SMED30016009

Overview
NameSMED30016009
Smed IDSMED30016009
Length (bp)3058
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30016009 (SMED30016009) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30016009 (SMED30016009) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30016009 (SMED30016009) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30016009 (SMED30016009) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30016009

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30016009h1SMcG0011035 SmedASXL_010073SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30016009h1SMcG0011035 SmedASXL_010073SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30016009 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.002711:18887..32351 -14971
Homology
BLAST of SMED30016009 vs. Ensembl Human
Match: TDRD1 (tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:11712])

HSP 1 Score: 53.5286 bits (127), Expect = 2.232e-6
Identity = 35/99 (35.35%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  116 NQTITLIATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPKT--------GTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIE 388
            ++TI     E +SPNLF      P+   ++Q  L   +  E   + N PK+        G  C +KY SD+ WYRA V+G    D  V++ + DYGNIE
Sbjct:  939 DKTIQANVLEIISPNLFYAL---PKGMPENQEKLCMLT-AELLEYCNAPKSRPPYRPRIGDACCAKYTSDDFWYRAVVLGTSDTD--VEVLYADYGNIE 1031          
BLAST of SMED30016009 vs. Ensembl Human
Match: TDRD1 (tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:11712])

HSP 1 Score: 53.5286 bits (127), Expect = 2.451e-6
Identity = 35/99 (35.35%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  116 NQTITLIATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPKT--------GTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIE 388
            ++TI     E +SPNLF      P+   ++Q  L   +  E   + N PK+        G  C +KY SD+ WYRA V+G    D  V++ + DYGNIE
Sbjct:  939 DKTIQANVLEIISPNLFYAL---PKGMPENQEKLCMLT-AELLEYCNAPKSRPPYRPRIGDACCAKYTSDDFWYRAVVLGTSDTD--VEVLYADYGNIE 1031          
BLAST of SMED30016009 vs. Ensembl Human
Match: TDRD1 (tudor domain containing 1 [Source:HGNC Symbol;Acc:HGNC:11712])

HSP 1 Score: 53.5286 bits (127), Expect = 2.519e-6
Identity = 35/99 (35.35%), Postives = 50/99 (50.51%), Query Frame = 2
Query:  116 NQTITLIATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPKT--------GTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIE 388
            ++TI     E +SPNLF      P+   ++Q  L   +  E   + N PK+        G  C +KY SD+ WYRA V+G    D  V++ + DYGNIE
