRAVLTNPDQWNYGQNFTAKLTLIPGNTAIKIWLRALNAIYASTRSDPPIQITTFEDTPGPVIDFNVLTLSINHVVLQWKSPTETNGIITGYRLAWRE-INGLELGYMTTYPDLTDPNQLQFQMSGLKAQTNYRILIWALTSQGAGIESFIDIQTQPAHIAPNAPMFTVNSVVNN--TVNITFSP--------SDTGVKGSVFYAQYRKVGQYRWDESEPQYIKSWIYIINLANDTTYELRMVATNGAG 1188          
BLAST of Neuroglian vs. TrEMBL
Match: A0A4E0S2U8 (Neuroglian OS=Fasciola hepatica OX=6192 GN=D915_001179 PE=4 SV=1)

HSP 1 Score: 547.354 bits (1409), Expect = 5.827e-166
Identity = 315/888 (35.47%), Postives = 458/888 (51.58%), Query Frame = 3
Query:  129 SFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQ-------DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQN--TLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPD 2750
            +FPPSF Q PPK       +  I LPC A   P+  Y W KNG    N   N        DEG+L + R   +++G YQC A N  G + S+   ++ A +  +   K + +   +    +L C+ P  YPP  + W   K+  ++   +E+NRR  D NG L+I  +I++D    Y+C++ N  LR  K G   +I+I           PL  LY +      ++   + L CIF         WF+   +   + P    Q +  GT LEI+ +    AG+Y C+   EQ   TLN ++T+ V  +P F+ +P D TV +N S IF C A G+P P+IRWT NG +   YL+G R  L GN + L NLT KD  VIQCNASN +GY +TNA++NV    P  + PPQ  ++ V    V + C  FS P   I W KD   +N     +Y   +NG+L I  +   D+GVYEC A+N FG  K    +++R  T I+    + +   G  V   C+A TD  E  NLKI W+K + L+   +            L L     RD+G Y CNASNG+D+      L V+G+PE   ++QV+C  + N  LAL++W  G  N A I  +I E+ TQY+   W    P      T +  +  IK    V + P I Y FR+R+ N +G S PS  T  +C +    P INP ++++YG+  N L I+W ++PY+ H G NL Y LT+ C++CD  P T+     +  W+T  +  ++    + + ++E YK + VTIQS+N  G ST  P   +GFSGE+ PT+ P +  I + T     LQW  I   Q  ++ G+FRGYR+EWCL+  +   C+  K  QD IL  P+
Sbjct:   20 TFPPSFTQMPPKNAVFIPGEA-IKLPCVAIGAPAPKYIWYKNGKEF-NWAANTGRYTKWPDEGTLIMARPGTDDDGMYQCFAINQFGISQSNVINVKRAELGDFELSKTKIVRAQHGQWLVLTCNVPLGYPPPVVTWQTEKN-SQIQYIKENNRRATDINGYLYIAAVIEDDHDTTYTCVANNEVLRYQKSGPSYRIQI----YGQQTNYPLTELYRTPRTEVTVVGEKLNLKCIFGGYPEPQYTWFKDGKEPINL-PNVNVQNM--GTMLEINPVTEDAAGEYRCQGSNEQTRVTLNAQYTVQVQVRPTFVEKPEDITVPVNESVIFRCTAKGKPAPQIRWTVNGGDPSHYLDGKRKILRGNTMELYNLTIKDTAVIQCNASNAFGYAFTNAYVNVMREPPYFIKPPQTELRAVDGHPVTLFCQTFSAPKALISWSKDGRPIN---GGRYQNMENGDLFISAIAITDSGVYECTATNPFGSRKAWGRLMVRRQTSIVLAPIDTQVYEGQVVKFVCTAETDPLELANLKITWYKDDNLINPDMTPRIQRVWFDYSLVLSGAQPRDTGQYRCNASNGLDFAYATASLLVQGRPEQAINVQVNCVEFINEELALVSWYPGSDNYAPIMEYIVEYSTQYEQDTWY---PAEIFNYTGLIQSTSIK----VVLRPAILYRFRVRTRNWVGISLPSKPTKESCGIPSRVPAINPKELYVYGSLRNNLIIRWTTLPYIEHYGSNLGYILTVSCLNCDIIPRTAVNTTVVGDWRTDTLTYTSFRVGAMVYEMETYKEFVVTIQSRNEKGVSTAPPTVAYGFSGEAVPTVVPPSPTILSPTSRGANLQWQAITAAQEPQVQGYFRGYRVEWCLSGLTTTDCETNKRFQDVILRIPN 887          

HSP 2 Score: 92.4337 bits (228), Expect = 7.210e-15
Identity = 87/289 (30.10%), Postives = 130/289 (44.98%), Query Frame = 3
Query: 2793 FNERVKRDVYSSI---YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKE--------NFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV-INTKSGSVNTQSRFLKT--GTGESNAFLMLRGSGTTW 3617
            F  +V R+  +++   YGQ+   TLTG+PG T+IR+W RI+N ++ GP      + T E  PGPVA      I +NY +I W  P   NG LTGY+    E         F++ NS N+              R+  LK  T Y I++W  T  G G +  +   T       +     I  +  +NF +     EP    +     G  F++Q+R    I W E+E  +    ++V+ LLP+ +Y VR V  N    S  + +R + T  G G  +    L G   TW
Sbjct:  984 FQTQVNRNAPTTLTFQYGQLVNYTLTGVPGATSIRVWLRILNTRFAGPMGAVASLTTLEDVPGPVANLRASAISVNYADIIWTPPTEPNGNLTGYEFEAMELKGLEMGFGFRYPNSTNATATSY---------RMPRLKPNTTYRITVWPKTAAGLGVDTFIDLTTAPSDVAPEAPSFAISAVGLSNFTV---IYEPSHTGI----PGTVFFVQYRQPGIIHWLESEPTFIEREIVVNQLLPDTSYEVRMVATNGAFLSTESATRLVHTLGGPGPDS----LTGPSGTW 1252          
BLAST of Neuroglian vs. TrEMBL
Match: A0A504YWU2 (Neuroglian OS=Fasciola gigantica OX=46835 GN=FGIG_02372 PE=4 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 1.809e-165
Identity = 315/888 (35.47%), Postives = 457/888 (51.46%), Query Frame = 3
Query:  129 SFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQ-------DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQN--TLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPD 2750
            +FPPSF Q PPK       +  I LPC A   P+  Y W KNG    N   N        DEG+L + R   +++G YQC A N  G + S+   ++ A +  +   K + +   +    +L C+ P  YPP  + W   K+  ++   +E+NRR  D NG L+I  +I++D    Y+C++ N  LR  K G   +I+I           PL  LY +      ++   + L CIF         WF+   +   + P    Q +  GT LEI+ +    AG+Y C+   EQ   TLN ++T+ V  +P F+ +P D TV +N S IF C A G+P P+IRWT NG +   YL+G R  L GN + L NLT KD  VIQCNASN +GY +TNA++NV    P  + PPQ  ++ V    V + C  FS P   I W KD   +N     +Y   +NG+L I  +   D+GVYEC A+N FG  K    +++R  T I+    + +   G  V   C+A TD  E  NLKI W+K + L+   +            L L     RD+G Y CNASNG+D+      L V+G+PE   ++QV+C  + N  LAL++W  G  N A I  +I E+ TQY+   W    P      T +  +  IK    V + P I Y FR+R+ N +G S PS  T  +C +    P INP ++++YG+  N L I+W ++PY+ H G NL Y LT+ C++CD  P T+     +  W+T  +  ++    + + ++E YK + VTIQS+N  G ST  P    GFSGE+ PT+ P +  I + T     LQW  I   Q  ++ G+FRGYR+EWCL+  +   C+  K  QD IL  P+
Sbjct:   35 TFPPSFTQMPPKNAVFIPGEA-IKLPCVAIGAPAPKYIWYKNGKEF-NWAANTGRYTKWPDEGTLIMARPGTDDDGMYQCFAINQFGISQSNVINVKRAELGDFEPSKTKIVRAQHGQWLVLTCNVPLGYPPPVVTWQTEKN-SQIQYIKENNRRATDINGYLYIAAVIEDDHDTTYTCVANNEVLRYQKSGPSYRIQI----YGQQTNYPLTELYRTPRTEVTVVGEKLNLKCIFGGYPEPQYTWFKDGKEPINL-PNVNVQNM--GTMLEINPVTEDAAGEYRCQGSNEQTRVTLNAQYTVQVQVRPTFVEKPEDITVPVNESVIFRCTAKGKPAPQIRWTVNGGDPSHYLDGKRKILRGNTMELYNLTIKDTAVIQCNASNAFGYAFTNAYVNVMREPPYFIKPPQTELRAVDGHPVTLFCQTFSAPKALISWSKDGRPIN---GGRYQNMENGDLFISAIAITDSGVYECTATNPFGSRKAWGRLMVRRQTSIVLAPIDTQVYEGQVVKFVCTAETDPLELANLKITWYKDDNLINPDMTPRIQRVWFDYSLVLSGAQPRDTGQYRCNASNGLDFAYATASLLVQGRPEQAINVQVNCVEFINEELALVSWYPGSDNYAPIMEYIVEYSTQYEQDTWY---PAEIFNYTGLIQSTSIK----VVLRPAILYRFRVRTRNWVGISLPSKPTKESCGIPSRVPAINPKELYVYGSLRNNLIIRWTTLPYIEHYGSNLGYILTVSCLNCDIIPRTAVNTTVVGDWRTDTLTYTSFRVGAMVYEMETYKEFMVTIQSRNEKGVSTAPPTVAHGFSGEAVPTVVPPSPTILSPTSRGANLQWQAITAAQEPQVQGYFRGYRVEWCLSGLTTTDCETNKRFQDVILRIPN 902          

HSP 2 Score: 92.8189 bits (229), Expect = 5.031e-15
Identity = 88/289 (30.45%), Postives = 130/289 (44.98%), Query Frame = 3
Query: 2793 FNERVKRDVYSSI---YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKE--------NFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVI-NTKSGSVNTQSRFLKT--GTGESNAFLMLRGSGTTW 3617
            F  +V R+  +++   YGQ    TLTG+PG T+IR+W RI+N ++ GP      + T E  PGPVA      I +NY +I W  P   NG LTGY+    E         F++ NS N+              R+S LK  T Y I++W  T  G G +  +   T       +     I  +  +NF +     EP    +     G  F++Q+R    I W E+E  +    ++V+ LLP+ +Y VR V  N    S  + +R + T  G G  +    L G   TW
Sbjct:  999 FQTQVNRNAPTTLTFQYGQQVNYTLTGVPGATSIRVWLRILNTRFAGPMGAVASLTTLEDVPGPVANLRASAISVNYADIIWTPPTEPNGNLTGYEFEAMELKGLEMGFGFRYPNSTNATATSY---------RMSRLKPNTTYRITVWPKTAAGLGVDTFIDLTTAPSDVAPEAPSFAISAVGLSNFTV---IYEPSHTGI----PGTVFFVQYRQPGIIHWLESEPTFIEREIVVNQLLPDTSYEVRMVATNGAFLSTESATRLVHTLGGPGPDS----LTGPSGTW 1267          
BLAST of Neuroglian vs. TrEMBL
Match: A0A3Q0KPG1 (Septate junction protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 538.495 bits (1386), Expect = 5.958e-163
Identity = 320/896 (35.71%), Postives = 472/896 (52.68%), Query Frame = 3
Query:  108 LLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQ-------DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIK-PKERFQTIRKGTTLEISNIERKDAGQYICEPVEE--QNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLK--VVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPD 2750
             +  S  ++PP+FI+ PP  +     +  I LPC AK  PS  Y W KNG    N   N        D G+L I R   +++G YQC+A N  G A+S    ++ A +  +   KE+ +      S  L C  P  YPP  + W   K+  ++   +E NRR  D NG L+I  +I EDD  +Y+C++ N  LR  K G   ++ +           P+ T Y S       +   V L CI+S        WF+  D++ +I  P  + + +  GT LEI+ +  + AG+Y C+ + E  +NT+N +FT+ V  +P FI +P D TV +N S  F C ASG+P P+IRWT NG++   YL+G R  LHGN + L+NLT KD  VIQCNASN +GY +TNA++NV    P  + PP+  ++ V    V + C  FS P   I W KD   +N     +Y +  +G+L I+++   D+GVYEC A+N FG  K    +++R  T+I+    N R      V   C+A TD  E  NLKI W+K +  +   +            L L     RD+G Y CNASNG+D+D     L V+G+PE   ++QV+C  + N  LAL+TW  G  N A I  +I E+ TQ++   W    P      T +  +  +K    V + P I+Y FR+R+ N++G S PS  T   C +    P++NP +++++GT  N L I+W ++P++ HNG NL Y LT++C++C    S +     I  W+T RIV ++  +   +++IE YK + VTIQS+N  G ST  P    G+S E+ PT+ P    +   T   V L+  II  NQ++ I GFFRGYRIEWC        CD  +  +D I   P+
Sbjct:    2 FITVSAITYPPTFIEMPPSDKVFIPGEA-IRLPCVAKGSPSPKYFWYKNGQYF-NWAANTGRYTKWPDHGTLVIARPGTDDDGMYQCIAKNQFGTALSVIVNVKRAELGDFELTKEQKVRASLGQSVRLACQVPVGYPPPVVTWQTEKN-AQIHYLKETNRRATDINGYLYIATVIPEDDDTLYTCVANNEVLRFQKSGPSFRLSVH----GQQSTYPVKTDYRSPRTEDAAVGDIVQLRCIYSGYPEPQYTWFK--DESEKITLPNVKIKNM--GTMLEINPVTIESAGEYRCQGINEVTKNTVNSQFTVFVRVRPKFIEKPEDITVPVNGSVTFRCTASGDPPPKIRWTINGEDPSSYLDGVRKVLHGNTMQLSNLTIKDSAVIQCNASNKFGYAFTNAYVNVMREAPYFMKPPESVVRAVDGNQVTLFCQTFSAPKAIISWTKDRRPIN---GGRYKILTSGDLFIESVAITDSGVYECTATNPFGSKKASGKLLVRRKTRIVLAPINTRVYENDVVKFVCTAETDPAEVSNLKITWYKDDNYIDPNLTPRIQQVWFDYALVLSGAQPRDTGQYRCNASNGLDFDTATAPLLVQGRPEQAINVQVNCVDFINEELALITWYPGSDNYAPIMEYIVEYSTQFERDTWY---PAEIFNLTGLVQSTSVK----VVLRPNIQYQFRVRTRNRVGVSLPSQPTTKTCGIPGRVPSVNPRELYVFGTIGNNLVIRWTTLPFIEHNGNNLGYILTVQCLNCASVQSNAINTTVIGDWRTDRIVYTSFKAGVVVSEIESYKLFRVTIQSRNEKGVSTQSPTVALGYSSEAMPTVSPPAPIVINTTVQGVYLKLKIIEANQVADIKGFFRGYRIEWCDASLDPVKCDALRQFKDIIFRVPN 876          

HSP 2 Score: 82.8037 bits (203), Expect = 5.752e-12
Identity = 73/255 (28.63%), Postives = 118/255 (46.27%), Query Frame = 3
Query: 2856 LTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAV-INTKSGSVNTQSRFLKTGTGESNAFLMLRGSGTTW 3617
            LTG+PG T I++W R++  +Y GP S  V + T  G  GP++    + I +NYI+++W+ P   NG + GY++   E     + G   +   I D      R+S LK  T Y I+IW +T  G G +  +  +T    +        I  +++  F +     EP    L     G  F++Q+R    + W E+ + + +  + V  L+ + TY VR V  N    S  ++ R + T  G S     L G   TW
Sbjct: 1009 LTGVPGATNIKLWVRVLTNKYAGPASPIVELMTSGGLSGPISNLKADAISVNYIDVSWSIPTEPNGYIIGYELEAME-LNGLDVGYGFRYPPITDNSSTSYRMSRLKGNTTYRITIWPITGAGLGIDNFIDIQTAPTDQAPSPPTFVITHVTETGFTI---IYEPSHVGL----PGTVFFVQYRQPGIVHWLESVRTFINRTITVDGLMSDTTYTVRMVATNGDVLSTASEDRVIHTLGGPSPG--SLAGDSGTW 1253          
BLAST of Neuroglian vs. TrEMBL
Match: A0A074ZUJ1 (Uncharacterized protein OS=Opisthorchis viverrini OX=6198 GN=T265_02573 PE=3 SV=1)

HSP 1 Score: 551.592 bits (1420), Expect = 1.668e-161
Identity = 330/936 (35.26%), Postives = 484/936 (51.71%), Query Frame = 3
Query:   84 NFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQ-------DEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSR---GSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQN--TLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLK--VVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHM 2849
            N  I +L L      +FPPSF Q PP+   ++     I+LPC A   P+  Y W KNG    N   N        D+G+L I R   +++G YQC A N  G A S+   +R A +  +  ++ +T+ V Y  S +L C+ P  YPP  + W   K Y ++   +E NRR  D NG L+I   I+ED   +Y+C++ N   R    G    IK+      +    P+  LYN+     V     + L CIF+        W++   +  E+ P    + +  GT LEI+ +  + AG+Y C+   EQ   T N+++T+ V  +P F+++P D TV +N S IF C A+G+P P+IRWT NGQ+   YL+G R  L GN ++L NLT KD  VIQCNASN +GY + NA++NV    P  + PPQ   + V    V I+C  FS P   I W KD   ++     +Y     G+L I ++   D+GVYEC A+N FG  K    +++R  T I+    + +      V   C+A TD  E +NL+I W+K + L++  +            L L     RD+G Y CNASNG+D+ +    L V+G+PE    ++V+C  +    LAL++W  G  N A I  +I E+ TQY+   W    P      T +  +  IK    V + P I Y FRIR+ N++G S PS  T   C +    P  NP ++++YG+  N L IKW ++PY+ H G NL Y L + C++CD  P T+     I  W+T  I +++    +K+ +IE YK+++V+IQS+N  G ST  P    G SGE+ PTI P +  +   T     L+W  I E QL ++NG+FRGYRIEWC     A  CD +   QD IL  PD      R +  +  F +    D+ SS  G+ H+
Sbjct:    9 NTLIFLLVLGWSLSITFPPSFTQLPPRNA-VFNPGEAILLPCVAIGAPAPKYTWFKNGKYF-NWAANTGRYTKWPDQGTLVIARPGTDDDGIYQCYASNQFGIAQSNTVNVRRAELGDFERVETKTMYVRYGDSVMLRCNVPLGYPPPVVTW-QTKKYSQIQYIKETNRRATDINGYLYIAAAIEEDHDTLYTCVANNEVTRYQTNGPSYLIKV----FGTQTNYPVKPLYNTPRTEVVTAGDILRLKCIFAGYPPPQYTWYKDGKEPIEL-PNVNVKNL--GTMLEINPVSVEAAGEYRCQVTNEQTRVTGNMQYTVRVHVRPTFVDKPQDTTVPVNGSVIFTCTATGDPAPQIRWTVNGQDPSAYLDGVRKTLQGNVMHLYNLTVKDTAVIQCNASNAFGYDFVNAYLNVMREPPYFIKPPQAEQRVVDGHEVIIHCQTFSAPKALISWTKDGRPIS---GGRYRSLITGDLKISSVAITDSGVYECTATNPFGSRKASGRLLVRRRTSIVLAPIDTQVYEDQVVKFVCTAETDPMELQNLEITWYKDDNLIEPSLTPRIQQIWFDYSLVLSGAQPRDTGQYRCNASNGLDYAVASASLLVQGRPEKAIRVEVNCAEFIKDELALVSWYPGSDNYAPIMEYIVEYSTQYERDTWY---PAEIFNYTGLVQSTSIK----VVLRPAILYQFRIRTRNRVGVSLPSVATSTACGIPARVPATNPSELYVYGSLRNNLIIKWTTMPYIEHYGSNLGYILKVTCLNCDIIPRTAVNNTVIGDWRTDSITMTSFLVGTKVYEIETYKQFKVSIQSQNEKGESTAPPTFAVGHSGEAVPTIVPPSPTLVNATSKGAVLRWQAITEAQLPQVNGYFRGYRIEWCDAFLDAIQCDKQTRFQDVILKIPDTPVFYSRRRRSIVDFEDTRPLDLLSSD-GESHL 923          

HSP 2 Score: 98.5969 bits (244), Expect = 1.081e-16
Identity = 78/269 (29.00%), Postives = 124/269 (46.10%), Query Frame = 3
Query: 2814 DVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSG-SVNTQSRFLKTGTGESNAFLMLRGSGTTW 3617
            D+ + ++GQ+   +LTG+PG +++R+W R++N ++ GP S  + + T E TPGPVA   + TI + Y +I W  P   NGI+ GY+   KE       G   +   ++D +  + R+  L+  T Y I++W  T  G G +  + F T             +  I   NF +     EP          G  F++Q+R    I W E+ + +    + V  L+P+  Y VR V     G S  T  R + T  G       L G+  TW
Sbjct:  998 DLPTFVWGQVVEHSLTGVPGNSSVRVWLRVLNTRFAGPMSPVISLNTLEDTPGPVANLQVVTIGVTYADIVWTPPAEPNGIVLGYEFEAKE-LHGLEMGFGFRFPPLQDGNATQCRLPGLRPNTSYRITVWPFTSAGTGVDTFIDFSTAPSDVAPSPPNFVVTHIGMTNFTV---MYEPSH----IGIPGTVFFVQYREPGVIHWLESTRTFVQRVINVEELMPDTFYEVRVVATNGEGLSTATADRLIHTMGGPGPG--SLAGASGTW 1256          
BLAST of Neuroglian vs. Ensembl Cavefish
Match: ENSAMXT00000055272.1 (neural cell adhesion molecule L1-like protein [Source:NCBI gene;Acc:103045998])

