aurora kinase-1

Overview
Nameaurora kinase-1 (AFJ24782.1)
Smed IDSMED30015999
Length (bp)1059
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of aurora kinase-1 (SMED30015999) t-SNE clustered cells

Violin plots show distribution of expression levels for aurora kinase-1 (SMED30015999) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of aurora kinase-1 (SMED30015999) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for aurora kinase-1 (SMED30015999) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015999

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015999SMESG000006604.1 SmedASXL_015261SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015999SMESG000006604.1 SmedASXL_015261SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30015999SMESG000006604.1 dd_Smed_v4_9065_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30015999SMESG000006604.1 dd_Smed_v6_9065_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30015999SMESG000006604.1 dd_Smed_v4_9065_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30015999SMESG000006604.1 SMED_00815_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30015999SMESG000006604.1 SMED_00815_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30015999SMESG000006604.1 SmWIOct06_040468GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of aurora kinase-1 vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 299.286 bits (765), Expect = 1.072e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 299.286 bits (765), Expect = 1.072e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 299.286 bits (765), Expect = 1.072e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 299.286 bits (765), Expect = 1.072e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. Ensembl Human
Match: AURKA (aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393])

HSP 1 Score: 299.286 bits (765), Expect = 1.072e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. Ensembl Celegans
Match: air-2 (Aurora/IPL1-related protein kinase 2 [Source:UniProtKB/Swiss-Prot;Acc:O01427])

HSP 1 Score: 267.314 bits (682), Expect = 7.324e-88
Identity = 126/280 (45.00%), Postives = 185/280 (66.07%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNN 945
            + I++F IG+ +G G+FGSVYL + K  +F +AIK++ K+ +    + +QL+REIEI SHL HPNI++LY YF D +++YL++E A  GE+Y+ +    R+    AA YM+++A AL YCH ++V+HRDIKPEN+LIGS+G+ K+ DFGWSVH  +  R TMCGT+DYL PEMV    ++  +D+W +GVL YE L    PFE   + KT   IK+  F  PD V   A D+I ++LV++PKAR +L+Q+ +H +I    E      +  ++   A L N
Sbjct:   25 FTINDFEIGRPLGKGKFGSVYLARTKTGHFHVAIKVLFKSQLISGGVEHQLEREIEIQSHLNHPNIIKLYTYFWDAKKIYLVLEYAPGGEMYKQLTVSKRFSEPTAAKYMYEIADALSYCHRKNVIHRDIKPENLLIGSQGELKIGDFGWSVHAPSNKRQTMCGTMDYLPPEMVNGADHSDAVDLWAIGVLCYEFLVGKPPFEHEDQSKTYAAIKAARFTYPDSVKKGARDLIGRLLVVDPKARCTLEQVKEHYWIQGMMEAKIRAEKQQKIEKEASLRN 304          
BLAST of aurora kinase-1 vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 256.144 bits (653), Expect = 2.590e-83
Identity = 121/268 (45.15%), Postives = 179/268 (66.79%), Query Frame = 1
Query:   94 EPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQ-KYGRYINER-AATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            E   W +D+F +G+ +G G+FG+V++ +EK+   ++A+K++ K  + +  + +QLKREIEI  HL HPNIL LYGYFHD +RV+++++ A++GEL+  +Q + G  +NE  A  ++ QLA AL YCH + V+HRDIKPEN+L+ SK   KLADFGWSV      R+T+CGT+DYLAPEMV    + F +DIW +G+LL+EML    PF + +  K + RIK  +  +P  V   AA +I  I+   P+ RL L  I+ HP+I E  ++
Sbjct:   35 EESCWSLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQR 302          
BLAST of aurora kinase-1 vs. Ensembl Celegans
Match: air-1 (Aurora/Ipl1 Related kinase; Aurora/Ipl1-related protein kinase 1 [Source:UniProtKB/TrEMBL;Acc:G5EDL3])