Sbjct:  939 DKTIQANVLEIISPNLFYAL---PKGMPENQEKLCMLT-AELLEYCNAPKSRPPYRPRIGDACCAKYTSDDFWYRAVVLGTSDTD--VEVLYADYGNIE 1031          
BLAST of SMED30016009 vs. TrEMBL
Match: E9HA69 (Uncharacterized protein OS=Daphnia pulex OX=6669 GN=DAPPUDRAFT_255836 PE=4 SV=1)

HSP 1 Score: 68.5514 bits (166), Expect = 7.975e-8
Identity = 60/245 (24.49%), Postives = 112/245 (45.71%), Query Frame = 2
Query: 2012 PFDKKPICEYYRTKGRCFKGSKCQDRHVTHSESSDDEDKKEFKWMRSISFMDKSFERCLRVGSIIGMRVTSIYGFGVFYALLTHGIGGFDNDASLSVLSDNEEAISENGLDFSSIHEMEDSLSEYMKYQYSSFNKTTEIIPNA---LVAVAVND-KIHRASITSEISDNRYQVFLVDFGISIEANLEALF-PLPKQYCSVYKQQCFMCKLDGVPIKNETDSKLFADAFWQKVNKRILHAKVIDTF 2731
            P D++ IC +Y  KG C+KG KC   H    ++   ED  E        ++D      L  GS+I ++VT +     FYA+L HG     N     + +D++        D  ++  M+ +L E  +Y  + F++   + P+A   ++A +  D + +R  +  E  ++ + ++ +D+G +   +L  L  P+P+ +  +  Q   M  L+G+      D+    +     V  R L A+V+ T 
Sbjct:  771 PKDEERICRFYAAKGSCYKGIKCDQLHSNPRKNVFTEDTIEV-------YVDVPSLPSLVSGSLIHIQVTCVTNAFRFYAILPHGTRNLQN-----LFADDD--------DGETLETMQQALQE--EYSSNYFSRRMTLAPSAGDVVIAKSPEDNRWYRGRVMEEKENDYFAIYFLDYGNAQPVHLRNLCNPVPR-FIHLPAQAVEM-YLNGIDTSQAADTIQAKNVLVSLVKNRDLVARVVHTI 991          
BLAST of SMED30016009 vs. TrEMBL
Match: M3XI36 (Tudor domain containing 1 OS=Latimeria chalumnae OX=7897 GN=TDRD1 PE=4 SV=1)

HSP 1 Score: 65.855 bits (159), Expect = 5.875e-7
Identity = 60/227 (26.43%), Postives = 99/227 (43.61%), Query Frame = 2
Query:   89 KIEDKDYNYNQTITL--------IATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPK-------TGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKDQNLIKIPFYLIRKDPFSRSRPHL--SNWLIQE 718
            K E +D    Q I+L        +  +  +P++F     C +     Q+  L  +L E  Y   IP         GT C +++  DN+WYRA ++G    D TV + ++DYGN+E+ V  + +R L+G       SL+    L  QA    L GVKPP   ++    + +K L S +  + +V          +++N   +       DP      HL  ++W  +E
Sbjct:  491 KEECEDLQSPQVISLSVGDVFSAVVADIQTPDVFF----CQQLKSGRQLAELQATLSE--YCSRIPANPAFNPAVGTTCCAQFTEDNQWYRASILGYSPED-TVLVGYIDYGNVEE-VLTRRLRPLQG-------SLL---HLPVQAIKCALSGVKPPLETWSPEAIAVMKKLVSQKILEVRVTG-------TREENTAVVELLDKSVDPVVNVAEHLVSASWAAEE 692          
BLAST of SMED30016009 vs. TrEMBL
Match: H3AU05 (Tudor domain containing 1 OS=Latimeria chalumnae OX=7897 GN=TDRD1 PE=4 SV=1)

HSP 1 Score: 65.4698 bits (158), Expect = 6.590e-7
Identity = 60/227 (26.43%), Postives = 99/227 (43.61%), Query Frame = 2
Query:   89 KIEDKDYNYNQTITL--------IATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPK-------TGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKDQNLIKIPFYLIRKDPFSRSRPHL--SNWLIQE 718