HSP 1 Score: 297.745 bits (761), Expect = 2.134e-83
Identity = 257/1054 (24.38%), Postives = 454/1054 (43.07%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI-----ENLIVNQDEGSLRIE--RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLL-----KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPF-DKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE-PVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVL--SNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P     PP        D +  L C AK  P   + W +NG          LI ++D G+  I   R + + +G+Y+C A N LG A+S +T   +     + + K     V    S ILEC+ P   PP  + W+       L   E+DNR  +  NGNL+ +  + +D    Y C ++   +RT+ +     I +KP + SS        KP L+   ++  +  ++    + L CI   F   ++ W     K  E  PK R      G  L IS +  +D+G+Y+C+           F ++V E P ++ +P   + V + S    +C A+G+P+P ++W  NG+    + +     + G+ + L      D  V QC ASN +G +   A + V N  PL+L    +    V   NV ++C  FS P   + WR++    ++    ++S+ +NG+L I    + D G Y C A N  G +   + + I++PT+I++   + + + G    LEC A  D    E+  + W K+ E +     +     I   +L++ +++  D G Y C A   +D D     + V   P+ PV+   +D +     R   L W+    +N+ +T +I E+    ++P  W  +L V+             +N+  ++++ +I Y FR+ +VN +GT +PS  +    +     P+ +PD++ I G  P  + I W+ +  + HNGP L Y L+ R             Q+ +    T +IV   S +  N+       +  YEV IQ+ N  G++   P    G+SGE  P   P ++ ++ +    +++ WS + +   + + G   GY + W                              +R +  +T   E      + ++ G      + G+   +  R+   + N +  GP S  +   T +G P           + + I + WA PL  NG+LTGY ++  + F  +   +      I   D  +  + +L+S ++Y   + A T  G G
Sbjct:   32 PVITVHPPASLITLPFDDSFTLTCEAKGNPKPEFHWTRNGQDFNLDDDSRLIQHEDSGTFIIPKIRDLVKYQGTYRCYASNKLGTAVSEETVFIVPASPKFPNEKIEPKVVNEGDSVILECNPPKGIPPVQLYWMTTG----LQHIEQDNRVSMSLNGNLYFSNTMSKDSRSDYCCFASFGRIRTIVQKNAMAIDVKPLNFSSKEYVDLKKKPNLLVPSDNQSQVHIVKGEELELECIAEGFPTPAIEW----SKPGEKLPK-RSNIKNYGKLLTISKVSEEDSGKYMCKASNGLGEALHYFHVHVEEPPRWVKEPVKSQVVTMGSDVHIKCHAAGKPQPTVKWMRNGKPFHDHSSSHST-VQGDTIMLLRALPNDSAVYQCEASNPHGTLLGTANVMVMNHPPLILTKDYQEYATVRGKNVTMDCKVFSSPLAAVEWRREDPEGSV--KERFSIHENGSLQIHPAEAEDMGKYVCFAKNSEGSSSISAELFIKDPTRIVAPPQDMKVKRGSTARLECRAEFDQSLSEDFDVFWQKEGEDIYSNFTEDSGFHINGGLLQIFNVSHNDKGLYTCIARTSLDEDTATARVTVLDVPDAPVNLTLLDHR----DRSVRLHWMPTRDHNSPVTEYIIEYEENHWEPGKWRPLLRVSGN-----------QNSAPLSLYGHINYQFRVTAVNAIGTGRPSKPS-KRYKTPSAAPDRSPDNIKIEGHLPQQMDITWEPLLPVEHNGPGLEYKLSYR-------------QLGVEETWTEQIVQRHSFVVKNTP-----TFVPYEVKIQAHNEQGWAPE-PRVVTGYSGEDLPLAAPEDVSVEVLNSTLLRVSWSPVPQ---ALLRGHLGGYSVHW------------------------------WRTRSLLTS-KEVPAEKQFLTLSGNRSHTMVPGLKPSSEYRLTVNVFNRRGNGPSSSPLTFTTPQGVPERPPVLKATNSQGDSITLVWAPPLEANGVLTGY-MLQYQIFNETLDVDEANTVNISGRDTTQWVLHNLESNSQYKFYLSACTVVGCG 1003          
BLAST of Neuroglian vs. Ensembl Cavefish
Match: ENSAMXT00000018100.2 (neural cell adhesion molecule L1-like protein [Source:NCBI gene;Acc:103045998])

HSP 1 Score: 297.36 bits (760), Expect = 1.101e-82
Identity = 257/1054 (24.38%), Postives = 454/1054 (43.07%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI-----ENLIVNQDEGSLRIE--RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLL-----KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPF-DKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE-PVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVL--SNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P     PP        D +  L C AK  P   + W +NG          LI ++D G+  I   R + + +G+Y+C A N LG A+S +T   +     + + K     V    S ILEC+ P   PP  + W+       L   E+DNR  +  NGNL+ +  + +D    Y C ++   +RT+ +     I +KP + SS        KP L+   ++  +  ++    + L CI   F   ++ W     K  E  PK R      G  L IS +  +D+G+Y+C+           F ++V E P ++ +P   + V + S    +C A+G+P+P ++W  NG+    + +     + G+ + L      D  V QC ASN +G +   A + V N  PL+L    +    V   NV ++C  FS P   + WR++    ++    ++S+ +NG+L I    + D G Y C A N  G +   + + I++PT+I++   + + + G    LEC A  D    E+  + W K+ E +     +     I   +L++ +++  D G Y C A   +D D     + V   P+ PV+   +D +     R   L W+    +N+ +T +I E+    ++P  W  +L V+             +N+  ++++ +I Y FR+ +VN +GT +PS  +    +     P+ +PD++ I G  P  + I W+ +  + HNGP L Y L+ R             Q+ +    T +IV   S +  N+       +  YEV IQ+ N  G++   P    G+SGE  P   P ++ ++ +    +++ WS + +   + + G   GY + W                              +R +  +T   E      + ++ G      + G+   +  R+   + N +  GP S  +   T +G P           + + I + WA PL  NG+LTGY ++  + F  +   +      I   D  +  + +L+S ++Y   + A T  G G
Sbjct:   32 PVITVHPPASLITLPFDDSFTLTCEAKGNPKPEFHWTRNGQDFNLDDDSRLIQHEDSGTFIIPKIRDLVKYQGTYRCYASNKLGTAVSEETVFIVPASPKFPNEKIEPKVVNEGDSVILECNPPKGIPPVQLYWMTTG----LQHIEQDNRVSMSLNGNLYFSNTMSKDSRSDYCCFASFGRIRTIVQKNAMAIDVKPLNFSSKEYVDLKKKPNLLVPSDNQSQVHIVKGEELELECIAEGFPTPAIEW----SKPGEKLPK-RSNIKNYGKLLTISKVSEEDSGKYMCKASNGLGEALHYFHVHVEEPPRWVKEPVKSQVVTMGSDVHIKCHAAGKPQPTVKWMRNGKPFHDHSSSHST-VQGDTIMLLRALPNDSAVYQCEASNPHGTLLGTANVMVMNHPPLILTKDYQEYATVRGKNVTMDCKVFSSPLAAVEWRREDPEGSV--KERFSIHENGSLQIHPAEAEDMGKYVCFAKNSEGSSSISAELFIKDPTRIVAPPQDMKVKRGSTARLECRAEFDQSLSEDFDVFWQKEGEDIYSNFTEDSGFHINGGLLQIFNVSHNDKGLYTCIARTSLDEDTATARVTVLDVPDAPVNLTLLDHR----DRSVRLHWMPTRDHNSPVTEYIIEYEENHWEPGKWRPLLRVSGN-----------QNSAPLSLYGHINYQFRVTAVNAIGTGRPSKPS-KRYKTPSAAPDRSPDNIKIEGHLPQQMDITWEPLLPVEHNGPGLEYKLSYR-------------QLGVEETWTEQIVQRHSFVVKNTP-----TFVPYEVKIQAHNEQGWAPE-PRVVTGYSGEDLPLAAPEDVSVEVLNSTLLRVSWSPVPQ---ALLRGHLGGYSVHW------------------------------WRTRSLLTS-KEVPAEKQFLTLSGNRSHTMVPGLKPSSEYRLTVNVFNRRGNGPSSSPLTFTTPQGVPERPPVLKATNSQGDSITLVWAPPLEANGVLTGY-MLQYQIFNETLDVDEANTVNISGRDTTQWVLHNLESNSQYKFYLSACTVVGCG 1003          
BLAST of Neuroglian vs. Ensembl Cavefish
Match: ENSAMXT00000053326.1 (neural cell adhesion molecule L1-like protein [Source:NCBI gene;Acc:103045998])

HSP 1 Score: 296.59 bits (758), Expect = 4.075e-82
Identity = 257/1054 (24.38%), Postives = 454/1054 (43.07%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI-----ENLIVNQDEGSLRIE--RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLL-----KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPF-DKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE-PVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVL--SNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P     PP        D +  L C AK  P   + W +NG          LI ++D G+  I   R + + +G+Y+C A N LG A+S +T   +     + + K     V    S ILEC+ P   PP  + W+       L   E+DNR  +  NGNL+ +  + +D    Y C ++   +RT+ +     I +KP + SS        KP L+   ++  +  ++    + L CI   F   ++ W     K  E  PK R      G  L IS +  +D+G+Y+C+           F ++V E P ++ +P   + V + S    +C A+G+P+P ++W  NG+    + +     + G+ + L      D  V QC ASN +G +   A + V N  PL+L    +    V   NV ++C  FS P   + WR++    ++    ++S+ +NG+L I    + D G Y C A N  G +   + + I++PT+I++   + + + G    LEC A  D    E+  + W K+ E +     +     I   +L++ +++  D G Y C A   +D D     + V   P+ PV+   +D +     R   L W+    +N+ +T +I E+    ++P  W  +L V+             +N+  ++++ +I Y FR+ +VN +GT +PS  +    +     P+ +PD++ I G  P  + I W+ +  + HNGP L Y L+ R             Q+ +    T +IV   S +  N+       +  YEV IQ+ N  G++   P    G+SGE  P   P ++ ++ +    +++ WS + +   + + G   GY + W                              +R +  +T   E      + ++ G      + G+   +  R+   + N +  GP S  +   T +G P           + + I + WA PL  NG+LTGY ++  + F  +   +      I   D  +  + +L+S ++Y   + A T  G G
Sbjct:   32 PVITVHPPASLITLPFDDSFTLTCEAKGNPKPEFHWTRNGQDFNLDDDSRLIQHEDSGTFIIPKIRDLVKYQGTYRCYASNKLGTAVSEETVFIVPASPKFPNEKIEPKVVNEGDSVILECNPPKGIPPVQLYWMTTG----LQHIEQDNRVSMSLNGNLYFSNTMSKDSRSDYCCFASFGRIRTIVQKNAMAIDVKPLNFSSKEYVDLKKKPNLLVPSDNQSQVHIVKGEELELECIAEGFPTPAIEW----SKPGEKLPK-RSNIKNYGKLLTISKVSEEDSGKYMCKASNGLGEALHYFHVHVEEPPRWVKEPVKSQVVTMGSDVHIKCHAAGKPQPTVKWMRNGKPFHDHSSSHST-VQGDTIMLLRALPNDSAVYQCEASNPHGTLLGTANVMVMNHPPLILTKDYQEYATVRGKNVTMDCKVFSSPLAAVEWRREDPEGSV--KERFSIHENGSLQIHPAEAEDMGKYVCFAKNSEGSSSISAELFIKDPTRIVAPPQDMKVKRGSTARLECRAEFDQSLSEDFDVFWQKEGEDIYSNFTEDSGFHINGGLLQIFNVSHNDKGLYTCIARTSLDEDTATARVTVLDVPDAPVNLTLLDHR----DRSVRLHWMPTRDHNSPVTEYIIEYEENHWEPGKWRPLLRVSGN-----------QNSAPLSLYGHINYQFRVTAVNAIGTGRPSKPS-KRYKTPSAAPDRSPDNIKIEGHLPQQMDITWEPLLPVEHNGPGLEYKLSYR-------------QLGVEETWTEQIVQRHSFVVKNTP-----TFVPYEVKIQAHNEQGWAPE-PRVVTGYSGEDLPLAAPEDVSVEVLNSTLLRVSWSPVPQ---ALLRGHLGGYSVHW------------------------------WRTRSLLTS-KEVPAEKQFLTLSGNRSHTMVPGLKPSSEYRLTVNVFNRRGNGPSSSPLTFTTPQGVPERPPVLKATNSQGDSITLVWAPPLEANGVLTGY-MLQYQIFNETLDVDEANTVNISGRDTTQWVLHNLESNSQYKFYLSACTVVGCG 1003          
BLAST of Neuroglian vs. Ensembl Cavefish
Match: ENSAMXT00000038803.1 (neural cell adhesion molecule L1-like protein [Source:NCBI gene;Acc:103045998])

HSP 1 Score: 296.59 bits (758), Expect = 4.649e-82
Identity = 257/1054 (24.38%), Postives = 454/1054 (43.07%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSI-----ENLIVNQDEGSLRIE--RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLL-----KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPF-DKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL--KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE-PVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVL--SNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P     PP        D +  L C AK  P   + W +NG          LI ++D G+  I   R + + +G+Y+C A N LG A+S +T   +     + + K     V    S ILEC+ P   PP  + W+       L   E+DNR  +  NGNL+ +  + +D    Y C ++   +RT+ +     I +KP + SS        KP L+   ++  +  ++    + L CI   F   ++ W     K  E  PK R      G  L IS +  +D+G+Y+C+           F ++V E P ++ +P   + V + S    +C A+G+P+P ++W  NG+    + +     + G+ + L      D  V QC ASN +G +   A + V N  PL+L    +    V   NV ++C  FS P   + WR++    ++    ++S+ +NG+L I    + D G Y C A N  G +   + + I++PT+I++   + + + G    LEC A  D    E+  + W K+ E +     +     I   +L++ +++  D G Y C A   +D D     + V   P+ PV+   +D +     R   L W+    +N+ +T +I E+    ++P  W  +L V+             +N+  ++++ +I Y FR+ +VN +GT +PS  +    +     P+ +PD++ I G  P  + I W+ +  + HNGP L Y L+ R             Q+ +    T +IV   S +  N+       +  YEV IQ+ N  G++   P    G+SGE  P   P ++ ++ +    +++ WS + +   + + G   GY + W                              +R +  +T   E      + ++ G      + G+   +  R+   + N +  GP S  +   T +G P           + + I + WA PL  NG+LTGY ++  + F  +   +      I   D  +  + +L+S ++Y   + A T  G G
Sbjct:   32 PVITVHPPASLITLPFDDSFTLTCEAKGNPKPEFHWTRNGQDFNLDDDSRLIQHEDSGTFIIPKIRDLVKYQGTYRCYASNKLGTAVSEETVFIVPASPKFPNEKIEPKVVNEGDSVILECNPPKGIPPVQLYWMTTG----LQHIEQDNRVSMSLNGNLYFSNTMSKDSRSDYCCFASFGRIRTIVQKNAMAIDVKPLNFSSKEYVDLKKKPNLLVPSDNQSQVHIVKGEELELECIAEGFPTPAIEW----SKPGEKLPK-RSNIKNYGKLLTISKVSEEDSGKYMCKASNGLGEALHYFHVHVEEPPRWVKEPVKSQVVTMGSDVHIKCHAAGKPQPTVKWMRNGKPFHDHSSSHST-VQGDTIMLLRALPNDSAVYQCEASNPHGTLLGTANVMVMNHPPLILTKDYQEYATVRGKNVTMDCKVFSSPLAAVEWRREDPEGSV--KERFSIHENGSLQIHPAEAEDMGKYVCFAKNSEGSSSISAELFIKDPTRIVAPPQDMKVKRGSTARLECRAEFDQSLSEDFDVFWQKEGEDIYSNFTEDSGFHINGGLLQIFNVSHNDKGLYTCIARTSLDEDTATARVTVLDVPDAPVNLTLLDHR----DRSVRLHWMPTRDHNSPVTEYIIEYEENHWEPGKWRPLLRVSGN-----------QNSAPLSLYGHINYQFRVTAVNAIGTGRPSKPS-KRYKTPSAAPDRSPDNIKIEGHLPQQMDITWEPLLPVEHNGPGLEYKLSYR-------------QLGVEETWTEQIVQRHSFVVKNTP-----TFVPYEVKIQAHNEQGWAPE-PRVVTGYSGEDLPLAAPEDVSVEVLNSTLLRVSWSPVPQ---ALLRGHLGGYSVHW------------------------------WRTRSLLTS-KEVPAEKQFLTLSGNRSHTMVPGLKPSSEYRLTVNVFNRRGNGPSSSPLTFTTPQGVPERPPVLKATNSQGDSITLVWAPPLEANGVLTGY-MLQYQIFNETLDVDEANTVNISGRDTTQWVLHNLESNSQYKFYLSACTVVGCG 1003          
BLAST of Neuroglian vs. Ensembl Cavefish
Match: nfasca (neurofascin homolog (chicken) a [Source:ZFIN;Acc:ZDB-GENE-080229-6])

HSP 1 Score: 285.034 bits (728), Expect = 1.187e-78
Identity = 271/1062 (25.52%), Postives = 460/1062 (43.31%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNG---HSIENLIVNQDEGSLRIERAIR------ENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTN-KYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSK---LTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHM--ATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDI---------VVKENFQ--FSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGK 3233
            PP+ ++Q  K +++      II+ C AK  P   + W +NG   ++ ++  V+  + S  +E + R      E EG YQC A N  G AIS+K  LR++    +       + V    S IL C+ P   PP +  W+N      ++   +D R  +  NG+L+ + ++  D    YSC +   F  T+++     +K+             ++    +    VL    +LL CI +      ++WF++     E K K  F++  K  TL I ++  +D+G+Y+C    +  ++    ++ V   P ++++P +  +A   +    C ASG P+P I W  NG+ I   L      + G+ +  N++      V QCNASN +GY+  NAF+++ +  P LL P  + IK +      ++C  F  P P + W K+   L ++L   KY + +NG L IK     D G Y  +ASN+ G+ +++  + ++EPT+I  +  +     G     EC  + D      + + W K ++ L              + + ++ + D G Y C  S  +D D     L V  +P+P  D+++      + R   LTWV G  NN+ +T    EF+ QY+   W    P      +    N   +N+  + + P++ Y FR+ ++NK+G S+PS  +    Q     P++ P  +  +GT  N + I W+ +     NGP L Y ++ R  D +              W       +N+T+ S    ++  E Y  YE+ IQ+ N  G      V   G+SGE  P+  P++LR+       V + W  +   + S I+G F+ YR                               L YR +  + +  +  K       Y  +      LT +   +   ++  + N ++ GP S+ V  +TKEG PG    F I       I + W KP+  NGIL GY +         V  +  Q  F+N    E  H I  PD+           T+Y   + A T+ G G+
Sbjct:   41 PPTIVKQSVK-DYIVDPRDNIIIECEAKGNPVPTFWWRRNGKFFNAEKDPRVSMRKRSGTLEISFRNGGKPEEYEGEYQCFALNDFGTAISNKILLRVSKSPLWPKEVLEPVVVTEGSSLILPCNPPPGLPPPNTFWMN----SAMMPITQDKRVSMGLNGDLYFSNVLARDSTMDYSCNARFLFTHTIQQKNPFNLKVLTTRNIPEFAPSFLSPSGLHSSKMVLRGEELLLECIAAGVPTPGIKWFKKGGDLPERKVK--FESFNK--TLRIVSVSEEDSGEYVCMASNKIGSIRHSISVQVKAAPYWLHKPTNLVLAPGENGQLVCLASGNPKPTIEWLVNGETIQSSLPNPSREVVGDAIIFNSVQIGSSAVYQCNASNEHGYLLVNAFVSILDMAPRLLGPKNQLIKVIENHQAFLDCPFFGSPYPDVRWFKNG--LGIVLDGVKYRLHNNGTLEIKRARPEDQGTYTFVASNMLGKAEDQVRLEVKEPTRITRIPEHLSANRGSLARFECKIKHD--HTLPVTVSWLKDDKPLHFGWMSKYKKDEESMSIPNINSDDEGTYTCTVSTELDQDSASARLIVLDRPDPPQDLELSDL---SARSVRLTWVPGNENNSPVT----EFLVQYEEDRW---KPGEWQNLSSYAGN---QNSVNLQLSPFVNYQFRVIAINKVGQSRPSRPSA-RYQTSGSPPDVAPSGLKGWGTRKNNMEISWQPLLDTQRNGPELRYVVSWRRKDHE------------EEW-------NNVTTTSTKYVVSDTETYVPYEIKIQAINDFGRGPESNV-VIGYSGEDKPSAAPADLRVPKADSTKVNVHWVPV---EPSSIHGEFKEYR-------------------------------LYYRREASLAKGVKVTKEKKTKGFYSDVSQNSGILTDLVPYSRYSMYMVVANNKFEGPHSKTVDFETKEGVPGAPKFFKIVQRNTETIHLKWDKPVEPNGILIGYTLKYNTVNGTQVGGQQVQSFFAN----ETEHTIHLPDRF----------TRYKFYLSARTQVGSGE 1007          
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Match: nfasca (neurofascin homolog (chicken) a [Source:ZFIN;Acc:ZDB-GENE-080229-6])