HSP 1 Score: 256.144 bits (653), Expect = 2.590e-83
Identity = 121/268 (45.15%), Postives = 179/268 (66.79%), Query Frame = 1
Query:   94 EPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQ-KYGRYINER-AATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            E   W +D+F +G+ +G G+FG+V++ +EK+   ++A+K++ K  + +  + +QLKREIEI  HL HPNIL LYGYFHD +RV+++++ A++GEL+  +Q + G  +NE  A  ++ QLA AL YCH + V+HRDIKPEN+L+ SK   KLADFGWSV      R+T+CGT+DYLAPEMV    + F +DIW +G+LL+EML    PF + +  K + RIK  +  +P  V   AA +I  I+   P+ RL L  I+ HP+I E  ++
Sbjct:   35 EESCWSLDDFDVGRPLGKGKFGNVFISREKKTKRIIALKVLFKTQLLQLGVSHQLKREIEIQYHLRHPNILTLYGYFHDDKRVFVILDYASRGELFNVLQSQPGHKVNEVIAGRFVRQLANALHYCHSKGVIHRDIKPENLLLDSKLNLKLADFGWSVVADHSKRHTLCGTMDYLAPEMVSNQPHDFNVDIWAIGILLFEMLVGYAPFANQTGDKLIARIKECKIYIPSVVTDGAASLINAIIKKEPQERLPLVDIMAHPWIKEMKQR 302          
BLAST of aurora kinase-1 vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 163.696 bits (413), Expect = 1.003e-47
Identity = 90/261 (34.48%), Postives = 143/261 (54.79%), Query Frame = 1
Query:  115 DNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQ---CKLADFGWSVHYK-TGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVP----DFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            DN+ + +++G G F  V     K      A K+I    +   D   +L+RE  I   L HPNI+RL+    ++   YL+ +L T GEL+EDI     Y    A+  + Q+  ++ YCH   ++HRD+KPEN+L+ SK +    KLADFG ++    +   +   GT  YL+PE++++D Y+  +DIW  GV+LY +L    PF D  + +   +IK+  +  P    D V P A  +I  +L +NPK R++ DQ ++ P+I
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQ-KLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of aurora kinase-1 vs. Ensembl Celegans
Match: unc-43 (Calcium/calmodulin-dependent protein kinase type II [Source:UniProtKB/Swiss-Prot;Acc:O62305])

HSP 1 Score: 163.696 bits (413), Expect = 1.003e-47
Identity = 90/261 (34.48%), Postives = 143/261 (54.79%), Query Frame = 1
Query:  115 DNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQ---CKLADFGWSVHYK-TGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVP----DFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            DN+ + +++G G F  V     K      A K+I    +   D   +L+RE  I   L HPNI+RL+    ++   YL+ +L T GEL+EDI     Y    A+  + Q+  ++ YCH   ++HRD+KPEN+L+ SK +    KLADFG ++    +   +   GT  YL+PE++++D Y+  +DIW  GV+LY +L    PF D  + +   +IK+  +  P    D V P A  +I  +L +NPK R++ DQ ++ P+I
Sbjct:   10 DNYDVKEELGKGAFSVVRRCVHKTTGLEFAAKIINTKKLSARDFQ-KLEREARICRKLQHPNIVRLHDSIQEESFHYLVFDLVTGGELFEDIVAREFYSEADASHCIQQILESIAYCHSNGIVHRDLKPENLLLASKAKGAAVKLADFGLAIEVNDSEAWHGFAGTPGYLSPEVLKKDPYSKPVDIWACGVILYILLVGYPPFWDEDQHRLYAQIKAGAYDYPSPEWDTVTPEAKSLIDSMLTVNPKKRITADQALKVPWI 269          
BLAST of aurora kinase-1 vs. Ensembl Fly
Match: aurA (gene:FBgn0000147 transcript:FBtr0082483)