            K E +D    Q I+L        +  +  +P++F     C +     Q+  L  +L E  Y   IP         GT C +++  DN+WYRA ++G    D TV + ++DYGN+E+ V  + +R L+G       SL+    L  QA    L GVKPP   ++    + +K L S +  + +V          +++N   +       DP      HL  ++W  +E
Sbjct:  458 KEECEDLQSPQVISLSVGDVFSAVVADIQTPDVFF----CQQLKSGRQLAELQATLSE--YCSRIPANPAFNPAVGTTCCAQFTEDNQWYRASILGYSPED-TVLVGYIDYGNVEE-VLTRRLRPLQG-------SLL---HLPVQAIKCALSGVKPPLETWSPEAIAVMKKLVSQKILEVRVTG-------TREENTAVVELLDKSVDPVVNVAEHLVSASWAAEE 659          
BLAST of SMED30016009 vs. TrEMBL
Match: A0A091TFC8 (Tudor domain-containing protein 1 (Fragment) OS=Phaethon lepturus OX=97097 GN=N335_11725 PE=4 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 2.028e-6
Identity = 59/207 (28.50%), Postives = 91/207 (43.96%), Query Frame = 2
Query:   35 SEYHFVKGTYNEKYSLGPK---IEDKDYNYNQTITLIATEFLSPNLFLGYESC---PEYYLDHQINL------LYDSLGEFFYFDNIPKT-------GTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVID 598
            + + F+K T +E +S G K    ED+++       +        + F G  SC   PE +   QI+       L  SL E  + D  P +       G +C +++  DN WYRA VI     D TV + ++DYGN E  + +  +R++        P LM    L +QA    L GVKPP   +     S +  L   + F  +V+D
Sbjct:  309 ATFFFLKCTVSENHSKGTKEKIPEDEEFLQCANSVVECVSVCVGDAFSGVVSCVQNPENFFCQQIHGARQLAELQMSLNE--HCDKFPSSPAFRPAAGNVCCAQFTEDNLWYRAAVIAYVSED-TVLVGYIDYGNFEV-LALTRLRRM-------IPRLM---DLPAQAIRCTLAGVKPPLGAWTSKAISFMNQLVKDKVFTVKVVD 501          
BLAST of SMED30016009 vs. TrEMBL
Match: G7E1J5 (Uncharacterized protein OS=Mixia osmundae (strain CBS 9802 / IAM 14324 / JCM 22182 / KY 12970) OX=764103 GN=Mo03376 PE=4 SV=1)

HSP 1 Score: 62.7734 bits (151), Expect = 4.211e-6
Identity = 38/114 (33.33%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  257 IPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAV--DYNKNLESKLKALTSHQTFDFQV 592
            +P+ G +  +++ SDN WYRAKV       K V L ++DYGN E NV    +R LE  +           KL +QA +  L  +K P+V  DY+++  + L+  T  Q     V
Sbjct:  726 VPRVGDLVSARFSSDNAWYRAKVTKHNPQRKVVALLYIDYGNTEDNVSYSSLRPLEDRF----------RKLPAQARMGILSMIKLPSVSSDYSEDAFAALREYTEGQILTANV 829          
BLAST of SMED30016009 vs. Ensembl Cavefish
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:103044565])

HSP 1 Score: 55.8398 bits (133), Expect = 2.353e-7
Identity = 33/112 (29.46%), Postives = 60/112 (53.57%), Query Frame = 2
Query:  260 PKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVI 595
            P  GT+C S +  DN+WYRAKV+     D+ V + ++D+GN E+ V++ ++R          P  M+   L +QA    L G+KP +  +++ +   LK L  ++    +++
Sbjct:  461 PAPGTVCCSLFSEDNQWYRAKVLAYSSEDR-VCVGYVDFGNSEE-VELIHLR----------PVSMELLALATQAIPCALAGIKPTSEAWSEEVILMLKRLVCNRFIQVEIL 560          