HSP 1 Score: 270.011 bits (689), Expect = 1.811e-75
Identity = 221/867 (25.49%), Postives = 373/867 (43.02%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQDEGSLRIE-----RAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIK-----FTINVVEKPIFI-NQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQ-YDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEW 2675
            PP+   Q PK   +   D  I + C AK  P  ++ W K+G      + E + +  D G+L ++     RA R  EG YQC A N  G A+S +  ++++    +       + V    SA+L C+ P   P   I W++      L    +D R     NG+L+ + +   D  + Y C +   + +T+++    K+ ++P S         ++   ++    VL    + L CI        ++WF+     AE+ P ER + +    TL ++N+   D G Y+C      N L ++       I     P ++   P  + V     T   C+A+G P+P IRW  NG  I    N     + G+ + L+NL      V QC A+N +G +  NAF+NV    P +L P  K    V+   V I C  F+ P P  +W   +     I  N +    +  L++  +   DAGVY C   N   + ++ + ++I++PT+I+      R Q     T EC A  D     +L I W+     L     H   +  S L + ++T  D G Y C AS  +D    +  L V  +P+   D+++  ++  + R   LTW  G  NN  I   + E+    ++P  W  +     +  +++            ++ PY+ Y FR+ +VN +G S+P S+    C      P INP  V   GTNP  + I W  +  ++ NGP   Y ++ R      +  T++     T    S +V+S   +         +  YE+ +++ N +G     P    G+SGE  P   P N+R++ +    +K+ W  +    L  + G   GY + +
Sbjct:    8 PPAITAQSPKNYIVDPRDN-IEIKCEAKGNPPPSFHWTKDGVDFHPEADERVQMRGDSGTLVVDVVGGGRAER-YEGEYQCRASNSGGTALSDRITVQLSRSPLWPKEVIDPVQVKEGSSAVLPCNPPPGIPLPVIFWMD----HVLQRLSQDERVSQGLNGDLYFSNVRASDARDDYICYARFVYTQTIQQKQPIKLTVQPGSRVDLYPPRFLSPVGASSTKMVLKGDVLSLECIAAGLPTPRIQWFK---SGAEM-PWERAKLLNFNKTLILANVTEGDDGNYVC---LASNRLGVQRHTTTVAIEDTAAPYWLTGGPESRVVQPGEQTTIMCRATGNPKPSIRWLLNGGPIEEAGNDPNRKVDGDTIILSNLPEGTSAVYQCEATNKHGSILGNAFVNVLAVPPRILSPMNKVYSAVVNQTVHIECKVFASPQPTFMWYVPNTQ-TCISINGFDSAASDTLVVPRVQKGDAGVYTCHVQNYLNKNQSLARLLIKDPTRIVQPPSELRAQRFGVATFECHATHD--PSLSLNISWFHDGYPLPESPRHE--LEGSGLTIVNVTEEDVGHYKCRASTELDHAEAEARLTVIDRPDSPMDLELTNRQDLSVR---LTWNPGSENNDPIKEFVVEYEEDWFEPGVWHRLSSFPGSRNSVL----------LDSLSPYVSYRFRVVAVNSVGPSEP-SLPTERCLTVSASPQINPSGVKGEGTNPTNMIISWTPMRGVDQNGPGFGYRVSWRLQSSGDAEWTTE-----TVLNRSHVVVSGTPT---------FSPYEIRVRAVNNIGLGPE-PDVVIGYSGEDVPLESPKNVRVEVLNSTIIKVTWEPV---PLESVRGHILGYTVHY 824          
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004759.1 (pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 gene:ENSPMAG00000004331.1 transcript:ENSPMAT00000004759.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 196.438 bits (498), Expect = 3.016e-53
Identity = 152/590 (25.76%), Postives = 252/590 (42.71%), Query Frame = 3
Query:  135 PPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIER----AIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINV----VEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEG 1856
            PP+  +Q P   ++  ++  I++ C AK  P+ +Y W KN  S +      ++     GS    +      + +EG YQC+  N LG A+S K +LR+A    +       ++V    S +L C  P   PP  I W+       L    +D R     +G+L+ + +   D  + Y C +     RT+      K+K++      + L  L+T +        L  +T+++ CI        VRW R     +   P+ RF T     TL +  +E +D+GQY C       + +  F + V       P +  +P D+ VA     +  C A G+P PE  W  NG+ +          + G+++ L  L      V QC ASN++G +  NA ++V    P  +   ++    V K  V ++C  F  P P I W KD   +N +   K+   +NG+L I      D G+Y C A+N        + + +RE T I    P +R ++  D T+E   R        L I W K    +++  ++      + L + +++  D G Y C A   +D    + EL V G
Sbjct:    2 PPAITKQSPTDHYVDPLED-ILVKCEAKGTPAPSYRWTKNDKSFDPRAEVGVVTAAGSGSFTFVKNSTGHAKRHEGDYQCLVSNKLGTAVSDKIKLRIASTPKWPKEVLDPMEVDEGNSVVLPCKPPQGVPPPKILWMT----STLDHIGQDKRVSQGLSGDLYFSNVKPVDSRDDYICYAQFVASRTIISKEPIKLKVRSPGGLRNRLPSLLTPHGKTTRMHSLKGSTLVMECIAEGLPTPDVRWERV----SGHMPRGRFSTGNHNKTLRLHPVEVEDSGQYKCIASNNMGSAHHSFVVTVDGSRAAAPYWTARPEDRIVAPGDDAVLHCVAGGKPPPETHWLLNGKPLNEAPAEPHRTVKGDRIVLKKLVIGQSAVYQCVASNVFGTIIANALVSVLAVPPKFITKDKEEYVVVEKQPVLLDCKVFGSPKPAIRWSKDG-QVNTLQDKKFKEFENGSLYIHEAKKADQGLYMCEATNDLDTGTINAKLRVREATHI---EPFERLRVRKDGTVELECRVTHDPDLELNIYWEKDG--MELSGTNWFMTDKNTLTINNVSEVDQGIYICVAHTFLDLARAEAELTVIG 576          
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Match: cntn3b (contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645])

HSP 1 Score: 188.734 bits (478), Expect = 7.280e-49
Identity = 218/872 (25.00%), Postives = 359/872 (41.17%), Query Frame = 3
Query:  126 ASFPPSFIQQPPKGEFLYQM-DTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENE--GSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWV--NVKDYGRLISFEEDNRRVLDN-NGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGS----VRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC--EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGN-KLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMN-VQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQ---------EGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLG---TSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMG---FSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQW-SIIYENQLSRINGF 2651
              + P F+++P    +L +  +  +   C A   P   Y WLKNG  +         G   I R   E    G +QC+  N +G  IS +  L+ A++ S+ S    T+ V      +L C  P      +  W+   + DY R      D RR +    GNL+I K+   D G  Y+C+  N    T      T + IK    S    +P I +   + +   LL  TV L C F+ G+    + W R++D      P + +  +     LEI N + +D G Y C  E V  +N+   K T  V   P +I    +    I     ++C+A G+P P  RW  NG  +    +  R  +  N +L L  L   D  + QC A N +G +Y++  + V    P     P K +    +     I C   + P P   W K   N  ++   + S+  NG+L I+++   DAG Y C   N  G   +   +I++E T+I  V   K   +G  +   C A  D            G+ + +E  K  E  ++++  S +  S +  ++ L  R  G Y C A   +D       L V G P P   +  +    +  R   LTW  G +N++ I S+  +         WL +     T   II  ++  +  T V + P++ Y F + ++N LG    S+PS M     + +   P + P+ +   G + + L I W+ +      GP++ Y L  R      + + +  Q+ I   ++ R V        +   +  Y  +EV I+  N  G   FS    V    +S E+ P + PSN+   ++T    ++ W +    +   RI G+
Sbjct:    4 GEYGPLFLEEPEDVTYLVESSEKKVSFRCRASGHPPPLYRWLKNGTEVPITGHYSLAGGSLIVRNPSEGRDGGVFQCLVTNSVGSIISVEARLQFAYLESFRSKPRGTVAVRQGQGVVLICAPPPYSGELTFVWLFNEMYDYMR-----SDGRRFVSQVTGNLYIAKVEATDVGS-YTCMVHNTVTNTRVASPPTPLLIK-SGRSMGEYEPRIEV-GFSPKTHTLLGHTVRLEC-FALGNPVPVISW-RKIDGQL---PSKAY-LMEANAVLEIPNFQHEDGGNYECNAENVAGKNSAQGKIT--VYAPPHWIQPISNVEQGIGDKLSWDCKAGGKPPPTYRWLRNGVPL---PSESRFSVMANGELILQELQPWDRGMYQCLAENKHGRIYSHGELRVKASAPDFRSNPLKRVTPAARGGQAVIKCEPKAWPRPSFTWTKG--NAMVMDNERMSITQNGSLWIRSVTDEDAGTYTCTVENHLGSANSTGRLILKESTRITVVPSLKMVSVGESIVWPCQASHDPSLDIVFVWSLNGQRIDME--KDAEHYQLLQG-SKSQTSDLALIKRLQLRHRGNYTCTAQTSVDNTSAWAMLMVRGPPGPPGAVVAEEATSTTVR---LTWKRGSNNHSPIISYKIQARAPVASTGWLNV----HTSPDIISGDS--EQATVVGLTPWMDYEFTVLAINALGESEASRPSRM----IKTQSAGPELAPERLGGGGGHQHELVITWQPVAPQFQYGPDVGYTLAFR-----ENGTKAWRQVTIPKAESYRYVY-------RSDNLAPYAPFEVKIKMYNFNGEGPFSNNTIV----YSAENAPKVAPSNVTARSLTSAEAEVSWRAPPLTSSTERITGY 822          
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008186.1 (pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 gene:ENSPMAG00000007342.1 transcript:ENSPMAT00000008186.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 160.999 bits (406), Expect = 7.181e-40
Identity = 211/860 (24.53%), Postives = 355/860 (41.28%), Query Frame = 3
Query:  243 WLKNGHS-IENLIVNQDEGS-LRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISS--YSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRR------VLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERK-DAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIF-ECQ-ASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQ-----CNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLN------LILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTII-IREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL---------KVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPS-SMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLN-HNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIK 2714
            W  NG        V+  +G  L +  A R + G+YQCVA    G      + L +   S    SS  ER +      S  L+C      PP +I W    D    +S +  +RR        D  G L++T      DG +Y C + N   +   +    +I ++     S  ++P+  +         L    +     +   S+RW R+        P    QT+    TL ++++++  D G YIC  + +      +  I  V++P  I QPF+         ++  C   SG+    I W  +GQ +   L G ++       ++++L   +VT +      C A N    V   + + V  R P   V   K   G+    V +NC A   P P+IIW+    N N      L    ++    NG+L+++ +   D G Y C  SN  G   ++S ++ ++ P  + S +       G    L+CSAR     GE   I  W+K E L          V    +   L S L++      DSGF+ C+A N    D   I+L V+  P+P  +++V   R  N R   L W  GF  N+ IT+   E+  + D   W       E  Q     ++ I   T + +HP   Y FR+ + N++G S+PS  + I   +   + P   P +V +   +  ++ + WK +P+ +  NG    Y +  R  +   S + S+F I        R+  +    +  L  ++ + RY V +Q+ N  G S     + +  + E  P+  P+N++  +I+  ++ L WS    +     NG  +GYR+ +       EL D++
Sbjct:  181 WFHNGDPPTPTASVSGAQGERLSVHAAGRSDGGTYQCVARGEGGDTAQDFSILMLEDGSPKIASSFSERVVSPGEPFS--LQCVV-RGSPPPTIAWT--LDGEPALSRDAPHRRGNHIVTPGDVTGYLNVTGA-RVTDGGVYRCQAGNAAGQAEYQ---ARINVR----GSPSIRPMRNVTAIAGREAYLHCRVIG----YPYYSIRWLRE----GTPLPYNHRQTVFANGTLRLADVQKGMDEGAYICSVLVQPGASPSRSLIVTVKEPPLI-QPFEMPAVTQGQRVYVPCVIVSGDSPIRITWHKDGQPLPPRL-GAQVE---TTEFISSLLIPNVTQLHNGNYTCLARNEAATVSHGSQLIV--RVPPRFVVQPKDQDGIFGKPVVLNCSADGYPIPKIIWKYSKGNGNPQFQPVLSGGGRFQPLGNGSLLLRQVQEEDGGFYLCQVSNGVGTDISKSMLLNVKIPALVTSQANVTLATRGQHSNLQCSAR-----GERPIIIRWEKEETLIDPERMFRYVVYTQDTGDELLSTLQILPTVRGDSGFFTCHAINSYGEDRGLIQLTVQEPPDP-PEVEV---REVNARTITLRWTSGFDGNSPITAFDIEYKNRSD--TW-------EQKQRTKDISSTINQATIIDLHPATHYVFRVYAKNRIGASEPSKDLPITTQEAAPDGP---PLEVILEPQSSQSIRVTWK-VPHGHLRNGVIRGYQIGYREAEPG-SGALSQFNI-------VRLESTGERESCLLHHLKKFTRYAVMVQAFNLAG-SGPSSSEAYAATLEDVPSKPPANIQAASISADAITLSWSPPPRDAH---NGLLQGYRVIYYPVLPDGELGDVR 978          

HSP 2 Score: 67.0106 bits (162), Expect = 3.852e-11
Identity = 104/445 (23.37%), Postives = 163/445 (36.63%), Query Frame = 3
Query:  546 ISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRG-----ADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVE--KPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKL--------YLNNLTTK--DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSN-DAGVYECLASNIFGQTKNESTII-IREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGEN-LKIEWWKKNELLKV---VKSHSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            +    D RR    +G L IT    ED G  Y C   N+F      G     A   +++ P     H LK  ++              +  +S     G V WF   D           Q    G  L +    R D G Y C    E       F+I ++E   P   +   ++ V+       +C   G P P I WT +G+     L+ D  H  GN +        YLN    +  D  V +C A N  G     A INV     +    P + +  +      ++C     P   I W ++     L   ++ ++  NG L + ++    D G Y C      G + + S I+ ++EP  I         Q G  V + C     I  G++ ++I W K  + L      +  +   +SS+L + ++T   +G Y C A N
Sbjct:   96 VPLPPDRRRGAGGSG-LVITDTTVEDSGA-YVCEVWNSFGVAAVSGRLTIKAPVVVRVDP-----HRLKTTLS---------GTAEFSCEVSGAAGDGMVTWFHNGDPPTPTASVSGAQ----GERLSVHAAGRSDGGTYQCVARGEGGDTAQDFSILMLEDGSPKIASSFSERVVSPGEPFSLQCVVRGSPPPTIAWTLDGEPA---LSRDAPHRRGNHIVTPGDVTGYLNVTGARVTDGGVYRCQAGNAAGQAEYQARINVRGSPSIR---PMRNVTAIAGREAYLHCRVIGYPYYSIRWLRE--GTPLPYNHRQTVFANGTLRLADVQKGMDEGAYICSVLVQPGASPSRSLIVTVKEPPLIQPFEMPAVTQ-GQRVYVPCV----IVSGDSPIRITWHKDGQPLPPRLGAQVETTEFISSLL-IPNVTQLHNGNYTCLARN 506          
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010567.1 (pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1 gene:ENSPMAG00000009565.1 transcript:ENSPMAT00000010567.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 137.887 bits (346), Expect = 6.656e-33
Identity = 126/533 (23.64%), Postives = 214/533 (40.15%), Query Frame = 3
Query:   51 LIMQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIEN----------LIVNQDEGSLRI--ERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKP--LITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLN-----GDRIHL-HGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQIN------CLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIRE 1571
            LI +P   +  +  + +       +   PP   + P   + +        L C A+  P+   EW K+G  +E           L+       LRI   R  + +EGSY CVA NYLG A+S    L +A I          + V     A++EC  P  +P  ++ W   K  G  ++  + + RV    G L I+     D G +Y C+ TN         A+  +  +P    +   KP  L+ L +S+ E    ++            +VRW ++   + ++    RF+ I+   TL +  +   D G Y C             ++ V   P F+ +P D+ VA   S  F C+ +G P P + W   G +   + N       R  +     L + ++   D     C A ++ G +   A + V +   L   PP    +G     + +       C A  +P P + W KD   L+L  + +  +   G L IK++   DAG+Y C+A +  G+T   + + ++E
Sbjct:    1 LIQKPPHGHRTHVLVCVCEWSRLRQEDAPPRIAEHP--SDLIVSRGEPATLNCKAEGRPAPTVEWYKDGERVETDRDDPRSHRMLLPTGSLFFLRIVHGRRTKTDEGSYVCVARNYLGEAVSRNASLEVANIRRNYRSSPSAVKVAAREPAVMECRPPRGHPEPTVSW---KRNG--VALTDKDERVTIRGGKLMISNTQKADAG-MYVCVGTNMVGERDSEPAELAVFERP----TFARKPMNLVMLADSDAEFRCEVHGDPPP-------TVRWRKE---DGDLPKGSRFE-IQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLVVHAPPQFVVRPRDQIVAQGQSATFLCETTGNPPPAVFWQREGSQNLLFPNQPSQPSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDA--LADSPPPIIRQGPANQTLAVGSVALLACQAMGMPTPSVHWLKDGSKLSL-GSARLGLQSGGTLSIKDVQLMDAGLYTCVAVSPSGETTWSAFMDVQE 507          

HSP 2 Score: 105.145 bits (261), Expect = 6.247e-23
Identity = 110/482 (22.82%), Postives = 192/482 (39.83%), Query Frame = 3
Query:  465 AILECDRPNCYPPASIQWVNVKDYGRLISFEEDNR--RVLDNNGNLHITKII-----DEDDGEIYSCISTNNFLRTMKRGADTKI-------KIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC---EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGN-KLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTN-------KYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIRE-----PTKIISVSP-NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNA 1805
            A L C +    P  +++W   KD  R+ +  +D R  R+L   G+L   +I+       D+G  Y C++ N     + R A  ++       +  P ++     +P +                  + C   RG    +V W R       +  K+   TIR G  L ISN ++ DAG Y+C     V E+++   +    V E+P F  +P +  +  +S   F C+  G+P P +RW    +E G    G R  +  +  L +  +   D     C   N  G    +A + V +  P  +V P+  I      +    C     PPP + W+++  + NL+  N       ++S+   G+L I ++  +D+G Y C A ++ G    ++ + + +     P  II   P N+   +G    L C A           + W K    L +  +         L ++ +   D+G Y C A
Sbjct:   47 ATLNC-KAEGRPAPTVEWY--KDGERVETDRDDPRSHRMLLPTGSLFFLRIVHGRRTKTDEGS-YVCVARNYLGEAVSRNASLEVANIRRNYRSSPSAVKVAAREPAV------------------MECRPPRGHPEPTVSWKR---NGVALTDKDERVTIRGGK-LMISNTQKADAGMYVCVGTNMVGERDSEPAELA--VFERPTFARKPMNLVMLADSDAEFRCEVHGDPPPTVRWR---KEDGDLPKGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLVV-HAPPQFVVRPRDQIV-AQGQSATFLCETTGNPPPAVFWQREG-SQNLLFPNQPSQPSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEVGDALADSPPPIIRQGPANQTLAVGSVALLACQA----MGMPTPSVHWLKDGSKLSLGSARLGLQSGGTLSIKDVQLMDAGLYTCVA 490          

HSP 3 Score: 81.2629 bits (199), Expect = 1.307e-15
Identity = 73/323 (22.60%), Postives = 134/323 (41.49%), Query Frame = 3
Query:  930 RKDAGQYICEP---VEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQAS-GEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTN-AFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQI---GLDVTLECSARTDIQEGENLKIEWWKK----NELLKVVKSHSAAILS----SVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQV 1850
            + D G Y+C     + E  + N    +  + +  + + P    VA     + EC+   G P P + W  NG  +      +R+ + G KL ++N    D  +  C  +N+ G   +  A + V+ R P     P   +  +   + +  C     PPP + WRK+  + +L   +++ + D+  L ++ +   D G Y C+  N  G+ +  +++++  P + + V P  R+QI   G   T  C        G      +W++    N L     S  ++  S      L +  +   DSG+Y C A +     L K  L+V
Sbjct:  101 KTDEGSYVCVARNYLGEAVSRNASLEVANIRR-NYRSSPSAVKVAAREPAVMECRPPRGHPEPTVSWKRNG--VALTDKDERVTIRGGKLMISNTQKADAGMYVCVGTNMVGERDSEPAELAVFER-PTFARKPMNLVM-LADSDAEFRCEVHGDPPPTVRWRKE--DGDLPKGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLVVHAPPQFV-VRP--RDQIVAQGQSATFLCET-----TGNPPPAVFWQREGSQNLLFPNQPSQPSSRFSVSQTGHLTITDVQRSDSGYYTCQALSVAGSILAKALLEV 408          

HSP 4 Score: 55.4546 bits (132), Expect = 9.505e-8
Identity = 65/302 (21.52%), Postives = 107/302 (35.43%), Query Frame = 3
Query: 1017 PIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLH----GNKLYL----NNLTTKDVTVIQCNASNIYG-YVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCL-AFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNEST--------IIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSS-VLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE 1865
            P     P D  V+        C+A G P P + W  +G+ +    +  R H      G+  +L       T  D     C A N  G  V  NA + V N +      P   +K   +    + C      P P + W+++   + L   ++      G L+I N    DAG+Y C+ +N+ G+  +E             R+P  ++ ++ +       D    C    D        + W K++  L   K     I     L++E +   D G Y C   N +        L V   P+
Sbjct:   30 PRIAEHPSDLIVSRGEPATLNCKAEGRPAPTVEWYKDGERVETDRDDPRSHRMLLPTGSLFFLRIVHGRRTKTDEGSYVCVARNYLGEAVSRNASLEVANIRRNYRSSPSA-VKVAAREPAVMECRPPRGHPEPTVSWKRN--GVALTDKDERVTIRGGKLMISNTQKADAGMYVCVGTNMVGERDSEPAELAVFERPTFARKPMNLVMLADS-------DAEFRCEVHGDPPP----TVRWRKEDGDLP--KGSRFEIQDDYTLRVERVGGTDEGTYTCVGENRVGKAEASASLVVHAPPQ 315          
BLAST of Neuroglian vs. Ensembl Nematostella
Match: EDO45343 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT95])