HSP 1 Score: 270.781 bits (691), Expect = 8.376e-88
Identity = 126/267 (47.19%), Postives = 188/267 (70.41%), Query Frame = 1
Query:   91 TEPQ----NWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYG--RYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            T+PQ     W ++NF IG+ +G G+FG+VYL +EK + FV+A+K++ K  I E+++ +Q++REIEI SHL HP+ILRLY YFHD  R+YL++E A +G L+  +Q     R+   ++ATY+  L  AL Y HER ++HRDIKPEN+L+G KG  K+ADFGWSVH    +R T+CGT+DYL PEMV+   +T  +D+W LGVL +E+L    PF   +  +T ++I  V++ +P+ ++  A+ +I K+LV+NP+ RL LDQ++ HP+I
Sbjct:  140 TQPQKPKKTWELNNFDIGRLLGRGKFGNVYLAREKESQFVVALKVLFKRQIGESNVEHQVRREIEIQSHLRHPHILRLYAYFHDDVRIYLILEYAPQGTLFNALQAQPMKRFDERQSATYIQALCSALLYLHERDIIHRDIKPENLLLGHKGVLKIADFGWSVHEPNSMRMTLCGTVDYLPPEMVQGKPHTKNVDLWSLGVLCFELLVGHAPFYSKNYDETYKKILKVDYKLPEHISKAASHLISKLLVLNPQHRLPLDQVMVHPWI 406          
BLAST of aurora kinase-1 vs. Ensembl Fly
Match: aurB (gene:FBgn0024227 transcript:FBtr0080180)

HSP 1 Score: 234.958 bits (598), Expect = 8.712e-75
Identity = 109/265 (41.13%), Postives = 172/265 (64.91%), Query Frame = 1
Query:   85 AMTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYG--RYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            A  +P +W   +F +G  +G G+FG VYL +E+ +++++A+K++ K  +++  +  Q+ REIEI S L HP+ILRL  +FHD+ R+YL +E+A++GEL++ ++     R+   R+A Y +Q+A AL YCH  +V+HRD+KPENIL+ S    KLADFGWS H     R T+CGTLDYL PEMV+ +SY   +D WCLG+L YE +    PFE  S + T  +I+ +E + P  ++    ++I  +L    K R++L  ++ H ++
Sbjct:   41 AYGQPYDWSPRDFEMGAHLGRGKFGRVYLARERHSHYLVAMKVMFKEELRKGCVQRQVLREIEIQSRLKHPHILRLLTWFHDESRIYLALEIASEGELFKHLRGAPNHRFDEPRSAKYTYQVANALNYCHLNNVIHRDLKPENILLTSTDDLKLADFGWSAHTPNNKRRTLCGTLDYLPPEMVDGNSYDDSVDQWCLGILCYEFVVGCPPFESNSTESTYSKIRRMEISYPSHLSKGCKELIGGLLRKESKGRITLVDVMTHYWV 305          
BLAST of aurora kinase-1 vs. Ensembl Fly
Match: Sik2 (gene:FBgn0025625 transcript:FBtr0070340)

HSP 1 Score: 185.267 bits (469), Expect = 1.078e-51
Identity = 97/255 (38.04%), Postives = 161/255 (63.14%), Query Frame = 1
Query:  121 FY-IGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATY-MHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTG-VRNTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            FY I + IG G F  V L + +     +AIK+I K+ + + +L  ++ RE+EI   L HP+I++LY     K  +Y++ E A++GE+++ I KYGR ++E AA +   Q+  A++YCH++ ++HRD+K EN+L+      K+ADFG+S H+K G +  T CG+  Y APE+ E   YT  EIDIW LGV+LY ++  ++PF+  + Q   +R+ S  F +P F++     +I+++LV+ P  R ++DQI +H ++
Sbjct:  140 FYDIERTIGKGNFAVVKLARHRITKNEVAIKIIDKSQLDQTNLQ-KVYREVEIMKRLKHPHIIKLYQVMETKNMIYIVSEYASQGEIFDYIAKYGR-MSESAARFKFWQIISAVEYCHKKGIVHRDLKAENLLLDLNMNIKIADFGFSNHFKPGELLATWCGSPPYAAPEVFEGKQYTGPEIDIWSLGVVLYVLVCGALPFDGSTLQSLRDRVLSGRFRIPFFMSSECEHLIRRMLVLEPTRRYTIDQIKRHRWM 392          
BLAST of aurora kinase-1 vs. Ensembl Fly
Match: SAK (gene:FBgn0026371 transcript:FBtr0078387)