BLAST of SMED30016009 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 51.9878 bits (123), Expect = 3.558e-6
Identity = 34/131 (25.95%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  200 DHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQV 592
            D Q+ L     G     D  P  GT+C +++  D +WYRA+V+     +K+V + ++D+GN E+ V + ++R +        P+L+    L  QA    L GV+P    +++   S +  + +++T + ++
Sbjct:  416 DLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAY-STEKSVCVGYIDFGNSEE-VDLNHLRPIS-------PALL---ALPKQAISCILAGVQPVEDSWSEECISTMLRMIANKTVNVEI 534          
BLAST of SMED30016009 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 51.9878 bits (123), Expect = 3.755e-6
Identity = 34/131 (25.95%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  200 DHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQV 592
            D Q+ L     G     D  P  GT+C +++  D +WYRA+V+     +K+V + ++D+GN E+ V + ++R +        P+L+    L  QA    L GV+P    +++   S +  + +++T + ++
Sbjct:  425 DLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAY-STEKSVCVGYIDFGNSEE-VDLNHLRPIS-------PALL---ALPKQAISCILAGVQPVEDSWSEECISTMLRMIANKTVNVEI 543          
BLAST of SMED30016009 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 51.9878 bits (123), Expect = 3.977e-6
Identity = 34/131 (25.95%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  200 DHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQV 592
            D Q+ L     G     D  P  GT+C +++  D +WYRA+V+     +K+V + ++D+GN E+ V + ++R +        P+L+    L  QA    L GV+P    +++   S +  + +++T + ++
Sbjct:  416 DLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAY-STEKSVCVGYIDFGNSEE-VDLNHLRPIS-------PALL---ALPKQAISCILAGVQPVEDSWSEECISTMLRMIANKTVNVEI 534          
BLAST of SMED30016009 vs. Ensembl Medaka
Match: tdrd1 (tudor domain containing 1 [Source:NCBI gene;Acc:100144383])

HSP 1 Score: 51.9878 bits (123), Expect = 3.977e-6
Identity = 34/131 (25.95%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  200 DHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQV 592
            D Q+ L     G     D  P  GT+C +++  D +WYRA+V+     +K+V + ++D+GN E+ V + ++R +        P+L+    L  QA    L GV+P    +++   S +  + +++T + ++
Sbjct:  416 DLQLKLREHCSGVETQQDFRPAPGTVCCAQFSEDKQWYRAQVLAY-STEKSVCVGYIDFGNSEE-VDLNHLRPIS-------PALL---ALPKQAISCILAGVQPVEDSWSEECISTMLRMIANKTVNVEI 534          
BLAST of SMED30016009 vs. Planmine SMEST
Match: SMESG000057172.1 (SMESG000057172.1)

HSP 1 Score: 1842.78 bits (4772), Expect = 0.000e+0
Identity = 926/933 (99.25%), Postives = 930/933 (99.68%), Query Frame = 2