HSP 1 Score: 167.162 bits (422), Expect = 1.224e-41
Identity = 239/1058 (22.59%), Postives = 422/1058 (39.89%), Query Frame = 3
Query:  243 WLKNGHSIENL------IVNQDEGSLRIERAI---RENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTID---VFYDGSAILEC-DRPNCYPP--ASIQWVNVKDYGRLISF-EEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGA-DTKIKIKPDSISSH--LLK-------PLITLYXX----XXXXXXXXXXXXXXXCIFSRG-----SVRWFR----QLDKNAEIKPKERFQTI--RKGTTLEISNIERKD-AGQYICEPVEEQNTLNIKFT-INVVEKPIFINQPFDKT-VAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTT-KDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQI--GLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIE------LQVEGKPEPVSDIQV-DCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMT-INNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDC-DY------SPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMG---FSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQ-----------FSNSGNSEKNHKIRDPDQLRERISDLKSETK 3188
            W K+G  +  L      I ++ +G  +++  I    ++ G++QC A N  G+  S K  + + +I  +++  E  ++   V      +L+C +R   YP   AS  W N       I+   + +   +  NGNL    + + D   I      +++ R  K G     ++    + +SH  LLK       PL  ++          + +   +  L C+         ++RW R      DK   +  K  F     + G  L IS + ++   G Y C     Q     + + + V   P +I +P  K  + +    +  C+A G+P P   W  NG +I   +N   + +  NKL    +   +   + QC A N YG V +   + +  RKP ++     YI    K   +I C + + P    +W KD   L++  + +YS+    +L+I  +  ND G Y C A+N+ G     +   + E TK I+V P+   ++  G      C A  D +    LK +W K    L+  ++ +       LKL      D   Y C A    D  L+  E        V+G P P S++ + +C   +     ++TWV G      IT +  E  ++++   W ++  V++   T ++          + + P+ K  FR+R+VN +G S+ S  T +  C+ ++ RP + P +        N L   W  +  L  N P   Y L  R     D+      +PST+K+ I    +                     Y+ +E  I + N +G    S ++  +    SG+  P  KP NL+   +T  +V L W  +  ++ S ++G+   +  +    +   E                 P     R + PV     ++      S  G     T+ G+   ++  +  +  N    GP+S+ +   T E  PG VA+ ++           W  PL +NG+L GY I   ++ Q           F+  G ++  H   D +Q    I  LK++T+
Sbjct:  118 WEKDGKLLAELEFKYEIITDKQKGVSKLKVQIPRPSQDNGNFQCFAENAEGKVFSRKIRVVVTYIGKFTNQDENYVEEKQVTVGQPFMLKCPERNTKYPQFGASYYWGNKDSTTNTINLLPQSSNIAMTQNGNLVFLYVTEADLKTI------DDWGRGAKNGTIQCNVQAGTTTYTSHKFLLKQVGTDNSPLKPVFVQDGEPKTLESAIQGKSKALFCVAQMSPAPNNAIRWVRVDSVTNDKLPIVDGKNGFSIPEDKSGRNLIISQVSKEQHEGVYQCIVENNQGKTESQLSQLKVFVPPGWIVKPPPKMNIPMYGGAVLLCEAFGDPTPAYGWYVNGSKI---VNSQHLIVTNNKLTFKAVELYEHAGIYQCVAENDYGMVVSTTVVEIDARKPGIIGFGPFYIFKDTKG--EIKCDSNAAPAANHVWSKDDQVLSI--SGRYSLGPGNSLVITPVQQNDEGKYTCKATNLLGTDTKSNDATVYERTK-ITVRPDASVELIKGKPTDFRCQATADPRLMNILKYKWLKDGTELQYTENINWIPNQLRLKLSEADIDDGAVYTCVAYT--DDKLKYSEDRASSIANVQGVPFPPSNLTITNCYNLTT----VITWVPGSSTGKPITHYQIEQESEFEAGVWQILKKVDDPKSTSLQ----------LQLTPWAKLRFRMRAVNSVGPSRASLPTPVGACETKVSRPTMVPKNFRGVPGKANELDAAWTPLTKLEQNAPGCKYVLKYRKSGAKDWQKVTIDNPSTAKYSILNPGY---------------------YELWEFMIYATNDIGDGPQSDIIKSR----SGQDAPKDKPKNLKKGVVTARTVSLTWDRVTVDRGS-VDGYISYHWFKTIETQNDQET----------------PVRTRRRREIPVGAQTYKLNATSQPSQSG-----TVRGLTPFSSYTLVLKAFNSGGEGPESDAITFDTNEDVPGIVADVDVTPFAKYIFAQ-WGPPLESNGVLLGYAIAAVKHTQGQPDPPMNSVKFTELGTNKLEHLFEDVEQESHYIIYLKAKTR 1097          
BLAST of Neuroglian vs. Ensembl Nematostella
Match: EDO46946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNL2])

HSP 1 Score: 93.2041 bits (230), Expect = 9.789e-21
Identity = 61/200 (30.50%), Postives = 92/200 (46.00%), Query Frame = 3
Query:  939 AGQYICEPVEEQNTLNIKFTINVVE-KPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFG 1535
            AG+Y C+  +     +   TI  +E KP +I +P D    +NS+T   C ASG PR   +W  NGQ +   +   R  LH   L L  L   D  + QC  +N +G +  +A + V   +      P+     ++   V ++C     P P + WRK S  L+     +Y    +G+L I N+ S D+G Y C  SN  G
Sbjct:   62 AGKYKCKATDTSGRTDTSTTIVRMEAKPEWITRPQDTIAGVNSNTTLRCHASGAPRVFYQWYCNGQPL---VTSQRHILHQGDLILKELRYSDGGMYQCVVTNTHGQLIASAELTVAGTR-----APEASKNALVDSTVTLHCQPSGNPKPMVRWRKGSVYLS--SGPRYQFLTSGDLKISNVTSLDSGRYTCEVSNRLG 251          

HSP 2 Score: 78.1814 bits (191), Expect = 1.424e-15
Identity = 69/265 (26.04%), Postives = 107/265 (40.38%), Query Frame = 3
Query: 1071 IFECQASGEPRPEIRWTSNGQE--IGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGK 1859
            + EC   G P P+I     G    +G+     R H      Y+   T       +C A++  G   T+  I     KP  +  PQ  I GV   N  + C A   P     W     N   ++T++  +   G+LI+K L  +D G+Y+C+ +N  GQ    + + +   T+    S N    +   VTL C        G    +  W+K  +          + S  LK+ ++T+ DSG Y C  SN +    R   L V+GK
Sbjct:   18 VLECIVYGMPVPKITLRKKGVHMILGQVTGNARRH------YIPKFTANHAGKYKCKATDTSGRTDTSTTIVRMEAKPEWITRPQDTIAGV-NSNTTLRCHASGAPRVFYQWY---CNGQPLVTSQRHILHQGDLILKELRYSDGGMYQCVVTNTHGQLIASAELTV-AGTRAPEASKNA--LVDSTVTLHCQP-----SGNPKPMVRWRKGSVYLSSGPRYQFLTSGDLKISNVTSLDSGRYTCEVSNRLGSASRTGRLNVQGK 264          
BLAST of Neuroglian vs. Ensembl Nematostella
Match: EDO32296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVH4])

HSP 1 Score: 88.1965 bits (217), Expect = 3.398e-18
Identity = 91/374 (24.33%), Postives = 149/374 (39.84%), Query Frame = 3
Query:  819 RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTI--NVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNK-LYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKG---------------VLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKI---------ISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGK 1859
            R ++ WFR      E++ K     +    +L +  +   D G+Y C         N   T        P+ ++   + TV  ++  + +C+ SG P P + W  +G    R L G+   +  N  L L      D     C A+N  G  + ++   +   +P   V P+    G               +    + I+C+A  VP P IIWRKD   L  I    Y    NG+L+I+ + ++  GV+ C A+N  G+    S I +R   K+         + +     +  G+D+TL CSAR          IEW    +++ V            L L ++ + DSG Y C ASN +        + V G+
Sbjct:   70 RPTITWFRG---GEEMRTK-----VTNNGSLILEKVSSSDIGRYTCTARNAFGKDNANSTTIPPGDGSPVKVSVGDNITVITDTPLLIDCEVSGIPFPSVVWVKDG----RVLMGEGYVIFDNGTLVLRRARPADSGRYTCTANNSRGKDHISSQPTI--ERP---VAPRDIPLGDGSPTIARIADNATVLTGSRLTIDCVATGVPKPSIIWRKDGREL--IGAGSYMAPGNGSLLIQQVAASHHGVFTCTATNPVGEDSVSSNIRVRTTDKVEKSDMKPVDVRIGGQVTSLSGVDITLNCSARGLPPP----DIEWMNGGKMITVQGPR--------LVLRNVMSSDSGNYTCIASNVVGRASASTMVNVTGR 412          

HSP 2 Score: 83.5741 bits (205), Expect = 1.345e-16
Identity = 80/331 (24.17%), Postives = 131/331 (39.58%), Query Frame = 3
Query:  906 TLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPI-----FINQPFDKTVAINSSTI------FECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGN-KLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTK------------IISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWD 1826
            TL I      DAG+Y+C  V           I ++ K       + N+PF   +  N +T+        C A+G PRP I W   G+E+       R  +  N  L L  +++ D+    C A N +G    N+          + V     I  +    + I+C    +P P ++W KD     +++   Y + DNG L+++     D+G Y C A+N  G+    S   I  P              I  ++ N     G  +T++C A T + +     I W K    L    S+ A    S+L ++ +     G + C A+N +  D
Sbjct:    3 TLSIVLRRTTDAGRYVCTAVNA---------IGIIHKSTNYIVWYENRPFKTKIGNNLTTMKGRKLTLICHATGRPRPTITWFRGGEEM-------RTKVTNNGSLILEKVSSSDIGRYTCTARNAFGKDNANSTTIPPGDGSPVKVSVGDNITVITDTPLLIDCEVSGIPFPSVVWVKDG---RVLMGEGYVIFDNGTLVLRRARPADSGRYTCTANNSRGKDHISSQPTIERPVAPRDIPLGDGSPTIARIADNATVLTGSRLTIDCVA-TGVPK---PSIIWRKDGRELIGAGSYMAPGNGSLL-IQQVAASHHGVFTCTATNPVGED 309          

HSP 3 Score: 68.5514 bits (166), Expect = 8.021e-12
Identity = 93/385 (24.16%), Postives = 151/385 (39.22%), Query Frame = 3
Query:  195 IILPCYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGAD-------TKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICE---PVEEQN-TLNIKF-TINVVE----KPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNR 1292
            + L C+A   P     W + G  +   + N   GSL +E+    + G Y C A N  G+  ++ T +     S         I V  D   +++C+     P  S+ W  VKD GR++  E     V+ +NG L + +    D G  Y+C + N+      RG D        +  + P  I      P  T+       TVL  + + + C+ +   + S+ W +      E+     +     G+ L I  +     G + C    PV E + + NI+  T + VE    KP+ +      T          C A G P P+I W + G+          I + G +L L N+ + D     C ASN+ G    +  +NV  R
Sbjct:   59 LTLICHATGRPRPTITWFRGGEEMRTKVTNN--GSLILEKVSSSDIGRYTCTARNAFGKDNANSTTIPPGDGSPVKVSVGDNITVITDTPLLIDCEVSG-IPFPSVVW--VKD-GRVLMGEG---YVIFDNGTLVLRRARPADSGR-YTCTANNS------RGKDHISSQPTIERPVAPRDIPLGDGSP--TIARIADNATVLTGSRLTIDCVATGVPKPSIIWRKD---GRELIGAGSYMAPGNGSLL-IQQVAASHHGVFTCTATNPVGEDSVSSNIRVRTTDKVEKSDMKPVDVRIGGQVTSLSGVDITLNCSARGLPPPDIEWMNGGKM---------ITVQGPRLVLRNVMSSDSGNYTCIASNVVGRASASTMVNVTGR 412          
BLAST of Neuroglian vs. Ensembl Nematostella
Match: EDO45383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT26])

HSP 1 Score: 85.8853 bits (211), Expect = 3.039e-17
Identity = 92/381 (24.15%), Postives = 152/381 (39.90%), Query Frame = 3
Query:  828 VRWFRQLDK-NAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYG---------------------YVYTNAFINVWNRKP-----LLLVPPQKYIKGVLKM-------NVQINCLAFSVPPPRIIWRKDSYNLN----LILTNKYSMDDN-GNLIIKNLNSNDAGVYECLA--SNIFGQTKNESTIIIREPTKIISVSPN----KRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELL-----KVVKSHSAAI--LSSVLKLESLTTRDSGFYNCNASNG 1814
            V W +     N  + P  RF +    T L I+N+ R D+G Y C    E   ++ +  ++V   P F+N P DKT     S  FEC   G P P + W  NG  +   ++  R + +G  L + N+   D    +CNAS+I G                       YT    N    K      L +  P K+++ +          N+ + C     P   ++W KD+  L     LI+T   S+D     L I N++ +D   Y+CLA  +     +   ++++++ P K      N    +++ + L   LEC  +          + W K N  L     ++  +H  +    +S L + +L   D   Y+C A N 
Sbjct:   28 VTWLKSGSAVNTSVDP--RFYS--NDTILMITNVSRIDSGTYSCNASNELGIISAEAALDVRYGPEFVNVPQDKTPNEGWSVTFECHTKGNPPPTVTWLKNGSALNTSVD-PRFYSNGTHLMITNVNRTDSGAYRCNASSILGPENDGNETSFLMISNLNRTDEASYTCRAKNAAGEKTSGSVNLAVNYPPKFLQSLKDEETLNETDNLTLTCKLEGKPLATVVWLKDNTELEPDSRLIITQPSSVDSGESTLTIINVHRHDEAYYKCLANNTVDTTTSTTNTSVVVQYPPKFFQSPKNETVTEKSNVTLTCQLECKPK--------CSVTWLKDNTPLDTSPDRITVTHPGSYGNTTSSLTITNLVRTDEARYSCKAINA 395          

HSP 2 Score: 69.707 bits (169), Expect = 4.068e-12
Identity = 74/299 (24.75%), Postives = 114/299 (38.13%), Query Frame = 3
Query: 1032 QPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLN-------------LILTNKYSMD---------------DNGN----LIIKNLNSNDAGVYECLASNIFGQ-TKNESTIIIREPTKIISVSPNKRNQIGLD-VTLECSARTDIQEGENLK-IEWWKKNELLK------VVKSHSAAILSSVLKLESLTTRDSGFYNCNA 1805
            +P  KT        FECQ +G P P + W  +G  +   ++  R + +   L + N++  D     CNASN  G +   A ++V      + VP  K        +V   C     PPP + W K+   LN             L++TN    D               ++GN    L+I NLN  D   Y C A N  G+ T     + +  P K +    ++      D +TL C       EG+ L  + W K N  L+      + +  S     S L + ++   D  +Y C A
Sbjct:    2 EPKGKTTTEGQVVKFECQTTGNPSPNVTWLKSGSAVNTSVD-PRFYSNDTILMITNVSRIDSGTYSCNASNELGIISAEAALDVRYGPEFVNVPQDKTPNE--GWSVTFECHTKGNPPPTVTWLKNGSALNTSVDPRFYSNGTHLMITNVNRTDSGAYRCNASSILGPENDGNETSFLMISNLNRTDEASYTCRAKNAAGEKTSGSVNLAVNYPPKFLQSLKDEETLNETDNLTLTCKL-----EGKPLATVVWLKDNTELEPDSRLIITQPSSVDSGESTLTIINVHRHDEAYYKCLA 292          

HSP 3 Score: 55.8398 bits (133), Expect = 8.673e-8
Identity = 40/154 (25.97%), Postives = 66/154 (42.86%), Query Frame = 3
Query: 1350 VQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            V+  C     P P + W K    +N  +  ++  +D   L+I N++  D+G Y C ASN  G    E+ + +R   + ++V  +K    G  VT EC  + +        + W K    L            + L + ++   DSG Y CNAS+
Sbjct:   14 VKFECQTTGNPSPNVTWLKSGSAVNTSVDPRFYSNDTI-LMITNVSRIDSGTYSCNASNELGIISAEAALDVRYGPEFVNVPQDKTPNEGWSVTFECHTKGNPPP----TVTWLKNGSALNTSVDPRFYSNGTHLMITNVNRTDSGAYRCNASS 162          
BLAST of Neuroglian vs. Ensembl Nematostella
Match: EDO49554 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL8])