HSP 1 Score: 178.333 bits (451), Expect = 9.910e-50
Identity = 91/257 (35.41%), Postives = 151/257 (58.75%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINE-RAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRN--TMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            I+++ +   +G G F +VY  +    +  +AIKMI K  I+   L N++++E+EIHS L HP++L+LY +F D   VYL++ELA  GEL+  +    R   E  AA+ + Q+   L Y H  ++MHRDI   N+L+  +   K+ADFG +   K       TMCGT +Y++PE+V + S+    D+W +G +LY +L    PFE  + Q T+ ++   E+ +P  ++  A D+I K+L   P  R++L+ ++ HP++
Sbjct:   11 IEDYEVQHLLGKGGFATVYKARCLHTHQDVAIKMIDKKLIQGTGLTNRVRQEVEIHSRLKHPSVLQLYTFFQDANYVYLVLELAHNGELHRYMNHIARPFTETEAASILKQVVAGLLYLHSHNIMHRDISLSNLLLSREMHVKIADFGLATQLKRPDERHMTMCGTPNYISPEVVSRTSHGLPADVWSVGCMLYTLLVGRPPFETDAVQSTLNKVVMSEYIMPAHLSYEAQDLINKLLKKLPHERITLEAVLCHPFM 267          
BLAST of aurora kinase-1 vs. Ensembl Fly
Match: par-1 (gene:FBgn0260934 transcript:FBtr0301503)

HSP 1 Score: 172.555 bits (436), Expect = 2.133e-47
Identity = 88/269 (32.71%), Postives = 158/269 (58.74%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGK-----KIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            + P  W     +IGK      IG G F  V L K       +AIK+I K  +    L  +L RE+ I   L HPNI++L+     ++ +YL++E A+ GE+++ +  +GR   + A     Q+  A++YCH++ ++HRD+K EN+L+ S+   K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  ++++K LV+NP  R SL+ I+   +++
Sbjct:  466 SAPMRWRATEEHIGKYKLIKTIGKGNFAKVKLAKHLPTGKEVAIKIIDKTQLNPGSLQ-KLFREVRIMKMLDHPNIVKLFQVIETEKTLYLIMEYASGGEVFDYLVLHGRMKEKEARVKFRQIVSAVQYCHQKRIIHRDLKAENLLLDSELNIKIADFGFSNEFTPGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGSTLRELRERVLRGKYRIPFYMSTDCENLLRKFLVLNPAKRASLETIMGDKWMN 733          
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 298.516 bits (763), Expect = 1.374e-98
Identity = 131/262 (50.00%), Postives = 192/262 (73.28%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            W ++NF IG+ +G G+FGSVYL +E++  F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G + ++R+ATY+ +LA AL+YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  S ++T  +I  VEF  P  V+  + D+I ++L  NP  RL +  +++HP++ E S K
Sbjct:  133 WTLENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSNGSRDLINRLLKHNPMHRLPIQGVMEHPWVVENSTK 394          
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:791894])