Query:   29 MTSEYHFVKGTY-NEKYSLGPKIEDKDYNYNQTITLIATEFLSPNLFLGYESCPEYYLDHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKDQNLIKIPFYLIRKDPFSRSRPHLSNWLIQELNWEECDHVESLEAIITSLYQINYNFFNVQFMIPKSLKRHQRSKNRLKSQINNNNLIQLEHDQSISMDGPENGDLDDFSRLSVKDLSDDENPKSQNDIFEVSGEILINESQQADISTSKINEDSDEDSETLLTISNWKPXXXXXXXXXXXXXWHLPLPEESVFRAIVTHLDSNLGFHINVCSDDIAKSFKSLEKALQTHYLLCNNSMLRQFVGVVDLIPGTLCLCSHNSTYNRAYIIGAQPLESKFRCKLLDYGEEVSLGESDIIPISDQFCQLPALAIECGLSGFNFSFHNTTLLLQKFEQLLAKYDYQVYISICFGDERNNFTKTDEKTLIKQPLFVELFIMYLDDDDKSNFLSLNKVLHELNQENITSVEPEETEPMSVTKNELYLSCSRTLNDIESDNSMDADENIIDGMKDIYITQKIFDEIEMPHPFDKKPICEYYRTKGRCFKGSKCQDRHVTHSESSDDEDKKEFKWMRSISFMDKSFERCLRVGSIIGMRVTSIYGFGVFYALLTHGIGGFDNDASLSVLSDNEEAISENGLDFSSIHEMEDSLSEYMKYQYSSFNKTTEIIPNALVAVAVNDKIHRASITSEISDNRYQVFLVDFGISIEANLEALFPLPKQYCSVYKQQCFMCKLDGVPIKNETDSKLFADAFWQKVNKRILHAKVIDTFEDGMNFIELYDFXXXXXXXXXXXXXXXELNL 2824
            MTSEYHFVKGTY +EKYSLGPKIEDKDYNYNQTITLIATEFLSPNLFLGYESCPEYYLD QINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKDQNLIKIPFYLIRKDPFSRSRPHLSNWLIQELNWEECDHVESLEAIITSLYQINYNFFNVQFMIPKSLKRHQRSKNRLKSQINNNNLIQLEHDQSISMD PENGDLDDFSRLSVKDLS+DENPKSQNDIFEVSGEIL+NESQQADISTSKINEDSDEDSETLLTISNWKPTTLLIDSSITSLLWHLPLPEESVFRAIVTHLDSNLGFHINVCSDDIAKSFKSLEKALQTHYLLCNNSMLRQFVGVVDLIPGTLCLCSHNSTYNRAYIIGAQPLESKFRCKLLDYGEEVSLGESDIIPISDQFCQLPALAIECGLSGFNFSFHNTTLLL+KFEQLLAKYDYQVYISICFGDERNNFTKTDEKTLIKQPLFVELFIMYLDDDDKSNFLSLNKVLHELNQENITSVEPEETEPMSVTKNELYLSCSRTLNDIESDNSMDADENIIDGMKDIYITQKIFDEIEMPHPFDKKPICEYYRTKGRCFKGSKCQDRHVTHSESSDDEDKKEFKWMRSISFMDKSFERCLRVGSIIGMRVTSIYGFGVFYALLTHGIGGFDNDASLSVLSDNEEAISENGLDFSSIHEMEDSLSEYMKYQYSSFNKTTEIIPNALVAVAVNDKIHRASITSEISDNRYQVFLVDFGISIEANLEALFPLPKQYCSVYKQQCFMCKLDGVPIKNETDSKLFADAFWQKVNKRILHAKVIDTFEDGMNFIELYDFINDNSNKSINSIIMSELNL
Sbjct:    1 MTSEYHFVKGTYSDEKYSLGPKIEDKDYNYNQTITLIATEFLSPNLFLGYESCPEYYLDDQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVIGQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKSQAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKDQNLIKIPFYLIRKDPFSRSRPHLSNWLIQELNWEECDHVESLEAIITSLYQINYNFFNVQFMIPKSLKRHQRSKNRLKSQINNNNLIQLEHDQSISMDDPENGDLDDFSRLSVKDLSEDENPKSQNDIFEVSGEILVNESQQADISTSKINEDSDEDSETLLTISNWKPTTLLIDSSITSLLWHLPLPEESVFRAIVTHLDSNLGFHINVCSDDIAKSFKSLEKALQTHYLLCNNSMLRQFVGVVDLIPGTLCLCSHNSTYNRAYIIGAQPLESKFRCKLLDYGEEVSLGESDIIPISDQFCQLPALAIECGLSGFNFSFHNTTLLLKKFEQLLAKYDYQVYISICFGDERNNFTKTDEKTLIKQPLFVELFIMYLDDDDKSNFLSLNKVLHELNQENITSVEPEETEPMSVTKNELYLSCSRTLNDIESDNSMDADENIIDGMKDIYITQKIFDEIEMPHPFDKKPICEYYRTKGRCFKGSKCQDRHVTHSESSDDEDKKEFKWMRSISFMDKSFERCLRVGSIIGMRVTSIYGFGVFYALLTHGIGGFDNDASLSVLSDNEEAISENGLDFSSIHEMEDSLSEYMKYQYSSFNKTTEIIPNALVAVAVNDKIHRASITSEISDNRYQVFLVDFGISIEANLEALFPLPKQYCSVYKQQCFMCKLDGVPIKNETDSKLFADAFWQKVNKRILHAKVIDTFEDGMNFIELYDFINDNSNKSINSIIMSELNL 933          