HSP 1 Score: 84.3445 bits (207), Expect = 1.688e-16
Identity = 132/625 (21.12%), Postives = 241/625 (38.56%), Query Frame = 3
Query:  114 MFSEASFPPSFIQQPPKGEFLYQMDTT----IILPCYAKAIPSANYEWLKNGH--SIENLIVNQDEGS---LRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECD-----RPNCYPPASIQW----VNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGT--TLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEK---PIFINQPFDKTVAINSSTI-FECQASGEPRPEIRWTSN-----GQEIGRYL-NGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRK--PLLLVPPQ--KYIKGVLKMNVQINCLAFSV---PPPRIIWRKDSYNL---NLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQ-IGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTT--RDSGFYNCNASNGIDWDLRKIELQVEGK 1859
            MFS+    P     P     L  ++ T    I L C     P     W K      +++ I    +G    L I++A +++EG Y C   N LG+A S K EL +       ++K + +    D   +   +     R   +P   ++W    V++ D GR    E+++   L         + +  DD   Y  ++ N   +  K     ++  KP        KP IT                            WFR    N  +    R     +G+   LE+  ++  DAG Y C     Q + +    + +  K   P F+     +T  + SS +  + +  G PRP + +  +       E  + L +GDR       L + NL  +D    +C  +N+ G   + A I V  R+  P   V P+  + ++ V  +  +       +   P P + W + +  +        ++   +D  +L+I    + D+G Y+C+ASN  G+T     + + E  K++    +K  + I +    E +   +I+     K+ W+K  ++L+  K+     +     +  + T   D G Y C A+N      RK ++ ++G+
Sbjct:    1 MFSKLFAAPKAGDAPSLSSQLMPVEVTEGNDIDLVCKVSVNPKPTVTWYKGDALVKLDDRISAHFDGRFSRLSIQKATKDDEGIYICDVQNELGKAFS-KVELTV----RKRNVKPQIVGEIKDAEEVERGEVRFEVRVTGFPKPRVEWYRGPVHLTDGGRFSISEKEDMYSL-------TVRDLKRDDSGTYKLVAQNTVGKCDKYTLVCRVSGKP--------KPTIT----------------------------WFRD---NTPVHTDNRVVASYEGSVSALELKEMKLSDAGLYKCTATNSQGSTSSSAEVTIKRKDAIPTFVVG-LKETEGLESSDMRLDVKIGGFPRPTVEFYKDYDLIVDSERHKILEDGDRCS-----LIITNLRPEDAGTYKCVITNLLGVETSEAVIRVQEREHAPRFDVKPEFLRKVEDVTALETEQVWFEIPIQGYPRPIVEWYRGTTRIKDGGRFTISESEENDMYSLVIDEARTEDSGPYKCVASNDAGKTTALLNLDVNE--KVVQPEFDKEVKPIEVKHGEEATTSLEIKGKPKPKVTWYKDGKVLRESKNIQLKSIGDTYSIRIVRTAPEDVGTYMCEATNKAGLASRKFDITIKGR 566          
BLAST of Neuroglian vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 328.946 bits (842), Expect = 3.428e-93
Identity = 274/1090 (25.14%), Postives = 471/1090 (43.21%), Query Frame = 3
Query:    3 FLYLLGQ*N-IFCDRYALIMQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGH----SIENLIVNQD-EGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-HSAAIL-SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            F+ LL   N  F    A  M   L  L +  I  L  +    A  P + I  PP+  F         + C AK  P   + W KNG     S++ L+  ++  G+  I     + E +G+Y+C A+N LG A+S +    +  I  +         V      IL+CD P   PP  I W+ +     L   E+D+R  +  NG+L+ + + ++D    Y C +    +RT+ + +   + + P +        L+T      E  ++    + L CI        V W    +K    +P E+F+    G  L +   E+   G+Y+C+       +   FT+ V E P F+ +P  +   I +  + +C  SG P+P   W+ NG  +   L+ +R  +  + + + N    D  V QC ASN +G + TNA I + N  P++L    +    V    V ++C  FS PP  I W KD  +  L+   ++++ DNG+L I  +   D G Y CLA N+ G +  ++ + +++PTKI++   ++   IG D  L C    D     + ++ W K +E +    + HS   L   VL + +++ RD G Y C A   +D D     L V   P+    + +  ++   +R   L WV G  +N+ IT  + EF   ++ P +W  +  V         P N   N+  + +H ++ Y FR+ +VN +G   PS  T          P+ NP+++ I G  P+ + I W+ +  + HNGP L Y ++ R  D +              WK   +   +    +  T    +  YE+ IQ+KN  G+    P    G+SGE +P+  P ++ ++ +    V + W  + +++L   +G   GYR+ W                              +R++  +     + +R   ++  G     T++G+   +   +     N +  GP S+ V  +T EG P  +  F +  ++   I +AW  PL  NGILTGY ++  +    +      +   I  PD  R  + DL+  +KY   + + T  G G
Sbjct:    9 FVALLTAVNCFFAFPSAAAMDIPLEVLTHANIEQLPTIT---AQSPGAVIALPPEESF--------AVTCEAKGNPEPEFRWTKNGQEFDPSLDPLLRKEENSGTFVIPNNGNLTEYQGTYRCFAFNKLGTAVSQEIGFMVPKIPKFPKEGFDPFKVDEGQPFILKCDPPKGIPPLQIYWMTM----YLQHIEQDDRVSMGLNGDLYFSHVEEKDSRRDYCCFAAFPKIRTIVQKSAMSVVVSPTNSILQRKPSLLTPPGVRSEAVLVKGEDLKLECIAEGIPTPKVEW----EKMGHGRP-EKFRLENHGKVLVVPGDEQDVGGKYMCKAKNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLSANR-KIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSAVEDQGVMMHCKVFSSPPSTIFWSKDDSS-ELVTGPRFTVHDNGSLEIHTIEKGDTGQYTCLAKNLEGTSAIDAMLYVKDPTKIVAPPQDQSILIGTDAQLSCLVEFDESFRGDFELLWQKDDEEISPNNTEHSRYFLEEGVLHIVNVSHRDQGEYRCVAKTPVDSDAASARLIVLDVPDAPQSVVLSERK---NRSVKLRWVPGEDHNSSITEFVIEFEENKWQPGSWRDLQRV---------PGN--HNSAVLDLHGHVGYRFRVYAVNAVGAGPPSKPT-ERYLTPPAAPDKNPENIKIEGHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRQDVE------------DEWKEHTVKRHSFVVRNTPT----FVPYEIKIQAKNHQGWGPE-PKMVTGYSGEDFPSAAPDDVAVEVMNSSMVNVTWKQVPKDKL---HGHLGGYRVNW------------------------------WRMRSLLHSKQSQGERHT-AAFPGSRSHGTVSGLVPFSEYSLIVMSFNGRGNGPGSKAVNFKTLEGVPEKIPVFRVADVQKRSISLAWTPPLEPNGILTGY-LLEYQLINDTEEAGPLQRVNISKPDTTRWHLRDLEPLSKYRFQLRSCTSMGCG 1009          
BLAST of Neuroglian vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 327.02 bits (837), Expect = 1.442e-92
Identity = 279/1098 (25.41%), Postives = 476/1098 (43.35%), Query Frame = 3
Query:    3 FLYLLGQ*N-IFCDRYALIMQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGH----SIENLIVNQD-EGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKP------DSISSHLL-KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-HSAAIL-SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            F+ LL   N  F    A  M   L  L +  I  L  +    A  P + I  PP+  F         + C AK  P   + W KNG     S++ L+  ++  G+  I     + E +G+Y+C A+N LG A+S +    +  I  +         V      IL+CD P   PP  I W+ +     L   E+D+R  +  NG+L+ + + ++D    Y C +    +RT+ + +   + + P      D  +S L  KP L+T      E  ++    + L CI        V W    +K    +P E+F+    G  L +   E+   G+Y+C+       +   FT+ V E P F+ +P  +   I +  + +C  SG P+P   W+ NG  +   L+ +R  +  + + + N    D  V QC ASN +G + TNA I + N  P++L    +    V    V ++C  FS PP  I W KD  +  L+   ++++ DNG+L I  +   D G Y CLA N+ G +  ++ + +++PTKI++   ++   IG D  L C    D     + ++ W K +E +    + HS   L   VL + +++ RD G Y C A   +D D     L V   P+    + +  ++   +R   L WV G  +N+ IT  + EF   ++ P +W  +  V         P N   N+  + +H ++ Y FR+ +VN +G   PS  T          P+ NP+++ I G  P+ + I W+ +  + HNGP L Y ++ R  D +              WK   +   +    +  T    +  YE+ IQ+KN  G+    P    G+SGE +P+  P ++ ++ +    V + W  + +++L   +G   GYR+ W                              +R++  +     + +R   ++  G     T++G+   +   +     N +  GP S+ V  +T EG P  +  F +  ++   I +AW  PL  NGILTGY ++  +    +      +   I  PD  R  + DL+  +KY   + + T  G G
Sbjct:    9 FVALLTAVNCFFAFPSAAAMDIPLEVLTHANIEQLPTIT---AQSPGAVIALPPEESF--------AVTCEAKGNPEPEFRWTKNGQEFDPSLDPLLRKEENSGTFVIPNNGNLTEYQGTYRCFAFNKLGTAVSQEIGFMVPKIPKFPKEGFDPFKVDEGQPFILKCDPPKGIPPLQIYWMTM----YLQHIEQDDRVSMGLNGDLYFSHVEEKDSRRDYCCFAAFPKIRTIVQKSAMSVVVSPRKSESPDGANSILQRKPSLLTPPGVRSEAVLVKGEDLKLECIAEGIPTPKVEW----EKMGHGRP-EKFRLENHGKVLVVPGDEQDVGGKYMCKAKNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLSANR-KIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSAVEDQGVMMHCKVFSSPPSTIFWSKDDSS-ELVTGPRFTVHDNGSLEIHTIEKGDTGQYTCLAKNLEGTSAIDAMLYVKDPTKIVAPPQDQSILIGTDAQLSCLVEFDESFRGDFELLWQKDDEEISPNNTEHSRYFLEEGVLHIVNVSHRDQGEYRCVAKTPVDSDAASARLIVLDVPDAPQSVVLSERK---NRSVKLRWVPGEDHNSSITEFVIEFEENKWQPGSWRDLQRV---------PGN--HNSAVLDLHGHVGYRFRVYAVNAVGAGPPSKPT-ERYLTPPAAPDKNPENIKIEGHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRQDVE------------DEWKEHTVKRHSFVVRNTPT----FVPYEIKIQAKNHQGWGPE-PKMVTGYSGEDFPSAAPDDVAVEVMNSSMVNVTWKQVPKDKL---HGHLGGYRVNW------------------------------WRMRSLLHSKQSQGERHT-AAFPGSRSHGTVSGLVPFSEYSLIVMSFNGRGNGPGSKAVNFKTLEGVPEKIPVFRVADVQKRSISLAWTPPLEPNGILTGY-LLEYQLINDTEEAGPLQRVNISKPDTTRWHLRDLEPLSKYRFQLRSCTSMGCG 1017          
BLAST of Neuroglian vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 326.635 bits (836), Expect = 1.684e-92
Identity = 266/1052 (25.29%), Postives = 462/1052 (43.92%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGH----SIENLIVNQD-EGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKP------DSISSHLL-KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-HSAAIL-SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+   Q P        + +  + C AK  P   + W KNG     S++ L+  ++  G+  I     + E +G+Y+C A+N LG A+S +    +  I  +         V      IL+CD P   PP  I W+ +     L   E+D+R  +  NG+L+ + + ++D    Y C +    +RT+ + +   + + P      D  +S L  KP L+T      E  ++    + L CI        V W    +K    +P E+F+    G  L +   E+   G+Y+C+       +   FT+ V E P F+ +P  +   I +  + +C  SG P+P   W+ NG  +   L+ +R  +  + + + N    D  V QC ASN +G + TNA I + N  P++L    +    V    V ++C  FS PP  I W KD  +  L+   ++++ DNG+L I  +   D G Y CLA N+ G +  ++ + +++PTKI++   ++   IG D  L C    D     + ++ W K +E +    + HS   L   VL + +++ RD G Y C A   +D D     L V   P+    + +  ++   +R   L WV G  +N+ IT  + EF   ++ P +W  +  V         P N   N+  + +H ++ Y FR+ +VN +G   PS  T          P+ NP+++ I G  P+ + I W+ +  + HNGP L Y ++ R  D +              WK   +   +    +  T    +  YE+ IQ+KN  G+    P    G+SGE +P+  P ++ ++ +    V + W  + +++L   +G   GYR+ W                              +R++  +     + +R   ++  G     T++G+   +   +     N +  GP S+ V  +T EG P  +  F +  ++   I +AW  PL  NGILTGY +  +       +G  ++ + I  PD  R  + DL+  +KY   + + T  G G
Sbjct:   38 PTITAQSPGAVIALPPEESFAVTCEAKGNPEPEFRWTKNGQEFDPSLDPLLRKEENSGTFVIPNNGNLTEYQGTYRCFAFNKLGTAVSQEIGFMVPKIPKFPKEGFDPFKVDEGQPFILKCDPPKGIPPLQIYWMTM----YLQHIEQDDRVSMGLNGDLYFSHVEEKDSRRDYCCFAAFPKIRTIVQKSAMSVVVSPRKSESPDGANSILQRKPSLLTPPGVRSEAVLVKGEDLKLECIAEGIPTPKVEW----EKMGHGRP-EKFRLENHGKVLVVPGDEQDVGGKYMCKAKNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLSANR-KIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSAVEDQGVMMHCKVFSSPPSTIFWSKDDSS-ELVTGPRFTVHDNGSLEIHTIEKGDTGQYTCLAKNLEGTSAIDAMLYVKDPTKIVAPPQDQSILIGTDAQLSCLVEFDESFRGDFELLWQKDDEEISPNNTEHSRYFLEEGVLHIVNVSHRDQGEYRCVAKTPVDSDAASARLIVLDVPDAPQSVVLSERK---NRSVKLRWVPGEDHNSSITEFVIEFEENKWQPGSWRDLQRV---------PGN--HNSAVLDLHGHVGYRFRVYAVNAVGAGPPSKPT-ERYLTPPAAPDKNPENIKIEGHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRQDVE------------DEWKEHTVKRHSFVVRNTPT----FVPYEIKIQAKNHQGWGPE-PKMVTGYSGEDFPSAAPDDVAVEVMNSSMVNVTWKQVPKDKL---HGHLGGYRVNW------------------------------WRMRSLLHSKQSQGERHT-AAFPGSRSHGTVSGLVPFSEYSLIVMSFNGRGNGPGSKAVNFKTLEGVPEKIPVFRVADVQKRSISLAWTPPLEPNGILTGYLLEYQLINDTEEAGPLQRVN-ISKPDTTRWHLRDLEPLSKYRFQLRSCTSMGCG 1011          
BLAST of Neuroglian vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 327.02 bits (837), Expect = 2.196e-92
Identity = 279/1098 (25.41%), Postives = 476/1098 (43.35%), Query Frame = 3
Query:    3 FLYLLGQ*N-IFCDRYALIMQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGH----SIENLIVNQD-EGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKP------DSISSHLL-KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-HSAAIL-SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            F+ LL   N  F    A  M   L  L +  I  L  +    A  P + I  PP+  F         + C AK  P   + W KNG     S++ L+  ++  G+  I     + E +G+Y+C A+N LG A+S +    +  I  +         V      IL+CD P   PP  I W+ +     L   E+D+R  +  NG+L+ + + ++D    Y C +    +RT+ + +   + + P      D  +S L  KP L+T      E  ++    + L CI        V W    +K    +P E+F+    G  L +   E+   G+Y+C+       +   FT+ V E P F+ +P  +   I +  + +C  SG P+P   W+ NG  +   L+ +R  +  + + + N    D  V QC ASN +G + TNA I + N  P++L    +    V    V ++C  FS PP  I W KD  +  L+   ++++ DNG+L I  +   D G Y CLA N+ G +  ++ + +++PTKI++   ++   IG D  L C    D     + ++ W K +E +    + HS   L   VL + +++ RD G Y C A   +D D     L V   P+    + +  ++   +R   L WV G  +N+ IT  + EF   ++ P +W  +  V         P N   N+  + +H ++ Y FR+ +VN +G   PS  T          P+ NP+++ I G  P+ + I W+ +  + HNGP L Y ++ R  D +              WK   +   +    +  T    +  YE+ IQ+KN  G+    P    G+SGE +P+  P ++ ++ +    V + W  + +++L   +G   GYR+ W                              +R++  +     + +R   ++  G     T++G+   +   +     N +  GP S+ V  +T EG P  +  F +  ++   I +AW  PL  NGILTGY ++  +    +      +   I  PD  R  + DL+  +KY   + + T  G G
Sbjct:    9 FVALLTAVNCFFAFPSAAAMDIPLEVLTHANIEQLPTIT---AQSPGAVIALPPEESF--------AVTCEAKGNPEPEFRWTKNGQEFDPSLDPLLRKEENSGTFVIPNNGNLTEYQGTYRCFAFNKLGTAVSQEIGFMVPKIPKFPKEGFDPFKVDEGQPFILKCDPPKGIPPLQIYWMTM----YLQHIEQDDRVSMGLNGDLYFSHVEEKDSRRDYCCFAAFPKIRTIVQKSAMSVVVSPRKSESPDGANSILQRKPSLLTPPGVRSEAVLVKGEDLKLECIAEGIPTPKVEW----EKMGHGRP-EKFRLENHGKVLVVPGDEQDVGGKYMCKAKNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLSANR-KIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSAVEDQGVMMHCKVFSSPPSTIFWSKDDSS-ELVTGPRFTVHDNGSLEIHTIEKGDTGQYTCLAKNLEGTSAIDAMLYVKDPTKIVAPPQDQSILIGTDAQLSCLVEFDESFRGDFELLWQKDDEEISPNNTEHSRYFLEEGVLHIVNVSHRDQGEYRCVAKTPVDSDAASARLIVLDVPDAPQSVVLSERK---NRSVKLRWVPGEDHNSSITEFVIEFEENKWQPGSWRDLQRV---------PGN--HNSAVLDLHGHVGYRFRVYAVNAVGAGPPSKPT-ERYLTPPAAPDKNPENIKIEGHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRQDVE------------DEWKEHTVKRHSFVVRNTPT----FVPYEIKIQAKNHQGWGPE-PKMVTGYSGEDFPSAAPDDVAVEVMNSSMVNVTWKQVPKDKL---HGHLGGYRVNW------------------------------WRMRSLLHSKQSQGERHT-AAFPGSRSHGTVSGLVPFSEYSLIVMSFNGRGNGPGSKAVNFKTLEGVPEKIPVFRVADVQKRSISLAWTPPLEPNGILTGY-LLEYQLINDTEEAGPLQRVNISKPDTTRWHLRDLEPLSKYRFQLRSCTSMGCG 1017          
BLAST of Neuroglian vs. Ensembl Medaka
Match: chl1b (cell adhesion molecule L1 like [Source:NCBI gene;Acc:101166545])

HSP 1 Score: 326.25 bits (835), Expect = 3.362e-92
Identity = 265/1052 (25.19%), Postives = 460/1052 (43.73%), Query Frame = 3
Query:  138 PSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGH----SIENLIVNQD-EGSLRIERA--IRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKP------DSISSHLL-KP-LITLYXXXXXXXXXXXXXXXXXCI---FSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-HSAAIL-SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEF-ITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKG 3230
            P+   Q P        + +  + C AK  P   + W KNG     S++ L+  ++  G+  I     + E +G+Y+C A+N LG A+S +    +  I  +         V      IL+CD P   PP  I W+ +     L   E+D+R  +  NG+L+ + + ++D    Y C +    +RT+ + +   + + P      D  +S L  KP L+T      E  ++    + L CI        V W    +K    +P E+F+    G  L +   E+   G+Y+C+       +   FT+ V E P F+ +P  +   I +  + +C  SG P+P   W+ NG  +   L+ +R  +  + + + N    D  V QC ASN +G + TNA I + N  P++L    +    V    V ++C  FS PP  I W KD  +  L+   ++++ DNG+L I  +   D G Y CLA N+ G +  ++ + +++PTKI++   ++   IG D  L C    D     + ++ W K +E +    + HS   L   VL + +++ RD G Y C A   +D D     L V   P+    + +  ++   +R   L WV G  +N+ IT  + EF   ++ P +W  +  V         P N   N+  + +H ++ Y FR+ +VN +G   PS  T          P+ NP+++ I G  P+ + I W+ +  + HNGP L Y ++ R  D +              WK   +   +    +  T    +  YE+ IQ+KN  G+    P    G+SGE +P+  P ++ ++ +    V + W  + +++L   +G   GYR+ W                              +R++  +     + +R   ++  G     T++G+   +   +     N +  GP S+ V  +T EG P  +  F +  ++   I +AW  PL  NGILTGY ++  +    +      +   I  PD  R  + DL+  +KY   + + T  G G
Sbjct:   38 PTITAQSPGAVIALPPEESFAVTCEAKGNPEPEFRWTKNGQEFDPSLDPLLRKEENSGTFVIPNNGNLTEYQGTYRCFAFNKLGTAVSQEIGFMVPKIPKFPKEGFDPFKVDEGQPFILKCDPPKGIPPLQIYWMTM----YLQHIEQDDRVSMGLNGDLYFSHVEEKDSRRDYCCFAAFPKIRTIVQKSAMSVVVSPRKSESPDGANSILQRKPSLLTPPGVRSEAVLVKGEDLKLECIAEGIPTPKVEW----EKMGHGRP-EKFRLENHGKVLVVPGDEQDVGGKYMCKAKNPLGEVVHYFTVTVEEPPEFLVEPQSQLSMIGADVVIKCSVSGSPQPVTTWSVNGVPLQETLSANR-KIFDDTIIIQNGQPSDSAVYQCEASNKHGKILTNANIMIMNLYPIILTSDGQEYSAVEDQGVMMHCKVFSSPPSTIFWSKDDSS-ELVTGPRFTVHDNGSLEIHTIEKGDTGQYTCLAKNLEGTSAIDAMLYVKDPTKIVAPPQDQSILIGTDAQLSCLVEFDESFRGDFELLWQKDDEEISPNNTEHSRYFLEEGVLHIVNVSHRDQGEYRCVAKTPVDSDAASARLIVLDVPDAPQSVVLSERK---NRSVKLRWVPGEDHNSSITEFVIEFEENKWQPGSWRDLQRV---------PGN--HNSAVLDLHGHVGYRFRVYAVNAVGAGPPSKPT-ERYLTPPAAPDKNPENIKIEGHLPHEMDINWEPLSPIEHNGPGLEYKVSYRRQDVE------------DEWKEHTVKRHSFVVRNTPT----FVPYEIKIQAKNHQGWGPE-PKMVTGYSGEDFPSAAPDDVAVEVMNSSMVNVTWKQVPKDKL---HGHLGGYRVNW------------------------------WRMRSLLHSKQSQGERHT-AAFPGSRSHGTVSGLVPFSEYSLIVMSFNGRGNGPGSKAVNFKTLEGVPEKIPVFRVADVQKRSISLAWTPPLEPNGILTGY-LLEYQLINDTEEAGPLQRVNISKPDTTRWHLRDLEPLSKYRFQLRSCTSMGCG 1011          
BLAST of Neuroglian vs. Planmine SMEST
Match: SMESG000005684.1 (SMESG000005684.1)

HSP 1 Score: 2675.2 bits (6933), Expect = 0.000e+0
Identity = 1364/1364 (100.00%), Postives = 1364/1364 (100.00%), Query Frame = 3
Query:   99 MLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSEEVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSGSVNTQSRFLKTGTGESNAFLMLRGSGTTWXXXXXXXXXXXXXXXXXXXXWRRQKILYMRGKQSTSIPDTSHIHSNLQNHPQDRYTSFVTYQSPVSENLQISFNKQTIENDYFDEKLPFCMVNMQSKLDEKIPFHSSSNLPSICHHQKSDLINSMSRTQFTPTLHRSAPNNHIPTAWTMPKSHQHLPDDIYSVSNSAVCDKVFYHPFDYKSAQTPVSTSFV 4190
            MLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYNSNLENTVLLNTTVLLSCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMTTIRIWTRIINIQYTGPKSEEVRIQTKEGTPGPVAEFNIETIEINYIEIAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSGSVNTQSRFLKTGTGESNAFLMLRGSGTTWFVILLILILGLLCGVIGLFIWRRQKILYMRGKQSTSIPDTSHIHSNLQNHPQDRYTSFVTYQSPVSENLQISFNKQTIENDYFDEKLPFCMVNMQSKLDEKIPFHSSSNLPSICHHQKSDLINSMSRTQFTPTLHRSAPNNHIPTAWTMPKSHQHLPDDIYSVSNSAVCDKVFYHPFDYKSAQTPVSTSFV
Sbjct:    1 MLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYNSNLENTVLLNTTVLLSCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPRELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMTTIRIWTRIINIQYTGPKSEEVRIQTKEGTPGPVAEFNIETIEINYIEIAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSGSVNTQSRFLKTGTGESNAFLMLRGSGTTWFVILLILILGLLCGVIGLFIWRRQKILYMRGKQSTSIPDTSHIHSNLQNHPQDRYTSFVTYQSPVSENLQISFNKQTIENDYFDEKLPFCMVNMQSKLDEKIPFHSSSNLPSICHHQKSDLINSMSRTQFTPTLHRSAPNNHIPTAWTMPKSHQHLPDDIYSVSNSAVCDKVFYHPFDYKSAQTPVSTSFV 1364          
BLAST of Neuroglian vs. Planmine SMEST
Match: SMESG000025433.1 (SMESG000025433.1)