HSP 1 Score: 283.878 bits (725), Expect = 4.940e-94
Identity = 127/262 (48.47%), Postives = 189/262 (72.14%), Query Frame = 1
Query:  109 CIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
             ID+F IG+ +G G+FG+VYL +E++   V+A+K++ K+ + +  + +QL+REIEI SHL HPNILR Y YFHD  RV+L++E A +GE+Y+++Q+YG + ++R ATYM +++ AL+YCHE+ V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  S+  ++D+W +GVL YE L  + PFE  S  +T +RI  V+   P  V+  A D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   49 SIDDFDIGRPLGKGKFGNVYLARERKLKVVIALKVLFKSQMVKEGVEHQLRREIEIQSHLRHPNILRFYNYFHDDTRVFLILEYAPRGEMYKELQRYGHFDDQRTATYMEEVSDALQYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWSIGVLCYECLVGNPPFETASHAETYKRITKVDLQFPKLVSEGARDLISKLLRHSPSMRLPLRSVMEHPWVKANSRRV 310          
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 204.527 bits (519), Expect = 2.169e-63
Identity = 86/156 (55.13%), Postives = 125/156 (80.13%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKT 573
            W ++NF IG+ +G G+FGSVYL +E++  F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G + ++R+ATY+ +LA AL+YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +
Sbjct:  133 WTLENFDIGRALGKGKFGSVYLAREQQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILEFAPKGELYGELQRCGTFDDQRSATYIMELADALRYCHSKAVIHRDIKPENLLLGANGELKIADFGWSVHTPS 288          
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Match: mark3a (MAP/microtubule affinity-regulating kinase 3a [Source:ZFIN;Acc:ZDB-GENE-030131-6232])

HSP 1 Score: 172.94 bits (437), Expect = 4.917e-49
Identity = 85/257 (33.07%), Postives = 157/257 (61.09%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            I N+ + K IG G F  V L +       +AIKMI K  +    L  +L RE+ I  +L HPNI++L+     ++ ++L++E A+ GE+++ +  +GR   + A     Q+  A++YCH++ ++HRD+K EN+L+      K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  +++K+ LV+NP  R +L+QI++  +I+
Sbjct:   54 IGNYRLLKTIGKGNFAKVKLARHILTGSEVAIKMIDKTQLNPTSLQ-KLSREVTIMKNLNHPNIVKLFEVIETEKTLFLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKRIVHRDLKAENLLLDGDMNIKIADFGFSNEFMVGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGTLEQIMKERWIN 309          
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Match: MARK4 (si:dkey-31m14.7 [Source:ZFIN;Acc:ZDB-GENE-121214-92])

HSP 1 Score: 167.162 bits (422), Expect = 4.226e-48
Identity = 85/257 (33.07%), Postives = 155/257 (60.31%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            I N+ + K IG G F  V L +       +AIK+I K  +    L  +L RE+ I   L HPNI++L+     ++ +YL++E A+ GE+++ +  +GR   + A     Q+  A+ YCH ++++HRD+K EN+L+ +    K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+DIW LGV+LY +++ S+PF+  + ++  ER+   ++ VP +++ +   ++++ LV+NP  R +L+QI++  +++
Sbjct:   55 IGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQ-KLFREVRIMKGLNHPNIVQLFEVIETEKTLYLVMEYASGGEVFDYLVSHGRMKEKEARGKFRQIVSAVHYCHLKNIVHRDLKAENLLLDADSNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRVPFYMSTDCEGILRRFLVLNPTKRCTLEQIMKDKWMN 310          
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 306.22 bits (783), Expect = 4.299e-102
Identity = 132/265 (49.81%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL ++K+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL +E L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   86 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 350          
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 306.605 bits (784), Expect = 4.558e-102
Identity = 132/265 (49.81%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL ++K+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL +E L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   96 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 360          
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:549613])

HSP 1 Score: 306.22 bits (783), Expect = 7.321e-102
Identity = 132/265 (49.81%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL ++K+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL +E L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:  101 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 365          
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Match: zbtb39 (zinc finger and BTB domain containing 39 [Source:Xenbase;Acc:XB-GENE-957946])

HSP 1 Score: 297.36 bits (760), Expect = 7.050e-98
Identity = 129/258 (50.00%), Postives = 188/258 (72.87%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            + WC+++F IG+ +G G+FG+VYL +E+ + F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL+++ A  GEL+ ++QK  R+  +++A Y+ QLA AL YCH ++V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T  RI  VEF  P +V+  A D++ K+L  NP  RLSL  +++HP+I
Sbjct:  139 KQWCLEDFEIGRPLGKGKFGNVYLARERESKFILALKVLFKTQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDAARVYLILDYAPGGELFRELQKVTRFDEQKSALYIKQLAEALLYCHSKNVIHRDIKPENLLLGANGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFETDTHQETYRRISKVEFQYPSYVSEGARDLVSKLLKHNPNHRLSLKGVLEHPWI 396          
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Match: ENSXETT00000045494.1 (MAP/microtubule affinity-regulating kinase 4 [Source:NCBI gene;Acc:100491038])