The following BLAST results are available for this feature:
BLAST of SMED30016009 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
TDRD12.232e-635.35tudor domain containing 1 [Source:HGNC Symbol;Acc:... [more]
TDRD12.451e-635.35tudor domain containing 1 [Source:HGNC Symbol;Acc:... [more]
TDRD12.519e-635.35tudor domain containing 1 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of SMED30016009 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
E9HA697.975e-824.49Uncharacterized protein OS=Daphnia pulex OX=6669 G... [more]
M3XI365.875e-726.43Tudor domain containing 1 OS=Latimeria chalumnae O... [more]
H3AU056.590e-726.43Tudor domain containing 1 OS=Latimeria chalumnae O... [more]
A0A091TFC82.028e-628.50Tudor domain-containing protein 1 (Fragment) OS=Ph... [more]
G7E1J54.211e-633.33Uncharacterized protein OS=Mixia osmundae (strain ... [more]
back to top
BLAST of SMED30016009 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
tdrd12.353e-729.46tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30016009 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30016009 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
tdrd13.558e-625.95tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.755e-625.95tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.977e-625.95tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
tdrd13.977e-625.95tudor domain containing 1 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of SMED30016009 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000057172.10.000e+099.25SMESG000057172.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30016009 ID=SMED30016009|Name=SMED30016009|organism=Schmidtea mediterranea sexual|type=transcript|length=3058bp
TCCGATCTTTTAAAGATTTATTTTGAATATGACTTCTGAGTATCATTTTG
TCAAAGGAACTTATAATGAAAAATATTCACTTGGTCCTAAGATTGAGGAC
AAAGATTATAATTATAATCAAACAATTACTTTAATTGCAACTGAATTTTT
ATCACCTAATTTGTTTCTCGGTTATGAAAGTTGTCCAGAGTATTATCTAG
ATCACCAAATTAATTTATTATACGATTCCTTAGGTGAGTTTTTTTATTTT
GACAATATACCGAAAACTGGAACCATATGTGTTTCAAAATATAAATCTGA
TAATAAATGGTATCGTGCTAAAGTTATTGGCCAATGCCACATTGATAAGA
CAGTTGATCTATATTTTCTTGATTATGGAAATATAGAGAAAAACGTTCAA
ATGAAATATATTAGAAAATTAGAAGGAACATATTCAACCCAATTTCCTTC
TTTAATGAAAAATAATAAACTTAAGAGTCAAGCGGCATTATTTGGCCTAG
TTGGTGTCAAGCCACCGGCTGTTGATTACAACAAAAACTTGGAATCTAAA
TTAAAAGCACTGACATCTCATCAAACTTTTGATTTTCAAGTAATTGATTT
GCCAGTTATCAATGTGAAAGTCAAAGATCAAAATTTAATTAAAATTCCAT
TTTATCTTATTCGGAAGGATCCATTTTCAAGATCACGCCCACATTTATCG
AATTGGCTAATTCAAGAATTAAATTGGGAAGAGTGTGATCACGTGGAATC