HSP 1 Score: 544.273 bits (1401), Expect = 2.770e-169
Identity = 378/1197 (31.58%), Postives = 579/1197 (48.37%), Query Frame = 3
Query:  132 FPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVN-------QDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFR--QLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLN--IKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKV--VKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWL----VILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKRYEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRID---AITDHSVKLQWSIIYENQLS-RINGFFRGYRIEWCLNETSAELCDIKKNCQDEIL-------------------------------IKPDPRELSYRLQDPVTRFN----ERVKRDVYSSI----YGQMHMATLTGIPGMXXXXXXXXXXXXQYTGPKSE-EVRIQTKEGTPGPVAXXXXXXXXXXXXXXAWAKPLATNGILTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIWALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQKLLDFSDSGWK---FYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVRAVINTKSG 3530
            +PPSF+ QP K E  Y ++  ++L C A   PS  Y W KN    + + +N        +EG+L       +++G YQCVA N  G+A S K+ +R A I  + S     + +    S  L+C  P  +PP  + W  +K YG     +E ++ V D +GNL+IT I  +DD   ++C + N  +R  K     +I + P    S    P+  L+ +       +   ++L CI        ++     + + I  +  F T   G  L I+ +   D G Y C      +T    + F ++V   PI   +  D  V    S +F C A+G+P+P+I WT NG+ +  YLNG+     GN ++L NL + D  V QCNASN  GY Y+N +INV   KP  +  PQ  +       V INC  FS P   + W KD +N+N     +Y + DNG+L+I  L + D+G Y C A+N++G     S + +R+ T+++    N     G +V   C+A+TD  E +NLKI W K N  + +   +  +     + L +    T D+G Y+CNA+NG+D+D+    L V+GKP     I  DC R +    AL++W  G  N A I  ++ E+ TQ+D K W     V+ P   T  T+         +  VT+ P+I+Y FR+R++N++G S+PS  T N C +    P  NP +VF+YGT  + L I+W  + Y+   GP L Y +++ C+ C   P        I+ W  + +   N    S    +E ++ ++V I++KN +G+S        G+SG++ P+I  + L++    A T + V L W+I+ ++ ++  +NGFFRGYRIEWCL       CD     QD IL                                K D +       +P T  N     R KR    +     YG+     LT IPG T I++W R++N  Y   +S+  + I+T E TPGPV  F   T+ IN++ + W  P  TNGI+TGY +  +E       G       + DP+QL+ ++S LKSETKY I IWALT +G G E  +   T+         +  I  +  N  N  +TF          SD+G K   F+ QFR      W+E+E QY   W+ + +L  + TY +R V    +G
Sbjct:   24 YPPSFVYQPNKNEVYYNLEA-LMLRCVATGNPSPTYTWYKNNKKFD-MSINVGRYTRWPNEGTLIFALPNDDDDGIYQCVASNDYGKAFSIKSNVRRAEIQDFKSKDVEKLSLNNGASVKLQCQVPVSFPPPIVAWNKIK-YGVPELLKESSKYVTDVDGNLYITGISMDDDRAQFTCTAFNERMRITKTDHPYEITVIP----SQSNIPVSLLFRTLQPIKGRVGEKLILRCIMGGNPAPTYQWNAKGQTSNILERPNFNTDAGGAILIINPVTAADKGTYQCRAENAVSTTPTFVDFAVDVESTPILTMKLSDANVPYGGSQVFTCDATGDPKPQITWTVNGEGLDTYLNGNNKKKTGNTIFLTNLVSGDQAVFQCNASNTVGYDYSNGYINVLRDKPEFINGPQPTLTKAENTAVTINCQTFSAPKAIVTWTKDGFNIN---GGRYLIQDNGDLLISKLITADSGTYSCSAANLYGSVSGTSVLYVRQRTELMIRPINTWVYFGQEVKFVCTAKTDRLETKNLKIIWNKDNNPITMGSYERTNTNPQDNSLIISGSQTTDTGIYSCNATNGLDFDVAYATLIVQGKPHTPIGITADCARLATLSQALVSWNPGADNYAPIIMYLVEYSTQFDRKGWYEVERVVQPTGSTGDTV---------DVKVTMRPFIQYWFRVRAMNRVGVSEPSDPTQNYCALPPAIPYSNPKNVFVYGTAKDNLVIQWTPMTYVEQCGPKLGYEISVMCITCKSIPQNRTNTTFISDWDQNIVTYYNFRLGSISYDMESFQLFQVNIRAKNEIGYSKSPDTIATGYSGDAPPSITAAQLQLSPGQADTGY-VSLTWNILTQSDIATNVNGFFRGYRIEWCLANLIDAECDASTQYQDVILATQNLPVLYGNKRRKRSVQDDDEDTQTDEGRFKYDTKYRQVIPDNPATSVNFQVLSRRKRAALKNPDDWNYGKNITVKLTMIPGNTWIKVWLRVLNAIYASARSDPPLLIKTAEDTPGPVINFRAITLSINHVVLQWLSPTETNGIITGYRLAWRE-INGLELGYMTTYPDLTDPNQLQFQMSGLKSETKYRILIWALTSKGSGIESFIDVMTQPAFIAPNAPKFTITSVVNNTVN--VTFAP--------SDTGVKGSVFFAQFRKIGQYRWDESEPQYIRTWIFLTNLANDTTYELRMVATNGAG 1189          
BLAST of Neuroglian vs. Planmine SMEST
Match: SMESG000021248.1 (SMESG000021248.1)

HSP 1 Score: 120.168 bits (300), Expect = 8.862e-27
Identity = 143/587 (24.36%), Postives = 239/587 (40.72%), Query Frame = 3
Query:  186 DTTIILPCYAKAIPSANYEWLK-NGHSIENLIVNQDEG--SLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAI-LECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAE-IKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPI--FINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIG--RYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKY--IKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNG-NLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQI--------GLDVTLECSARTD-------IQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE 1865
            +T + + C+++  P+  Y W K N   I    V    G  +L I++  R ++  YQC   N  G       ++ +    S + +  R    F  GS   L C+    +P   I+W  ++     +        +L NN  LH   + D+     Y+CI+TN    + ++  D  +   P  +S    K    L +  L  +   +   +        ++ WF    K+ E I+   R     +GT L + N +  D G Y C    +       +T++++  P   F ++     VA+  +    C + G P+P+I W  +G  I   R L  D     G  L +N+    D    QC A N +G    +  + V    P L    ++Y  ++  +   V + CL   +P P I W KD   +N + + +Y +  N   L I  + ++DAG Y C+A N FGQ +    + I  P  I       RN+I        G ++ L C A           ++G +L +     N+     K    +    +L L S    DSG Y CNASN I +D+ +  ++V   PE
Sbjct: 1496 ETDLYITCWSEGNPAPRYLWYKDNSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGED-KKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSG-FPTPQIRWTYMETINSPL--------LLSNNSQLHFMNV-DKSHITRYTCIATNE-AGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPV-------ATIEWF----KDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSD----DGYHLTVNSTMETDAGRYQCIAENTHGQTDISFDVQV-TYGPTLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRLPSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSI------DRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPE 2048          

HSP 2 Score: 99.3673 bits (246), Expect = 2.106e-20
Identity = 139/575 (24.17%), Postives = 228/575 (39.65%), Query Frame = 3
Query:  183 MDTTIILPCYAKAIPSANYEWLKNG-----HSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYD-----GSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTN-----NFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVR----WFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAI--NSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLK-MNVQINCLAFSVPPPRIIWRKDSY----NLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGL--DVTLECSARTDIQEGE-NLKIEWWKKN---ELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            +D TI L C A   P+   +WL        +++   +V +++ +L +ERA   + G Y C+A N  G+    K  +   F + Y  +K    ++ Y+     G+    C   N  PPA I+W    +     S  +D  ++  +   L + ++   D G IY C++ N     NF           + I P  +  H  K +I +                    +S G+      W++    N+++    R +    G TL I  + R D   Y C    E       F +NV   P        +T      S+T   C  SG P P+IRWT         +N   +  + ++L+  N+    +T   C A+N  G      F  V    P ++       + +LK   ++++C + + P   I W KD      NL + +TN+ +      L + N   +D G+Y+CL SN  G  K   T+ I  P  I   S    +Q+ L  ++ L C     + EG    KIEW K     +  +V+ S     L+    + S    D+G Y C A N
Sbjct: 1303 IDNTITLTCIASGNPTPKIKWLFKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGK--DQKNSIVTVF-APYIDMKTPNKNITYNPIIVGGNITFSCVM-NSTPPAEIKWFK-NEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSG-IYKCLAINIGESLNFTLV--------VLISPTILGKHSSKSVININEETDLYIT----------CWSEGNPAPRYLWYKD---NSQLISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVFVPPSINGISMRETPEFLKGSTTNLWCNVSGFPTPQIRWT-----YMETINSPLLLSNNSQLHFMNVDKSHITRYTCIATNEAGSA-RKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQ-----LHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFC-----VSEGRPKPKIEWRKDGSRIDFRRVLLSDDGYHLT----VNSTMETDAGRYQCIAEN 1830          

HSP 3 Score: 97.8265 bits (242), Expect = 5.785e-20
Identity = 128/622 (20.58%), Postives = 241/622 (38.75%), Query Frame = 3
Query:   90 TINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE--------------NLIVNQDEGSLRIERAIRENEGSYQCVAYNYLG-RAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCY-PPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKER---FQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQ---PFDKTVAINSSTIFECQA--SGEPRPEIRWTSNGQEIGRYLNGDRIHL----HGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWN--RKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE 1865
            T   + + M      PPS  +     E++ ++   + LPC A   P+ N  + K+G+S++               L+V+Q+   L +  A R + G YQC A N +G   + +   +R       S++ E  ++ F + +  LEC       PPA I W   + +G  +S    + R+  +   + +  +   D GE Y C + N   + +    + ++ +KP    + L       Y                   +   ++ W+RQ  +   +  KER   F  +R  + ++I+NI+  DA  Y C       T+  KF I+V+  P  + +   P +  V  N    F C        +P I WT     I   L GD  +     +G  L + N  + +     C A N+ G       + V +  + P      ++ I   L  +V   C A   P P I+W      ++      + + +N  ++     + + G+++C+A N  G       + +  P  +       R + G   ++ C+A     EG    +  W ++              + +L++      D+G Y C  +N I  D + +++ +   P+
Sbjct: 1927 TFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNV-EPKVNWFTNQTRSLECTLMGVADPPAKITW---ERHGVPLS-SGGSIRISPDGTRITVENVKQYDAGE-YKCHAQNEVSK-ISLVFNVEVFLKPRFYKNQL-------YTKIEAVQNTTVQMSCECTGYPPPTLLWYRQ--EQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPI---LIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRERSGTSFSVLCTA-----EGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPK 2524          

HSP 4 Score: 97.8265 bits (242), Expect = 6.188e-20
Identity = 152/646 (23.53%), Postives = 261/646 (40.40%), Query Frame = 3
Query:  195 IILPCYAKAIPSANYEW---------LKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLK--ERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXX---XXXXXXXXXXCIFSR---GSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVA-INSST--IFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHL--HGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQ----------KYIKGVLKMNVQINCLAFSVPPPRIIWR-KDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASN--GIDWDLRKIELQV---------------------------EGKPEPVSDIQVDCKRYSNHRLALLTWVDGFH 1946
            + L C     P+   +W          +N   I N  +  D+  L I +   E +G Y C   N  G A   K    +  + S   ++  ++++ VF D +  L C      P   I+W+  K   +LI       +++  N    I +      G  YSC++ N      + G D K     +SI + +  P I +   N   T   +++   +  SC+ +      ++WF+      +  PK+RF+    G+TL +  ++  D+G Y C  +    +LN  FT+ V+  P  + +   K+V  IN  T     C + G P P   W  +  ++   ++G R+ +   G  L +  +   D +V QC+ +N  G    N  +NV+       VPP           +++KG    N+  N   F  P P+I W   ++ N  L+L+N      N  L   N++ +    Y C+A+N  G  +     ++  P KI+S+ P+K+  I  D  L  S  +D        IEW+K  EL++     +     + L L +    D G Y C  SN  G+D     +++ +                           EG+P+P  + + D  R    R+ L    DG+H
Sbjct: 1212 LTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPI--DKNDLLITQMRSELQGIYTCDGTNVGGSA---KMSYDVIILESPKIIQFNDKSV-VFIDNTITLTCIASG-NPTPKIKWLFKK---KLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAEN------EGGKDQK-----NSIVT-VFAPYIDMKTPNKNITYNPIIVGGNITFSCVMNSTPPAEIKWFKNEIDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAINIGESLN--FTLVVLISPTILGKHSSKSVININEETDLYITCWSEGNPAPRYLWYKDNSQL---ISGGRVEITNGGKTLLIKKVRRSDDSVYQCHVTNEAGEDKKNFDVNVF-------VPPSINGISMRETPEFLKGST-TNLWCNVSGF--PTPQIRWTYMETINSPLLLSN------NSQLHFMNVDKSHITRYTCIATNEAGSARKLFDPVLTYPPKIVSLDPDKKRWILKDGELRLSCNSD--AAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEGRPKPKIEWRKDGSRIDFRRVLLSD--DGYH 1810          

HSP 5 Score: 93.5893 bits (231), Expect = 1.292e-18
Identity = 90/369 (24.39%), Postives = 171/369 (46.34%), Query Frame = 3
Query:  900 GTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFI-NQPFDKTVAINSSTI-FECQASGEPRPEIRWTSNGQEI----GRYLNGDRIHLHGNK-LYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLL---LVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNG-NLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRN----QIGLDVTLECSARTDIQEGENLKIEWWKKN------ELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGF 1943
            GT + + N+++ DAG+Y C    E + +++ F + V  KP F  NQ + K  A+ ++T+   C+ +G P P + W    QEI     RY   D   L GN  + + N+   D     C A+N  G +     I+V     ++   L P    +K  +++    +   +++  P I+W K++  + +  T+ Y   +NG +L I N  S+++G Y C A N+ GQ  +   + +  P K  +     R     Q+G  V  +C A    +      I W+ K+      +++  V S++A +L+    + S+  ++ G + C A N +   ++  +L+V   P  V   +++ +  S    ++L   +G+
Sbjct: 2103 GTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAVQNTTVQMSCECTGYPPPTLLWYRQEQEILADKERYPKFD--ILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISVIIPPKIMKRSLGPENHRVKENMQITFHCSVYNYNMTKPVILWTKENSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKFPTDFSIFRETITVQLGTSVNFQCPA----EGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLT----IPSV-NKEGGIFKCIARNEVGSIMKVYKLEVI-MPALVRLDKIEVRERSGTSFSVLCTAEGY 2459          

HSP 6 Score: 88.1965 bits (217), Expect = 4.623e-17
Identity = 128/579 (22.11%), Postives = 222/579 (38.34%), Query Frame = 3
Query:  219 AIPSANYEWLKNG---HSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGR---AISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVN-----VKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKP---------LITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFD-------KTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGEN-LKIEWW--KKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPE 1865
            A P A   W ++G    S  ++ ++ D   + +E   + + G Y+C A N + +     + +  L+  F   Y +     I+   + +  + C+    YPP ++ W       + D  R   F+     +L  N  + IT I   DD + Y+C +TN    T+++  +  + I P  I    L P          IT + S                  ++  + W ++ +    I   + + T   G +L I N +  ++G+Y CE        +  F + V   P F   P D        TV + +S  F+C A G P P I W      I  Y   + +  +  K+       K+  + +C A N  G +     + V    P L+   +  ++     +  + C A   P P I W +D   +    T   S    G L I +    D G Y C  +N   Q      ++I  P KI S   +   ++G  V L C     I EG    +I W+    N++   +      +    L ++ +    SG Y C A+N   +   +I L+V  +P+
Sbjct: 2076 ADPPAKITWERHGVPLSSGGSIRISPDGTRITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRF---YKNQLYTKIEAVQNTTVQMSCECTG-YPPPTLLWYRQEQEILADKERYPKFD-----ILRGNSVMQITNI-QPDDADTYACTATNGG-GTIEKKFEISVIIPP-KIMKRSLGPENHRVKENMQITFHCSVYNYN------------MTKPVILWTKE-NSPILIGDTDYYLTFNNGQSLTILNPKSDESGRYTCEAKNLAGQDSHTFVLTVTSPPKF---PTDFSIFRETITVQLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEGGIFKCIARNEVGSIMKVYKLEVI--MPALVRLDKIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSR--TGILEITDAKEEDTGRYTCTGTNKISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPC-----IVEGTRPFRIHWYTPGNNQISSTILGEYQFLSEQGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPK 2617          

HSP 7 Score: 87.8113 bits (216), Expect = 6.583e-17
Identity = 86/365 (23.56%), Postives = 156/365 (42.74%), Query Frame = 3
Query:  834 WF---RQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINS-STIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLL---VPPQ-----KYIKGVLKMNVQINCLAFSVPPPRIIWRKD---SYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQ 1883
            WF   R+LD      P+       + + ++ISN++ +D+G+ IC+         ++  ++ +  P  ++    K + +        C A+G P+P+I W           NG  + + GN +    + T D+  I+ N    +  V TN   +  +RK   L     P+       I G    N+ I C     PPPR+ W +     YN+ + L ++Y ++ + +LIIK L+  D   Y C A N  G+ + ES  I         ++  +  Q+ ++ TL+      + E +   +  W KN   ++  S+      + L ++++   D   Y C A N +      IEL V+ KP  + D +
Sbjct:  665 WFLNGRELDPT---DPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAGIDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSANGVPQPKITWE---------FNGSPVTIDGNIIINETIGTLDINRIEKNMKGQWVCVATNNAGS--SRKSFNLDIGFGPRIKDFVTNIDGSYGENITIRCQVEGHPPPRVKWLRGIAGGYNIPIALGDRYFINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQ-ESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNG-KEIEYSNRIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFK 1013          

HSP 8 Score: 87.0409 bits (214), Expect = 1.100e-16
Identity = 129/567 (22.75%), Postives = 230/567 (40.56%), Query Frame = 3
Query:  195 IILPCYAKAIPSANYEWLKNGHSIE--NLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRA---ISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIK-PDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGS----VRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTI-FECQASGEPRPEIRWTSNGQEIGRYLNGDRIH---LHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNK--YSM--DDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQ-----IGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKS-----HSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            +I+    ++ P A   WLKNG  IE  N I+ +D  +L I+    E+E  Y C+A N +G A   I    + +   I  + +     ID       +L+C      P   I+W   +  GR ++ E   R V+  +G+      I E+    ++C +TN+    +K   + K+ +K P  IS    K  I+ Y       +     V L+CI + G+    + W++      EI    R +   +   L++      + G Y C+   E ++ +  F I ++  P   +    K        +   C+  G P P  +W+     +    N   I    +  N L +  + ++   +  C+ +N+ G    +  + +     ++    +  +   +   + + C+A   P P+I W    +   LI  N   Y M  ++   LI++   S   G Y CLA N  G+ +  S + +  P  I   +PNK        +G ++T  C     +      +I+W+ KNE + + KS        ++  S L L  +   DSG Y C A N
Sbjct:  934 VIVCLVVESKPPAVISWLKNGKEIEYSNRIMAKDN-TLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDVQTKPIIIGDFKTF----IDAKDGDVIVLQCQTKG-DPKPKIEW---RKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVK---EFKVSVKAPPQIS----KEGISDY------EIGSKENVELNCIITSGNPSPKIEWYKNGQPLVEI--PGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGFPTPTKKWSWKSSILDLQRNPFGITNSPIDKNDLLITQMRSELQGIYTCDGTNVGGSAKMSYDVIILESPKIIQFNDKSVV--FIDNTITLTCIASGNPTPKIKWL---FKKKLIPPNAVGYKMVGENQETLIVERAASMHGGEYSCLAENEGGKDQKNSIVTVFAPY-IDMKTPNKNITYNPIIVGGNITFSCV----MNSTPPAEIKWF-KNE-IDIYKSLPKDRFKISLDGSTLTLFEVKHLDSGIYKCLAIN 1464          

HSP 9 Score: 80.8777 bits (198), Expect = 7.579e-15
Identity = 125/601 (20.80%), Postives = 240/601 (39.93%), Query Frame = 3
Query:  192 TIILPCYAKAIPSANYEWLKNGHSIE------NLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLK-ERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDK--NAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTL--NIKFTINVVEKP-IFINQPFDKTVAINSSTIFECQA-SGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGN-LIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGL--DVTLECSARTDIQEGENLKIEWWKKNE-LLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDGF 1943
            +I   C A + P   + W  NG  ++      +++ +  E  ++I     ++ G   C A N  G     +  +++++IS    L  +   ++  +G         N  P   I W   +  G  ++ +  N  + +  G L I +I     G+ + C++TNN   + ++  +  I   P       +K  +T  + +    + +   V          V+W R +    N  I   +R+  I +  +L I  +  +D   YIC+   +   +  +++  I+ +  P I   Q     V      +  C     +P   I W  NG+EI  Y N  RI    N L +  +  +D  +  C A N  G    +  ++V   KP+++   + +I       + + C     P P+I WRK    L +    +  +  +G+ L + ++    AG + C A+N       E  + ++ P +I S       +IG   +V L C   +      + KIEW+K  + L+++      A   ++LK+      ++G Y C A+N +  D R  ++ +   P+      +        +L L   +DGF
Sbjct:  648 SITASCRALSTPPPTFSWFLNGRELDPTDPRISIVNDVQESQIKISNVKPQDSGELICKAKNSAG---IDEVRIKLSYISLPKILSLDLAKEIPLEGDQQTVRCSANGVPQPKITW---EFNGSPVTID-GNIIINETIGTLDINRIEKNMKGQ-WVCVATNN-AGSSRKSFNLDIGFGPR------IKDFVTNIDGSYGENITIRCQVEG---HPPPRVKWLRGIAGGYNIPIALGDRY-FINQDNSLIIKGLSMEDQSAYICDAQNQHGKVQESVQIRISGIAAPKIAFTQSKQVVVESTLKKVIVCLVVESKPPAVISWLKNGKEI-EYSN--RIMAKDNTLVIKTVKAEDEAIYTCIAKNQVGTAKFDIELDV-QTKPIIIGDFKTFIDAKDGDVIVLQCQTKGDPKPKIEWRKGGRPLTMEPGLRIVISPDGSQLTVYSITEEHAGTFTCTATNDHAAVVKEFKVSVKAPPQI-SKEGISDYEIGSKENVELNCIITSG---NPSPKIEWYKNGQPLVEIPGRVEIAGQKNILKVYGKNEDETGSYECKATNEVSSDSRFFQITILVAPKASDSKMIKIYTKEGEKLTLNCKIDGF 1221          

HSP 10 Score: 80.8777 bits (198), Expect = 9.353e-15
Identity = 80/312 (25.64%), Postives = 143/312 (45.83%), Query Frame = 3
Query:  909 LEISNIERKDAGQYICEPVEEQNTLNIKFT-INVVEKPIFINQPFDKTVAINSS-TIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLV-----PPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNG-NLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENL-KIEWWKKNELLK--VVKSHSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            + I +++ +D G YIC         +   T +++  +P F+ +P  K V   +    F C+A+  P+P+I+W  NG+ I   LN +        + L ++ +++    +C A N  G V  +  + V   KP + V     P +   + +L   V+    +       I+W K+     +I+ N   +  N  NLII    S D G+Y+C+ASN  G+ + +  ++++ P     +  N    +G  + L C+A     EG  +  I W+K  +L+K   VKS    I +  L++  +    SG Y C AS+
Sbjct: 2764 INIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWKSFRCEATSHPKPDIKWMFNGRAIESKLNSN----GRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVI-AKPRVRVYQSDDPSESIKRTILMCKVEGKVDS-------IVWLKNG----VIVQNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGNISANLGEVLILPCAA-----EGYPIPTISWYKNKKLIKYDFVKS---LIKNGSLRIIGVQKEHSGVYFCVASS 3051          