HSP 1 Score: 172.17 bits (435), Expect = 4.187e-48
Identity = 84/262 (32.06%), Postives = 159/262 (60.69%), Query Frame = 1
Query:   97 PQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            P+   + N+ + + IG G F  V L +       +AIK+I K  +  + L  +L RE+ I   L HPNI++L+     ++ +YL++E A+ GE+++ +  +GR   + A     Q+  A+ YCH+++++HRD+K EN+L+ S+   K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +   ++++ LV+NP  R +LDQI+   +++
Sbjct:   43 PEEPHVGNYRLLRTIGKGNFAKVKLARHVLTGREVAIKIIDKTQLNPSSLQ-KLFREVRIMKGLNHPNIVKLFEVIETEKTLYLIMEYASGGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHRDLKAENLLLDSESNIKIADFGFSNEFTPGGKLDTFCGSPPYAAPELFQGKRYNGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCEGVLRRFLVLNPSKRCTLDQIMNDKWMN 303          
BLAST of aurora kinase-1 vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 299.286 bits (765), Expect = 5.443e-99
Identity = 133/267 (49.81%), Postives = 191/267 (71.54%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            T+ + W +++F IG+ +G G+FG+VYL +E+++ F+LA+K++ K  +++ ++ +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T  RI  VEF  PDFV   A D+I ++L  N   RL+L ++++HP+I   S K
Sbjct:  114 TKKRQWTLEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of aurora kinase-1 vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 299.286 bits (765), Expect = 5.443e-99
Identity = 133/267 (49.81%), Postives = 191/267 (71.54%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            T+ + W +++F IG+ +G G+FG+VYL +E+++ F+LA+K++ K  +++ ++ +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T  RI  VEF  PDFV   A D+I ++L  N   RL+L ++++HP+I   S K
Sbjct:  114 TKKRQWTLEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of aurora kinase-1 vs. Ensembl Mouse
Match: Aurka (aurora kinase A [Source:MGI Symbol;Acc:MGI:894678])

HSP 1 Score: 298.516 bits (763), Expect = 2.235e-98
Identity = 133/267 (49.81%), Postives = 191/267 (71.54%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            T+ + W +++F IG+ +G G+FG+VYL +E+++ F+LA+K++ K  +++ ++ +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T  RI  VEF  PDFV   A D+I ++L  N   RL+L ++++HP+I   S K
Sbjct:  136 TKKRQWTLEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANSSK 402          
BLAST of aurora kinase-1 vs. Ensembl Mouse
Match: Aurkb (aurora kinase B [Source:MGI Symbol;Acc:MGI:107168])

HSP 1 Score: 288.115 bits (736), Expect = 2.483e-95
Identity = 129/265 (48.68%), Postives = 190/265 (71.70%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            Q + IDNF IG+ +G G+FG+VYL +EK++ F++A+K++ K+ I++  + +QL+REIEI +HL HPNIL+LY YF+D++R+YL++E A +GELY+++QK   +  +R AT M +L+ AL YCH++ V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +   +D+WC+GVL YE++  + PFE PS  +T  RI  V+   P  V   A D+I K+L  NP  RL L ++  HP++   S +V
Sbjct:   75 QPFTIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKLLKHNPWQRLPLAEVAAHPWVRANSRRV 339          
BLAST of aurora kinase-1 vs. Ensembl Mouse
Match: Aurkb (aurora kinase B [Source:MGI Symbol;Acc:MGI:107168])