ATTAGAAGCAATAATCACATCACTTTATCAAATCAATTACAACTTTTTCA
ATGTTCAATTCATGATTCCAAAATCTTTAAAAAGACATCAGAGATCAAAA
AATCGTTTGAAATCACAAATCAACAATAATAACTTAATTCAGTTAGAACA
CGACCAATCTATTAGTATGGATGGCCCTGAAAATGGAGATCTAGATGATT
TTTCTAGATTATCTGTGAAAGATTTATCAGACGATGAAAATCCAAAATCA
CAAAATGATATATTTGAGGTGTCAGGTGAAATTTTAATAAATGAATCTCA
ACAAGCAGATATTTCAACTAGTAAAATAAATGAAGACTCTGATGAAGACA
GTGAAACACTACTCACAATTTCCAATTGGAAACCGACAACACTTCTTATA
GATTCATCCATCACCAGTTTATTGTGGCATTTACCCTTACCAGAAGAATC
GGTTTTCAGAGCAATTGTGACACATCTTGATTCTAATCTTGGGTTTCATA
TCAACGTTTGCTCAGATGATATCGCAAAATCCTTTAAAAGCTTAGAGAAA
GCTCTCCAGACTCATTATCTTCTATGTAACAATTCTATGTTACGGCAGTT
CGTTGGCGTTGTAGATCTCATTCCTGGAACTTTGTGTTTGTGTTCTCACA
ATTCCACTTACAATCGAGCCTACATTATTGGAGCACAACCATTAGAAAGC
AAATTCCGATGCAAATTATTGGATTACGGGGAAGAAGTGTCTCTCGGAGA
ATCTGATATAATACCGATCAGTGATCAATTTTGCCAGTTACCTGCTTTAG
CAATAGAATGTGGTTTGTCGGGTTTTAATTTCAGCTTTCATAATACCACA
TTATTATTGCAAAAATTCGAACAGCTATTGGCCAAATACGATTATCAAGT
TTATATTTCGATTTGTTTTGGCGATGAAAGAAATAATTTCACCAAAACCG
ATGAGAAAACTCTGATAAAACAGCCACTGTTCGTTGAGCTGTTTATTATG
TACTTGGATGATGATGATAAATCGAATTTCCTTTCTCTGAATAAGGTTTT
ACACGAATTGAATCAGGAAAATATCACGAGCGTAGAACCAGAAGAAACGG
AACCAATGAGTGTAACAAAAAACGAACTGTATCTGAGTTGCTCTAGAACT
CTAAATGATATTGAAAGTGATAATTCCATGGATGCCGATGAAAATATAAT
CGATGGGATGAAGGATATCTATATCACTCAGAAAATTTTCGACGAAATTG
AAATGCCTCACCCATTTGATAAGAAACCGATTTGTGAGTATTATCGAACG
AAAGGTCGATGTTTCAAGGGTTCCAAATGTCAAGATCGCCATGTTACTCA
CTCAGAGTCTTCTGATGACGAAGACAAGAAAGAATTTAAATGGATGCGTT
CTATTTCATTTATGGATAAATCATTCGAAAGGTGTTTAAGGGTGGGCTCG
ATCATTGGTATGCGAGTTACATCAATATATGGATTTGGTGTGTTTTATGC
ACTCCTCACTCATGGAATTGGAGGCTTTGATAATGATGCTTCACTGTCTG
TTTTATCTGACAATGAGGAGGCGATCAGTGAAAACGGATTGGATTTTTCC
TCTATCCATGAAATGGAAGACAGTCTCAGTGAATACATGAAATATCAATA
TAGTTCATTCAATAAAACTACTGAAATTATACCAAATGCTTTAGTAGCAG
TGGCTGTAAATGATAAAATTCATAGAGCAAGTATAACTAGTGAAATCTCA
GATAATCGATATCAAGTGTTTTTGGTGGACTTCGGAATAAGTATCGAGGC
AAATTTAGAAGCGTTATTTCCATTGCCTAAACAATATTGCAGTGTTTATA
AACAGCAATGCTTCATGTGTAAATTAGATGGAGTTCCAATAAAAAATGAA
ACAGATTCAAAATTATTTGCTGATGCTTTTTGGCAAAAAGTAAACAAACG
AATTTTGCATGCGAAAGTTATTGATACATTTGAAGACGGAATGAATTTTA
TTGAATTGTACGATTTCATCAATGACAATTCCAATAAATCAATCAATTCC
ATCATAATGAGTGAATTAAACCTTTGAAATAAAAGTTCTGTCTACCCATT
TGTCGCATTTATGTATATCTGTGTGTGTGTGTGTGTTTGTCATAAAATAA
TACATTCTAATTGTTTTTAATGTTTTTATTTTTTTATTGATTTGTAGAAA
ATTGTATTTTAATAATATTAAATTTTTATTTTGCTTGCAAATATTCGTAA
ATGTCAAATTTTTCGACGTGTCACAATAATCAATGTTTTTGTGCATTTAA
TTGAGCGG
back to top

protein sequence of SMED30016009-orf-1

>SMED30016009-orf-1 ID=SMED30016009-orf-1|Name=SMED30016009-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=933bp
MTSEYHFVKGTYNEKYSLGPKIEDKDYNYNQTITLIATEFLSPNLFLGYE