HSP 11 Score: 79.7221 bits (195), Expect = 1.700e-14
Identity = 138/605 (22.81%), Postives = 228/605 (37.69%), Query Frame = 3
Query:  129 SFPPSFIQQPPKGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIE-NLIVN-QDEGS-LRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHIT-KIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKP-IFINQPFDK-TVAINSSTIFECQASGEPRPEIRWTSNGQEIGRY---LNGD-----RIHLHGNKLYLNNLTTK--DVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSV--PPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTI-IIREP--------TKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAA--IL--SSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQV 1850
            ++PP  +   P  +     D  + L C + A P A  EW K+G  I  NL VN  + G+ L +  A   + G Y+C+  N LG      T   M   S   + K     V   G+  L C      P   I+W   KD  R+     D RRVL ++   H+T     E D   Y CI+ N   +T     D ++   P       L P    Y               L       ++ W +       + P  R++ I     LEI  ++  DAG+Y C        + I   + +   P I  N+  ++  + +       C A+G P P I +  +G  +  +    N D     R+ +   +  L   + K  D  + QCNASN  GY      + V           +  +         + C    V  PP +I W +    L+   + + S D    + ++N+   DAG Y+C A N   +      + +  +P        TKI +V         + ++ EC+            + W+++ + +   K       IL  +SV+++ ++   D+  Y C A+NG     +K E+ V
Sbjct: 1659 TYPPKIVSLDPDKKRWILKDGELRLSCNSDAAPVATIEWFKDGELIRNNLRVNITNRGTQLHLLNAQESDIGIYKCLVSNKLGLDKQAWTVDIMIPPSIKFNSKAGAHQVALGGNLYLFCVSEG-RPKPKIEW--RKDGSRI-----DFRRVLLSDDGYHLTVNSTMETDAGRYQCIAENTHGQT-DISFDVQVTYGP------TLDPGGKRYYKVERTVGGTVVLECLVSGIPTPAITWLKDGIPINRL-PSYRYRIIGNSKQLEIIAMQASDAGRYSCVAKNTFGQMEIFMDVTIGAPPSIDRNRILNEYIIKVGDELRLPCPANGSPNPNIAFFKDGNSLDMFDLSPNKDASYKKRLLVSQERQMLTLYSAKRTDSGLYQCNASNAIGYDVMEYSVRVRTPPEFDTSNVEPKVNWFTNQTRSLECTLMGVADPPAKITWERHGVPLSSGGSIRISPDGT-RITVENVKQYDAGEYKCHAQNEVSKISLVFNVEVFLKPRFYKNQLYTKIEAV-----QNTTVQMSCECTGYPP------PTLLWYRQEQEILADKERYPKFDILRGNSVMQITNIQPDDADTYACTATNGGGTIEKKFEISV 2235          

HSP 12 Score: 78.5666 bits (192), Expect = 3.749e-14
Identity = 132/598 (22.07%), Postives = 228/598 (38.13%), Query Frame = 3
Query:  180 QMDTTIILPCYAKAIPSANYEWLKNGHSIE-----NLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAIS-HKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGS---VRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKP-IFINQPFDKTVAINSSTIFECQ-ASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVDCKRYSNHRLALLTWVDG 1940
            Q+ T++   C A+  P+ +  W      I      N +++ +   L I    +E  G ++C+A N +G  +  +K E+ M  +     ++ R       G++         YP   I+W   +D   +  +     +     G L IT   +ED G  Y+C  TN   +  K   D  I I P  I S     ++ +              VLL CI        + W+   +          +Q + +   L I  + +  +G Y C    +     I+ T+ V+ +P IF     + T  +N+    +C+   G P+P I W  NG  + +  N       G  ++ N+L  +D   + C A N+ G       I V    P + +P    + G    +V I C     P P + W+KD  +L  +L N++  +    + I +L   D G Y C+      +    ST +           P  +N +    T   S R +        I+W       + ++S   +     + L+S+ + ++G Y C A N +        L+V  KP  V   Q D    S  R  L+  V+G
Sbjct: 2353 QLGTSVNFQCPAEGSPTPSIMWFYKDMPISPYDMMNFVISNNAKVLTIPSVNKEG-GIFKCIARNEVGSIMKVYKLEVIMPALVRLDKIEVRE----RSGTSFSVLCTAEGYPKPVIKWT--RDGKGIFRY---GTKTDSRTGILEITDAKEEDTGR-YTCTGTNKISQDSK-SVDVVI-ISPPKIESPKKSIMVRV-----------GEQVLLPCIVEGTRPFRIHWYTPGNNQISSTILGEYQFLSE-QGLIIDRVRKDHSGVYRCVANNDAGYQEIRITLEVLVQPKIFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIF-NSLKIEDEGSLTCIAKNVAGEDRLTFQITV-ELLPKVSLPIS--VTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVV--QETRWKSFRCEATSHPKPDIKWMFNG---RAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPR-VRVYQSDDPSESIKRTILMCKVEG 2915          

HSP 13 Score: 75.485 bits (184), Expect = 4.020e-13
Identity = 106/488 (21.72%), Postives = 186/488 (38.11%), Query Frame = 3
Query:  147 IQQPPKGEFLYQMDTTIILPC-YAKAIPSANYEWLKNG---HSIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFY---DGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLE------------ISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKP-IFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNE 1550
            I +P + E    ++T + + C   + IP     W +NG     ++N     D G         E+EGS  C+A N  G       E R+ F  +   L + ++ +     +GS++    +    P  ++ W   K  G+ +     NR   ++   ++I  +  ED G  Y CI   +            I  +P  +    LK ++                            RW +     A   PK   + +  G  +E            + ++  ++AG+Y C       ++   F + V+ KP + + Q  D + +I   TI  C+  G+    I W  NG  +    N  R++++   L +N   +KD  + QC ASN  G       + V +     L+P    I   L   + + C A   P P I W K+   +        S+  NG+L I  +    +GVY C+AS+  G+  ++
Sbjct: 2618 IFRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVKNYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAG-------EDRLTFQITVELLPKVSLPISVTGDEGSSVTIICKVEGKPKPTVTW---KKDGQSLQNVLGNRFRFNSENEINIYDLKPEDTGN-YICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQ-------------------------ETRW-KSFRCEATSHPKPDIKWMFNGRAIESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIK-RTILMCKVEGKVD-SIVWLKNGVIV---QNSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPPVFTLLPGN--ISANLGEVLILPCAAEGYPIPTISWYKNKKLIKYDFVK--SLIKNGSLRIIGVQKEHSGVYFCVASSNQGEVHSQ 3059          

HSP 14 Score: 65.855 bits (159), Expect = 2.964e-10
Identity = 126/580 (21.72%), Postives = 233/580 (40.17%), Query Frame = 3
Query:  162 KGEFLYQMDTTIILPCYAKAIPSANYEWLKNGHSIENLIVNQDE--GSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLK--ERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFSRG----SVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC--EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHG-NKLYLNNLTTKDVTVIQCNASNIYGYVYT-NAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTI-IIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKP 1862
            K E   +  T+  + C A+  P    +W ++G  I       D   G L I  A  E+ G Y C   N     IS  ++     I S   ++  +++I V      +L C      P   I W    +  ++ S      + L   G   I   + +D   +Y C++ N+           +I+I  +     L++P I    +  E T +LNT + + C    G     + W R     +++K    + T         ++++ +D G   C  + V  ++ L  + T+ ++ K   ++ P   T    SS    C+  G+P+P + W  +GQ +   L G+R   +  N++ + +L  +D     C          T + +++++ R   +  P  K +    +      C A S P P I W    +N   I  +K + +  G++ ++++ S +AG Y+C+A N  G  +    + +I +P   +  S +    I   + L C       EG+   I W K   +++   S    I    L +    ++D+G Y C ASN       ++ L V+  P
Sbjct: 2439 KIEVRERSGTSFSVLCTAEGYPKPVIKWTRDGKGIFRYGTKTDSRTGILEITDAKEEDTGRYTCTGTN----KISQDSKSVDVVIISPPKIESPKKSIMVRVGEQVLLPCIVEGTRP-FRIHWYTPGN-NQISSTILGEYQFLSEQG--LIIDRVRKDHSGVYRCVANND-------AGYQEIRITLEV----LVQPKI-FRPTETETTGVLNTVLQMQCKILEGIPQPVITWERNGITLSKVK---NYYTTTDSGLFIFNSLKIEDEGSLTCIAKNVAGEDRLTFQITVELLPK---VSLPISVTGDEGSSVTIICKVEGKPKPTVTWKKDGQSLQNVL-GNRFRFNSENEINIYDLKPEDTGNYICIGERSGAEASTASTYLSIFTRPKFVYKPKLKNVVQETRWK-SFRCEATSHPKPDIKWM---FNGRAI-ESKLNSNGRGSITLQSVRSENAGEYKCIAKNRVGSVEYSFMLEVIAKPRVRVYQSDDPSESIKRTI-LMCKV-----EGKVDSIVWLKNGVIVQ--NSSRLYINDFNLIINQAKSKDTGIYQCIASNSAGEAQGQVHLLVKSPP 2978          
BLAST of Neuroglian vs. Planmine SMEST
Match: SMESG000018028.1 (SMESG000018028.1)

HSP 1 Score: 112.079 bits (279), Expect = 3.491e-25
Identity = 118/470 (25.11%), Postives = 197/470 (41.91%), Query Frame = 3
Query:  195 IILPCYAKAIPSANYEWLKNGHSIE---------NLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWVNVKDYGRLISFEEDNRRV-LDNNGNLHITKIIDEDDGEIYSCISTN--------NFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCIFS---RGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYICEPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQE-IGRYLN---GDRIHLHG-NKLYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRK----PLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYEC 1514
            + L C AK  P  N  W K+G  +E         N +V  +E  L       ++EG Y C A N  G  IS+   + +AF++    +   +       + ++EC  P   P  ++ W   K  G  I   E N+R+ + +NGNL I K   +D G  Y+C++ N        + L T+++    + KI P +I   + +  +                    C+     + ++ W R    N +  P  R  T+     ++IS ++  D G YIC        L     ++VV  P FI  P ++ V +  + IF C+ +G P+P I W+ NG   I    N    +RI +     L +N +   D    +C AS+  G + ++A ++V + +    P++ V PQ     +  +    NC         + W K+ + LNL+   +      G L I  L  +DAG Y C
Sbjct:   43 VSLRCSAKGDPMPNIIWYKDGQVVESYRDKPATSNRLVKDNE--LLFMHLDTQDEGVYYCNASNIHGWTISNNASVLIAFLNK-DIIGPESKTASVGETVLMECKPPKGVPKPTVIW---KFNGNAI---EVNKRIKILDNGNLRIDKATRKDSGR-YNCLAKNFADERDSTSALLTVRQ--KPQFKIAPSNIEVKVNEAAV------------------FPCVADGDPKPTIVWRRD---NQKKIPSSR-ATLIDNKGMQISKVQLTDMGNYICHASNSAGHLEAYAKLSVVSTPGFIETPDNQKVRVGDTAIFNCRVTGSPQPTIIWSHNGDHFIADEENSRRSERIQVDKLGSLTINPVKISDSGKYECKASSYIGKIQSSASLHVIDAQKYVPPVIEVGPQNQTLRI-GLTATFNCQPKQQDDVTVHWLKNGHQLNLVSDPRIITLTTGKLKINLLRMSDAGNYTC 477          

HSP 2 Score: 101.293 bits (251), Expect = 9.584e-22
Identity = 86/347 (24.78%), Postives = 160/347 (46.11%), Query Frame = 3
Query:  864 IKPKERFQTIRKGTTLEISNIERKDAGQYICEP---VEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLNGDRIHLHGNK-LYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNL-----NLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTK----IISVSP-NKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSS-VLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGK 1859
            I+  +R + +  G  L I    RKD+G+Y C      +E+++ +   T+   +KP F   P +  V +N + +F C A G+P+P I W  + Q   + +   R  L  NK + ++ +   D+    C+ASN  G++   A ++V +    +  P  + ++  +      NC     P P IIW  +  +      N   + +  +D  G+L I  +  +D+G YEC AS+  G+ ++ +++ + +  K    +I V P N+  +IGL  T  C  +    + +++ + W K    L +V       L++  LK+  L   D+G Y C       + L  + L++  K
Sbjct:  163 IEVNKRIKILDNGN-LRIDKATRKDSGRYNCLAKNFADERDSTSALLTVR--QKPQFKIAPSNIEVKVNEAAVFPCVADGDPKPTIVWRRDNQ---KKIPSSRATLIDNKGMQISKVQLTDMGNYICHASNSAGHLEAYAKLSVVSTPGFIETPDNQKVR--VGDTAIFNCRVTGSPQPTIIWSHNGDHFIADEENSRRSERIQVDKLGSLTINPVKISDSGKYECKASSYIGKIQSSASLHVIDAQKYVPPVIEVGPQNQTLRIGLTATFNCQPK----QQDDVTVHWLKNGHQLNLVSDPRIITLTTGKLKINLLRMSDAGNYTCKIVQNEAFTLWSVTLKILDK 497          

HSP 3 Score: 87.0409 bits (214), Expect = 4.038e-17
Identity = 75/277 (27.08%), Postives = 122/277 (44.04%), Query Frame = 3
Query: 1011 EKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYLN----GDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGYVYTN---AFINVWNRKPLLLVPPQKYIKGVLKMNVQINCL-AFSVPPPRIIWRKDSYNLNLILTNK-YSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTII-IREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASN 1811
            +KPI    P              C A G+P P I W  +GQ +  Y +     +R+ +  N+L   +L T+D  V  CNASNI+G+  +N     I   N+    ++ P+     V +  V + C     VP P +IW+   +N N I  NK   + DNGNL I      D+G Y CLA N   +  + S ++ +R+  +      N   ++       C A     +G+      W+++   K+  S +  I +  +++  +   D G Y C+ASN
Sbjct:   24 QKPIISEHPASTHGLSLQRVSLRCSAKGDPMPNIIWYKDGQVVESYRDKPATSNRL-VKDNELLFMHLDTQDEGVYYCNASNIHGWTISNNASVLIAFLNKD---IIGPESKTASVGE-TVLMECKPPKGVPKPTVIWK---FNGNAIEVNKRIKILDNGNLRIDKATRKDSGRYNCLAKNFADERDSTSALLTVRQKPQFKIAPSNIEVKVNEAAVFPCVA-----DGDPKPTIVWRRDNQKKIPSSRATLIDNKGMQISKVQLTDMGNYICHASN 287          

HSP 4 Score: 63.1586 bits (152), Expect = 9.730e-10
Identity = 60/200 (30.00%), Postives = 90/200 (45.00%), Query Frame = 3
Query: 1287 NRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRKD-----SYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQT-KNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGID-WDLRKIELQVEGKPE 1865
            ++KP++   P     G+    V + C A   P P IIW KD     SY      +N+   D+   L+  +L++ D GVY C ASNI G T  N ++++I    K I    +K   +G  V +EC     + +   +    WK N     V      + +  L+++  T +DSG YNC A N  D  D     L V  KP+
Sbjct:   23 SQKPIISEHPAS-THGLSLQRVSLRCSAKGDPMPNIIWYKDGQVVESYRDKPATSNRLVKDNE--LLFMHLDTQDEGVYYCNASNIHGWTISNNASVLIAFLNKDIIGPESKTASVGETVLMECKPPKGVPKPTVI----WKFNGNAIEVNKRIKILDNGNLRIDKATRKDSGRYNCLAKNFADERDSTSALLTVRQKPQ 215          
BLAST of Neuroglian vs. Planmine SMEST
Match: SMESG000036495.1 (SMESG000036495.1)