HSP 1 Score: 288.115 bits (736), Expect = 2.483e-95
Identity = 129/265 (48.68%), Postives = 190/265 (71.70%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            Q + IDNF IG+ +G G+FG+VYL +EK++ F++A+K++ K+ I++  + +QL+REIEI +HL HPNIL+LY YF+D++R+YL++E A +GELY+++QK   +  +R AT M +L+ AL YCH++ V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +   +D+WC+GVL YE++  + PFE PS  +T  RI  V+   P  V   A D+I K+L  NP  RL L ++  HP++   S +V
Sbjct:   75 QPFTIDNFEIGRPLGKGKFGNVYLAREKKSRFIVALKILFKSQIEKEGVEHQLRREIEIQAHLKHPNILQLYNYFYDQQRIYLILEYAPRGELYKELQKSRTFDEQRTATIMEELSDALTYCHKKKVIHRDIKPENLLLGLQGELKIADFGWSVHAPSLRRKTMCGTLDYLPPEMIEGRMHNEMVDLWCIGVLCYELMVGNPPFESPSHSETYRRIVKVDLKFPSSVPSGAQDLISKLLKHNPWQRLPLAEVAAHPWVRANSRRV 339          
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Match: sp|Q6GPL3|AUKBB_XENLA (Aurora kinase B-B OS=Xenopus laevis OX=8355 GN=aurkb-b PE=2 SV=1)

HSP 1 Score: 308.916 bits (790), Expect = 3.276e-102
Identity = 134/265 (50.57%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL +EK+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL YE L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   93 RKFTIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHSETHRRIVNVDLKFPPFLSEGSKDLISKLLRYHPAQRLPLKGVMEHPWVKANSRRV 357          
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Match: sp|Q6DE08|AUKBA_XENLA (Aurora kinase B-A OS=Xenopus laevis OX=8355 GN=aurkb-a PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 7.038e-102
Identity = 134/265 (50.57%), Postives = 198/265 (74.72%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL +EK+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL YE L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   86 RKFTIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 350          
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Match: sp|A4IGM9|AURKB_XENTR (Aurora kinase B OS=Xenopus tropicalis OX=8364 GN=aurkb PE=2 SV=1)

HSP 1 Score: 306.22 bits (783), Expect = 2.277e-101
Identity = 132/265 (49.81%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL ++K+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL +E L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   86 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 350          
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Match: sp|P97477|AURKA_MOUSE (Aurora kinase A OS=Mus musculus OX=10090 GN=Aurka PE=1 SV=1)

HSP 1 Score: 299.286 bits (765), Expect = 3.808e-98
Identity = 133/267 (49.81%), Postives = 191/267 (71.54%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            T+ + W +++F IG+ +G G+FG+VYL +E+++ F+LA+K++ K  +++ ++ +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T  RI  VEF  PDFV   A D+I ++L  N   RL+L ++++HP+I   S K
Sbjct:  114 TKKRQWTLEDFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKTQLEKANVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSNGELKIADFGWSVHAPSSRRTTMCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGMPPFEAHTYQETYRRISRVEFTFPDFVTEGARDLISRLLKHNASQRLTLAEVLEHPWIKANSSK 380          
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Match: sp|O14965|AURKA_HUMAN (Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA PE=1 SV=2)