SCPEYYLDHQINLLYDSLGEFFYFDNIPKTGTICVSKYKSDNKWYRAKVI
GQCHIDKTVDLYFLDYGNIEKNVQMKYIRKLEGTYSTQFPSLMKNNKLKS
QAALFGLVGVKPPAVDYNKNLESKLKALTSHQTFDFQVIDLPVINVKVKD
QNLIKIPFYLIRKDPFSRSRPHLSNWLIQELNWEECDHVESLEAIITSLY
QINYNFFNVQFMIPKSLKRHQRSKNRLKSQINNNNLIQLEHDQSISMDGP
ENGDLDDFSRLSVKDLSDDENPKSQNDIFEVSGEILINESQQADISTSKI
NEDSDEDSETLLTISNWKPTTLLIDSSITSLLWHLPLPEESVFRAIVTHL
DSNLGFHINVCSDDIAKSFKSLEKALQTHYLLCNNSMLRQFVGVVDLIPG
TLCLCSHNSTYNRAYIIGAQPLESKFRCKLLDYGEEVSLGESDIIPISDQ
FCQLPALAIECGLSGFNFSFHNTTLLLQKFEQLLAKYDYQVYISICFGDE
RNNFTKTDEKTLIKQPLFVELFIMYLDDDDKSNFLSLNKVLHELNQENIT
SVEPEETEPMSVTKNELYLSCSRTLNDIESDNSMDADENIIDGMKDIYIT
QKIFDEIEMPHPFDKKPICEYYRTKGRCFKGSKCQDRHVTHSESSDDEDK
KEFKWMRSISFMDKSFERCLRVGSIIGMRVTSIYGFGVFYALLTHGIGGF
DNDASLSVLSDNEEAISENGLDFSSIHEMEDSLSEYMKYQYSSFNKTTEI
IPNALVAVAVNDKIHRASITSEISDNRYQVFLVDFGISIEANLEALFPLP
KQYCSVYKQQCFMCKLDGVPIKNETDSKLFADAFWQKVNKRILHAKVIDT
FEDGMNFIELYDFINDNSNKSINSIIMSELNL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR002999Tudor
IPR000571Znf_CCCH
Vocabulary: molecular function
TermDefinition
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0016442RISC complex
Vocabulary: biological process
TermDefinition
GO:0031047gene silencing by RNA
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002999Tudor domainSMARTSM00333TUDOR_7coord: 445..502
e-value: 12.0
score: 7.5
coord: 798..854
e-value: 0.28
score: 20.3
coord: 76..136
e-value: 9.6E-8
score: 41.7
IPR002999Tudor domainPFAMPF00567TUDORcoord: 75..148
e-value: 3.0E-13
score: 49.9
coord: 388..515
e-value: 2.0E-11
score: 44.0
coord: 776..868
e-value: 6.5E-12
score: 45.6
IPR002999Tudor domainPROSITEPS50304TUDORcoord: 77..137
score: 13.202
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 781..856
e-value: 1.8E-13
score: 52.7
NoneNo IPR availableGENE3DG3DSA:2.40.50.790coord: 858..912
e-value: 1.8E-13
score: 52.7
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 415..512
e-value: 2.3E-11
score: 45.3
NoneNo IPR availableGENE3DG3DSA:2.30.30.140coord: 74..133
e-value: 3.3E-14
score: 54.2
NoneNo IPR availablePANTHERPTHR22948TUDOR DOMAIN CONTAINING PROTEINcoord: 78..163
coord: 774..921
coord: 385..543
NoneNo IPR availableCDDcd04508TUDORcoord: 81..130
e-value: 8.06079E-13
score: 61.4599
NoneNo IPR availableCDDcd04508TUDORcoord: 811..848
e-value: 0.00164838
score: 35.2664
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 57..133
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 419..516
NoneNo IPR availableSUPERFAMILYSSF63748Tudor/PWWP/MBTcoord: 773..869
IPR000571Zinc finger, CCCH-typePROSITEPS50103ZF_C3H1coord: 663..691
score: 13.892