HSP 1 Score: 108.227 bits (269), Expect = 3.094e-23
Identity = 191/878 (21.75%), Postives = 339/878 (38.61%), Query Frame = 3
Query:  261 SIENLIVNQDEGSLRIERAIRENEGSYQCVAYNYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPASIQWV----NVKDYGRL----ISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSC-ISTNNFLRTMKRGADTKIKIKPDSISSHLLKPLITLYXXXXXXXXXXXXXXXXXCI--FSRGSVR-----WFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC--EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRPEIRWTSNGQEIGRYL--NGDRIH--LHGNK----LYLNNLTTKDVTVIQCNASNIYGYVYTNAFINVWNRKPLLLVP-----PQKYIKGVLKMNVQINCLAFSVPPPRIIWRKDSYNLNLILTN-----------KYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNESTIIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNELLKVVKSHSAA-------------ILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEGKPEPVSDIQVD--CKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKNWLVILP-VNET-FQTIIRPNNKIKNNTWVTIHPYIKYNFRIR--SVNKLGTSQPSSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLTYHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEI-------YKRYEVTIQSKNTMG---FSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQWSIIYENQLSRINGFFRGYRIEWCL 2681
            S  N  V Q  G L I       +    C   N  G AIS + ++    +  Y+    + + +  +   +L+C+ P+  P  SI +        D G +    I  +  N   L  N  L    I    D   Y C +       T  +  D  +++     +S+ L P   +++                    F  G ++     +F + + N  + PK       +  TL  +NI+ +D G Y C  E ++ + ++    T+++  KP F+ +P ++   + SS    CQA G+P+  ++W  N      +L  N D  +    GN     L +N + T D  +I CN  NI+G    +AFI +   K + LVP     P    + ++  N  I C     P P I W KD   L+L  +N           +     N NL IKN+ ++D G Y C A+N  G+  + + + +     + +    +R Q+  +V L C A        ++  +W+ +N  LK  +    A                  LK+ ++   D   Y C  +   +       +QV G P     I V       SN    ++ W DG+ +   I  +  E   +   + W  +   +N+T  + I + NN I+N    +  P    NFR+R  + N  G  +PS  +    +     P   P +V   G    TL I+W+ +  L  NG N  Y +  +             + +   W T+   ++    N K  ++ +       Y +++V +++ N MG   +S V  +     S    P+  P ++  ++    ++ + W       +    G  +GY I + +
Sbjct:  262 SYTNGKVTQTGGLLTINDPDNTFDNKIDCQVQNDYGTAISRQVQIIRGRLEIYTKNPRQLLRMPDNTGFMLDCEPPDHDPKDSIVYTFYITRKNDKGEVVDDVIQSQLRNNIFLSYNLGLIGFSIGSVKDSGTYKCMVGWRGLTGTSYKSPDIPLEV----YASNTLYPPPNVHDKFPNFKPSNPFLGDTVIFECFGYGEIKQNPLKYFWKWNNNP-LPPKAVITDFERRVTL--NNIQFEDEGVYSCNIETMDGRVSIARSVTLSINAKPTFVVKPKNQYPDVGSSVTLTCQAVGKPQVIMQWYRNEIPFSSWLAKNPDPRYNFTEGNVSVALLVINGVKTTDNAMIGCNIYNIFGK--ESAFIEL---KTVSLVPNFDKYPLLNTEAIIGTNTIIPCQPEGSPTPTITWTKDGSQLSLSPSNFNQVIGAVDCTRLCSLPNNNLFIKNVEASDKGTYACTATNSLGKANSSAYLDVINALTLTNNPVGRRVQVNTNVYLPCQAAG--TPYLDIDYDWYFENVRLKFDRMDLDARRYDKSQFMRPYYRYFGTLKIYNIQFYDEANYTCRVTTPFNVISSSALIQVIGPPGVGGGITVTPLVGNVSN----VVEWTDGYDHGQPILWYRLEVAKEDGTQKWYPLKERINKTDIKPITKQNNLIRNQFVFSELP-ANTNFRLRLFAANSFGIGEPSGPS-EVFKTAAIPPQKAPKNVTGGGGKVGTLVIRWEPLLPLEENGDNFAYEIRYK-------------ESKEIEWITASNFINKSLENDKYRQVTLDLPANKDYIQFQVQVRATNIMGPGPWSDVSNIT----SASKLPSYAPQDVHANSFNSTAINVDWK---APAIGSGEGPIQGYHIVYWM 1099          
The following BLAST results are available for this feature:
BLAST of Neuroglian vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHL13.205e-9025.11cell adhesion molecule L1 like [Source:HGNC Symbol... [more]
CHL13.790e-8924.93cell adhesion molecule L1 like [Source:HGNC Symbol... [more]
CHL11.354e-8825.66cell adhesion molecule L1 like [Source:HGNC Symbol... [more]
NFASC1.558e-8124.33neurofascin [Source:HGNC Symbol;Acc:HGNC:29866][more]
NFASC1.118e-8023.85neurofascin [Source:HGNC Symbol;Acc:HGNC:29866][more]
back to top
BLAST of Neuroglian vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lad-23.992e-7625.72L1 CAM ADhesion molecule homolog [Source:UniProtK... [more]
sax-76.318e-6624.94Sensory AXon guidance [Source:UniProtKB/TrEMBL;Ac... [more]
sax-77.204e-6624.94Sensory AXon guidance [Source:UniProtKB/TrEMBL;Ac... [more]
sax-72.415e-5524.98Sensory AXon guidance [Source:UniProtKB/TrEMBL;Ac... [more]
sax-74.393e-5524.98Sensory AXon guidance [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of Neuroglian vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Nrg6.878e-10126.45gene:FBgn0264975 transcript:FBtr0301762[more]
Nrg6.878e-10126.45gene:FBgn0264975 transcript:FBtr0071207[more]
Nrg6.878e-10126.45gene:FBgn0264975 transcript:FBtr0071209[more]
Nrg6.878e-10126.45gene:FBgn0264975 transcript:FBtr0333522[more]
Nrg6.878e-10126.45gene:FBgn0264975 transcript:FBtr0301764[more]
back to top
BLAST of Neuroglian vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chl1b1.541e-8724.45cell adhesion molecule L1-like b [Source:ZFIN;Acc:... [more]
nrcama3.169e-8726.26neuronal cell adhesion molecule a [Source:ZFIN;Acc... [more]
chl1b1.309e-8624.48cell adhesion molecule L1-like b [Source:ZFIN;Acc:... [more]
chl1b1.502e-8624.48cell adhesion molecule L1-like b [Source:ZFIN;Acc:... [more]
chl1b3.081e-8624.48cell adhesion molecule L1-like b [Source:ZFIN;Acc:... [more]
back to top
BLAST of Neuroglian vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
l1cam1.966e-8926.63L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam2.205e-8926.63L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam4.600e-8926.69L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam5.743e-8926.58L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
l1cam8.021e-8926.73L1 cell adhesion molecule [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Neuroglian vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chl16.052e-8624.50cell adhesion molecule L1-like [Source:MGI Symbol;... [more]
Chl16.052e-8624.50cell adhesion molecule L1-like [Source:MGI Symbol;... [more]
Chl11.427e-8524.32cell adhesion molecule L1-like [Source:MGI Symbol;... [more]
Nfasc3.064e-8224.24neurofascin [Source:MGI Symbol;Acc:MGI:104753][more]
Nfasc5.190e-8123.76neurofascin [Source:MGI Symbol;Acc:MGI:104753][more]
back to top
BLAST of Neuroglian vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P20241|NRG_DROME2.019e-9926.45Neuroglian OS=Drosophila melanogaster OX=7227 GN=N... [more]
sp|O00533|NCHL1_HUMAN1.539e-8925.11Neural cell adhesion molecule L1-like protein OS=H... [more]
sp|P70232|NCHL1_MOUSE4.234e-8524.50Neural cell adhesion molecule L1-like protein OS=M... [more]
sp|P35331|NRCAM_CHICK1.741e-7824.76Neuronal cell adhesion molecule OS=Gallus gallus O... [more]
sp|O94856|NFASC_HUMAN9.409e-7823.99Neurofascin OS=Homo sapiens OX=9606 GN=NFASC PE=1 ... [more]
back to top
BLAST of Neuroglian vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
Q1JUB39.573e-17432.51L1-like cell adhesion molecule OS=Dugesia japonica... [more]
A0A4E0S2U85.827e-16635.47Neuroglian OS=Fasciola hepatica OX=6192 GN=D915_00... [more]
A0A504YWU21.809e-16535.47Neuroglian OS=Fasciola gigantica OX=46835 GN=FGIG_... [more]
A0A3Q0KPG15.958e-16335.71Septate junction protein OS=Schistosoma mansoni OX... [more]
A0A074ZUJ11.668e-16135.26Uncharacterized protein OS=Opisthorchis viverrini ... [more]
back to top
BLAST of Neuroglian vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000055272.12.134e-8324.38neural cell adhesion molecule L1-like protein [Sou... [more]
ENSAMXT00000018100.21.101e-8224.38neural cell adhesion molecule L1-like protein [Sou... [more]
ENSAMXT00000053326.14.075e-8224.38neural cell adhesion molecule L1-like protein [Sou... [more]
ENSAMXT00000038803.14.649e-8224.38neural cell adhesion molecule L1-like protein [Sou... [more]
nfasca1.187e-7825.52neurofascin homolog (chicken) a [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Neuroglian vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfasca1.811e-7525.49neurofascin homolog (chicken) a [Source:ZFIN;Acc:Z... [more]
ENSPMAT00000004759.13.016e-5325.76pep scaffold:Pmarinus_7.0:GL479237:38728:63566:1 g... [more]
cntn3b7.280e-4925.00contactin 3b [Source:ZFIN;Acc:ZDB-GENE-130530-645][more]
ENSPMAT00000008186.17.181e-4024.53pep scaffold:Pmarinus_7.0:GL476501:83598:168579:1 ... [more]
ENSPMAT00000010567.16.656e-3323.64pep scaffold:Pmarinus_7.0:GL479154:561817:685780:1... [more]
back to top
BLAST of Neuroglian vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuroglian vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO453431.224e-4122.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO469469.789e-2130.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO322963.398e-1824.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453833.039e-1724.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495541.688e-1621.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuroglian vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chl1b3.428e-9325.14cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b1.442e-9225.41cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b1.684e-9225.29cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b2.196e-9225.41cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
chl1b3.362e-9225.19cell adhesion molecule L1 like [Source:NCBI gene;A... [more]
back to top
BLAST of Neuroglian vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000005684.10.000e+0100.00SMESG000005684.1[more]
SMESG000025433.12.770e-16931.58SMESG000025433.1[more]
SMESG000021248.18.862e-2724.36SMESG000021248.1[more]
SMESG000018028.13.491e-2525.11SMESG000018028.1[more]
SMESG000036495.13.094e-2321.75SMESG000036495.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016017 ID=SMED30016017|Name=Neuroglian|organism=Schmidtea mediterranea sexual|type=transcript|length=4285bp
AATTTTTATACTTGTTAGGACAATAAAATATATTTTGTGATCGCTATGCG
TTGATAATGCAACCTTCATTATTATACTTGGTCAATTTTACGATAAACAT
GCTGAATTTGCTAATGTTTTCAGAAGCCTCATTCCCTCCCTCATTCATTC
AACAGCCACCTAAGGGAGAATTCCTCTATCAGATGGACACCACAATCATT
TTGCCGTGTTATGCAAAAGCAATTCCTAGTGCCAATTACGAGTGGTTAAA
AAATGGACATTCAATAGAAAACTTGATTGTGAATCAAGATGAAGGAAGTT
TACGAATTGAAAGAGCGATAAGAGAAAATGAAGGGAGTTATCAATGTGTT
GCTTACAATTATCTTGGAAGAGCTATATCTCATAAAACTGAACTACGAAT
GGCTTTCATTTCTTCATATTCTTCGTTAAAGGAAAGAACAATCGATGTAT
TCTATGATGGCAGTGCTATATTGGAATGTGACAGACCGAATTGTTATCCC
CCTGCCTCTATTCAATGGGTAAATGTGAAAGACTATGGTAGATTAATCAG
TTTTGAAGAGGATAATCGAAGAGTTTTGGACAACAACGGAAATCTTCATA
TTACCAAAATTATTGACGAGGACGATGGGGAAATCTATTCTTGCATATCA
ACTAACAATTTCCTGAGAACAATGAAACGTGGGGCAGATACGAAAATAAA
AATAAAGCCTGATTCCATATCATCACATCTATTGAAGCCACTTATAACTC
TATATAATTCAAATTTAGAAAATACAGTTCTCCTCAATACAACCGTCTTG
CTTAGTTGTATTTTCTCTCGTGGCTCCGTTCGTTGGTTTAGACAGCTTGA
TAAAAATGCAGAAATAAAGCCAAAAGAAAGATTCCAAACAATTCGTAAAG
GAACAACATTAGAAATTTCAAATATTGAAAGAAAAGATGCTGGACAATAC
ATTTGTGAGCCCGTTGAGGAACAGAATACTTTAAATATAAAGTTCACAAT
TAATGTTGTCGAGAAACCAATTTTTATTAATCAACCGTTTGACAAAACTG
TTGCTATAAATTCATCAACGATATTTGAATGCCAGGCATCAGGAGAGCCT
AGACCGGAAATTCGATGGACTTCAAATGGACAGGAAATTGGACGCTATCT
AAATGGAGATAGAATTCATTTACATGGAAATAAATTATATCTGAACAACC
TTACAACAAAAGACGTCACTGTAATCCAATGTAATGCATCCAACATTTAC
GGATATGTTTATACCAATGCATTTATTAATGTTTGGAATAGAAAGCCGCT
GTTGTTAGTCCCCCCTCAAAAATATATTAAGGGTGTTTTGAAAATGAATG
TTCAAATTAATTGCCTGGCGTTTAGTGTTCCGCCACCTAGAATCATCTGG
AGGAAAGACTCTTATAATCTGAATCTAATACTGACAAATAAATATTCAAT
GGATGACAATGGTAATCTCATTATAAAGAATTTAAACTCAAATGATGCTG
GAGTTTACGAATGCTTGGCATCCAATATTTTTGGTCAAACAAAAAACGAA
AGCACAATTATTATTAGAGAACCGACCAAAATAATTTCTGTATCACCGAA
TAAAAGAAATCAAATTGGTCTAGATGTGACTTTAGAATGTTCAGCTAGAA
CTGACATACAAGAGGGGGAAAATCTCAAAATTGAATGGTGGAAAAAAAAT
GAGCTTTTAAAGGTTGTAAAGTCACATTCTGCTGCAATATTAAGCAGTGT
TCTGAAACTCGAATCTCTCACGACAAGAGATTCTGGATTTTATAATTGTA
ATGCTTCAAATGGCATTGACTGGGATCTTCGGAAAATTGAACTTCAAGTT
GAAGGAAAACCCGAACCAGTTAGTGATATTCAAGTGGATTGTAAAAGGTA
CTCAAATCATCGTTTGGCACTTTTAACTTGGGTAGATGGGTTTCATAACA
ATGCGGAAATAACGTCGCATATATTTGAATTTATAACTCAATACGACCCA
AAGAATTGGTTGGTAATTTTGCCAGTAAATGAGACATTTCAAACCATCAT
CCGACCGAATAATAAAATCAAAAACAACACTTGGGTTACCATTCATCCAT
ACATAAAATACAACTTCAGAATTAGAAGTGTTAATAAATTAGGCACTTCA
CAGCCAAGTTCAATGACAATCAACAATTGCCAAATGAGAATGGAACGACC
CAATATCAATCCAGATGATGTTTTCATTTACGGTACAAATCCAAATACTC
TCACAATTAAATGGAAGTCAATACCATACTTAAATCACAACGGTCCAAAT
CTGACGTACCATTTAACGATTCGGTGTATGGATTGTGATTATAGTCCTTC
TACATCAAAGTTCCAGATTCAAATCACGTCCTGGAAGACTAGCAGAATAG
TGCTATCCAATATTACTAGTAACTCGAAATTAACAAAAATTGAGATTTAT
AAGCGATATGAAGTAACCATTCAATCAAAGAACACAATGGGATTTAGTAC
AGTTTTGCCTGTAAAGTATTTTGGATTTTCTGGCGAAAGTTATCCGACAA
TAAAGCCCAGTAATTTGAGAATTGACGCAATTACGGATCACAGTGTGAAA
CTTCAGTGGTCCATTATATATGAAAACCAGCTGTCACGGATTAATGGCTT
TTTTAGGGGCTACCGAATCGAGTGGTGTTTAAATGAGACATCGGCAGAGT
TGTGTGACATAAAAAAAAATTGTCAAGATGAAATTCTAATAAAACCAGAT
CCACGAGAATTAAGTTATAGATTGCAAGACCCTGTGACAAGATTCAATGA
ACGTGTGAAAAGAGACGTATATTCATCAATATATGGCCAAATGCACATGG
CAACCTTGACTGGAATACCAGGAATGACAACTATTAGAATATGGACTAGA
ATAATCAACATTCAGTACACTGGACCGAAAAGTGAAGAAGTACGAATTCA
AACCAAAGAAGGAACGCCTGGTCCAGTGGCGGAGTTCAACATCGAAACTA
TCGAGATAAATTACATTGAAATAGCATGGGCAAAGCCATTAGCAACTAAT
GGAATTTTAACTGGATATGATATTGTTGTTAAAGAAAATTTTCAATTTTC
TAATAGTGGAAACAGCGAGAAAAATCATAAAATCCGAGACCCGGATCAAT
TGCGTGAAAGAATTTCTGATTTAAAATCGGAAACTAAATACGACATATCA
ATTTGGGCATTAACAAAACAAGGAAAAGGAAAAGAGAAACAACTTACTTT
TAAGACGAGAGCAGAAAGTAAAGAATCAAAATTAATTCAATTGAAAATAG
AGCGAATATCACAAAATAATTTTAACATGTCAATAACGTTCACTGAACCC
ATTCAGAAATTGCTGGACTTTTCCGATTCTGGGTGGAAATTTTATATCCA
ATTTCGTCTCACTAAAGGAATAATATGGGAAGAAACTGAGAAGCAGTATA
CTCATTGGTGGCTGATTGTCCATCATTTGCTACCTGAAGAAACATATCTT
GTGAGAGCAGTTATTAATACAAAATCTGGATCCGTCAACACTCAATCAAG
ATTTTTGAAAACGGGAACTGGTGAATCGAATGCTTTCTTAATGTTGCGTG
GATCTGGAACGACTTGGTTCGTTATTCTACTCATTTTGATACTGGGGCTT
TTATGCGGAGTTATTGGATTGTTTATTTGGAGAAGACAAAAGATATTATA
CATGAGAGGAAAACAAAGTACTTCGATTCCAGATACTTCGCACATTCATT
CGAACCTCCAAAACCATCCACAAGATCGATATACCTCATTCGTCACTTAT
CAATCTCCAGTTTCAGAAAACCTCCAGATCAGTTTCAACAAGCAAACCAT
TGAGAACGATTATTTTGATGAAAAATTGCCATTTTGTATGGTTAACATGC
AATCAAAATTAGACGAGAAAATACCTTTTCACAGTTCTAGCAACCTTCCC
TCTATTTGCCACCATCAAAAAAGCGATTTAATAAATTCAATGTCAAGAAC
ACAATTTACTCCAACTCTTCACCGATCAGCTCCCAATAATCACATTCCTA
CAGCTTGGACGATGCCTAAATCCCATCAACATCTACCAGACGACATTTAC
AGTGTTTCTAACTCTGCAGTGTGTGATAAAGTATTTTATCATCCATTTGA
CTACAAATCTGCTCAAACTCCCGTTTCCACTTCATTTGTTTAACCATCAT
TTATTAAAATGACAAATATTGAAAATAAAAAATAAAAATTTCAAATTTTC
AACAAGAACTTGGTTTGAAGTTTAACAAGAAGAGA
back to top

protein sequence of SMED30016017-orf-1

>SMED30016017-orf-1 ID=SMED30016017-orf-1|Name=SMED30016017-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1379bp
MQPSLLYLVNFTINMLNLLMFSEASFPPSFIQQPPKGEFLYQMDTTIILP
CYAKAIPSANYEWLKNGHSIENLIVNQDEGSLRIERAIRENEGSYQCVAY
NYLGRAISHKTELRMAFISSYSSLKERTIDVFYDGSAILECDRPNCYPPA
SIQWVNVKDYGRLISFEEDNRRVLDNNGNLHITKIIDEDDGEIYSCISTN
NFLRTMKRGADTKIKIKPDSISSHLLKPLITLYNSNLENTVLLNTTVLLS
CIFSRGSVRWFRQLDKNAEIKPKERFQTIRKGTTLEISNIERKDAGQYIC
EPVEEQNTLNIKFTINVVEKPIFINQPFDKTVAINSSTIFECQASGEPRP
EIRWTSNGQEIGRYLNGDRIHLHGNKLYLNNLTTKDVTVIQCNASNIYGY
VYTNAFINVWNRKPLLLVPPQKYIKGVLKMNVQINCLAFSVPPPRIIWRK
DSYNLNLILTNKYSMDDNGNLIIKNLNSNDAGVYECLASNIFGQTKNEST
IIIREPTKIISVSPNKRNQIGLDVTLECSARTDIQEGENLKIEWWKKNEL
LKVVKSHSAAILSSVLKLESLTTRDSGFYNCNASNGIDWDLRKIELQVEG
KPEPVSDIQVDCKRYSNHRLALLTWVDGFHNNAEITSHIFEFITQYDPKN
WLVILPVNETFQTIIRPNNKIKNNTWVTIHPYIKYNFRIRSVNKLGTSQP
SSMTINNCQMRMERPNINPDDVFIYGTNPNTLTIKWKSIPYLNHNGPNLT
YHLTIRCMDCDYSPSTSKFQIQITSWKTSRIVLSNITSNSKLTKIEIYKR
YEVTIQSKNTMGFSTVLPVKYFGFSGESYPTIKPSNLRIDAITDHSVKLQ
WSIIYENQLSRINGFFRGYRIEWCLNETSAELCDIKKNCQDEILIKPDPR
ELSYRLQDPVTRFNERVKRDVYSSIYGQMHMATLTGIPGMTTIRIWTRII
NIQYTGPKSEEVRIQTKEGTPGPVAEFNIETIEINYIEIAWAKPLATNGI
LTGYDIVVKENFQFSNSGNSEKNHKIRDPDQLRERISDLKSETKYDISIW
ALTKQGKGKEKQLTFKTRAESKESKLIQLKIERISQNNFNMSITFTEPIQ
KLLDFSDSGWKFYIQFRLTKGIIWEETEKQYTHWWLIVHHLLPEETYLVR
AVINTKSGSVNTQSRFLKTGTGESNAFLMLRGSGTTWFVILLILILGLLC
GVIGLFIWRRQKILYMRGKQSTSIPDTSHIHSNLQNHPQDRYTSFVTYQS
PVSENLQISFNKQTIENDYFDEKLPFCMVNMQSKLDEKIPFHSSSNLPSI
CHHQKSDLINSMSRTQFTPTLHRSAPNNHIPTAWTMPKSHQHLPDDIYSV
SNSAVCDKVFYHPFDYKSAQTPVSTSFV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0002028dorsal-ventral muscle cell
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR036179Ig-like_dom_sf
IPR036116FN3_sf
IPR003961FN3_dom
IPR003599Ig_sub
IPR003598Ig_sub2
IPR013783Ig-like_fold
IPR013098Ig_I-set
IPR007110Ig-like_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR003598Immunoglobulin subtype 2SMARTSM00408igc2_5coord: 242..307
e-value: 2.6E-4
score: 30.3
coord: 427..493
e-value: 3.6E-7
score: 39.8
coord: 519..588
e-value: 0.12
score: 15.8
coord: 132..203
e-value: 0.4
score: 11.0
coord: 42..104
e-value: 1.5E-7
score: 41.1
coord: 333..399
e-value: 0.021
score: 23.2
IPR003961Fibronectin type IIISMARTSM00060FN3_2coord: 831..956
e-value: 56.0
score: 5.0
coord: 971..1058
e-value: 6.0E-4
score: 29.1
coord: 1073..1160
e-value: 180.0
score: 0.6
coord: 602..698
e-value: 5.6
score: 13.7
coord: 715..814
e-value: 3.7
score: 15.3
IPR003961Fibronectin type IIIPFAMPF00041fn3coord: 973..1060
e-value: 7.8E-6
score: 26.2
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 1075..1174
score: 6.178
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 833..938
score: 6.21
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 973..1071
score: 12.063
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 718..828
score: 9.902
IPR003961Fibronectin type IIIPROSITEPS50853FN3coord: 604..713
score: 9.137
IPR003961Fibronectin type IIICDDcd00063FN3coord: 971..1067
e-value: 4.69572E-8
score: 50.1875
IPR003961Fibronectin type IIICDDcd00063FN3coord: 718..822
e-value: 0.00240681
score: 36.7055
IPR003961Fibronectin type IIICDDcd00063FN3coord: 602..702
e-value: 1.97698E-4
score: 39.7871
IPR003599Immunoglobulin subtypeSMARTSM00409IG_3ccoord: 126..217
e-value: 12.0
score: 10.9
coord: 421..504
e-value: 8.7E-7
score: 38.5
coord: 513..599
e-value: 0.0025
score: 27.1
coord: 327..410
e-value: 0.014
score: 24.6
coord: 236..318
e-value: 5.9E-5
score: 32.5
coord: 36..116
e-value: 0.011
score: 25.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 411..502
e-value: 4.5E-15
score: 57.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 595..716
e-value: 1.0E-9
score: 40.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 321..410
e-value: 5.1E-17
score: 63.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 20..114
e-value: 7.7E-15
score: 57.0
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 966..1076
e-value: 6.6E-14
score: 53.9
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 503..594
e-value: 2.2E-9
score: 39.4
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 717..826
e-value: 4.5E-13
score: 51.2
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 227..317
e-value: 3.6E-9
score: 38.5
IPR013783Immunoglobulin-like foldGENE3DG3DSA:2.60.40.10coord: 118..221
e-value: 1.7E-10
score: 42.8
NoneNo IPR availablePFAMPF13927Ig_3coord: 510..585
e-value: 2.0E-7
score: 31.5
coord: 413..490
e-value: 1.7E-11
score: 44.6
coord: 27..101
e-value: 3.9E-9
score: 37.0
NoneNo IPR availablePANTHERPTHR44170FAMILY NOT NAMEDcoord: 20..1200
NoneNo IPR availablePANTHERPTHR44170:SF15NEURONAL CELL ADHESION MOLECULEcoord: 20..1200
NoneNo IPR availableCDDcd00096Igcoord: 524..595
e-value: 2.39099E-5
score: 41.4589
NoneNo IPR availableCDDcd00096Igcoord: 247..301
e-value: 4.66166E-5
score: 40.6885
NoneNo IPR availableCDDcd00096Igcoord: 137..202
e-value: 3.07542E-6
score: 44.1553
NoneNo IPR availableCDDcd00096Igcoord: 47..106
e-value: 2.50779E-9
score: 53.0148
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..24
score: 0.486
NoneNo IPR availableTMHMMTMhelixcoord: 1186..1208
IPR013098Immunoglobulin I-setPFAMPF07679I-setcoord: 322..409
e-value: 1.7E-9
score: 37.6
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 28..108
score: 11.515
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 414..502
score: 9.936
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 321..408
score: 9.773
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 506..597
score: 11.061
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 228..310
score: 7.649
IPR007110Immunoglobulin-like domainPROSITEPS50835IG_LIKEcoord: 139..217
score: 7.704
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 26..110
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 506..605
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 239..327
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 317..410
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 424..505
IPR036179Immunoglobulin-like domain superfamilySUPERFAMILYSSF48726Immunoglobulincoord: 127..203
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 602..819
IPR036116Fibronectin type III superfamilySUPERFAMILYSSF49265Fibronectin type IIIcoord: 833..1062