HSP 1 Score: 299.671 bits (766), Expect = 4.234e-98
Identity = 134/270 (49.63%), Postives = 192/270 (71.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQ 909
            + W +++F IG+ +G G+FG+VYL +EK++ F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A  G +Y ++QK  ++  +R ATY+ +LA AL YCH + V+HRDIKPEN+L+GS G+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W LGVL YE L    PFE  + Q+T +RI  VEF  PDFV   A D+I ++L  NP  R  L ++++HP+I   S K + +CQ
Sbjct:  126 RQWALEDFEIGRPLGKGKFGNVYLAREKQSKFILALKVLFKAQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDATRVYLILEYAPLGTVYRELQKLSKFDEQRTATYITELANALSYCHSKRVIHRDIKPENLLLGSAGELKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGRMHDEKVDLWSLGVLCYEFLVGKPPFEANTYQETYKRISRVEFTFPDFVTEGARDLISRLLKHNPSQRPMLREVLEHPWITANSSKPS-NCQ 394          
BLAST of aurora kinase-1 vs. TrEMBL
Match: I1ZIC8 (Aurora kinase-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:   88 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH 966
            MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH
Sbjct:    1 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH 293          
BLAST of aurora kinase-1 vs. TrEMBL
Match: A0A0P7V4G2 (Protein kinase domain-containing protein OS=Scleropages formosus OX=113540 GN=Z043_113663 PE=3 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 8.612e-100
Identity = 136/271 (50.18%), Postives = 194/271 (71.59%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQA 912
            + W +DNF IG+ +G G+FG+VYL +E++  F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G + ++R ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL+YE L    PFE    ++T  RI  VEF+ P  V+P   D+I K+L  NP  RL +  ++ HP++ E S K    CQA
Sbjct:   50 KRWTLDNFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYSELQRCGHFDDQRTATYITELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLIYEFLAGKPPFESKGHEETYRRISKVEFSYPTRVSPGGRDLIGKLLKHNPLQRLPILDVLSHPWVVEHSIKTPQRCQA 320          
BLAST of aurora kinase-1 vs. TrEMBL
Match: A0A1L8H3C5 (Protein kinase domain-containing protein OS=Xenopus laevis OX=8355 GN=aurkb PE=1 SV=1)

HSP 1 Score: 307.76 bits (787), Expect = 2.086e-99
Identity = 134/265 (50.57%), Postives = 198/265 (74.72%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL +EK+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL YE L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   86 RKFTIDDFDIGRPLGKGKFGNVYLAREKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALHYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCYEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 350          
BLAST of aurora kinase-1 vs. TrEMBL
Match: A0A0P7UMX5 (Aurora kinase A-B-like (Fragment) OS=Scleropages formosus OX=113540 GN=Z043_118414 PE=3 SV=1)

HSP 1 Score: 306.99 bits (785), Expect = 5.975e-99
Identity = 135/264 (51.14%), Postives = 193/264 (73.11%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            + W +DNF IG+ +G G+FG+VYL +E+++ F+LA+K++ K  ++   + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G +  +R+ATYM +LA AL+YCH + V+HRDIKPENIL+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE LT   PFE  S ++T  +I  V+F  PD ++  + D+I K+L  NP  RL L  ++ HP++ E S K
Sbjct:  103 KRWSLDNFDIGRPLGKGKFGNVYLARERQSKFILALKVLFKKQLESAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSSRVYLILEFAPKGELYSELQRCGHFDEQRSATYMKELADALQYCHSKKVIHRDIKPENILLGANGEIKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLTGKPPFETQSHEETYRKISRVDFRYPDHMSSGSRDLINKLLKHNPLHRLPLHAVLAHPWVVEHSTK 366          
BLAST of aurora kinase-1 vs. TrEMBL
Match: A0A5G3KNV3 (Aurora kinase B OS=Xenopus tropicalis OX=8364 GN=aurkb PE=3 SV=1)

HSP 1 Score: 306.605 bits (784), Expect = 7.157e-99
Identity = 132/265 (49.81%), Postives = 199/265 (75.09%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + + ID+F IG+ +G G+FG+VYL ++K+N F++A+K++ K+ +++  + +QL+REIEI SHL HPNILR+Y YFHD++R+YLM+E A +GELY+++QK+GR+  +R+AT+M +LA AL+YCHER V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  ++  ++D+WC GVL +E L    PF+ PS  +T  RI +V+   P F++  + D+I K+L  +P  RL L  +++HP++   S +V
Sbjct:   96 RKFTIDDFDIGRPLGKGKFGNVYLARDKQNKFIMALKVLFKSQLEKEGVEHQLRREIEIQSHLRHPNILRMYNYFHDRKRIYLMLEFAPRGELYKELQKHGRFDEQRSATFMEELADALQYCHERKVIHRDIKPENLLMGYKGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGKTHDEKVDLWCAGVLCFEFLVGMPPFDSPSHTETHRRIVNVDLKFPPFLSDGSKDLISKLLRYHPPQRLPLKGVMEHPWVKANSRRV 360          
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 290.426 bits (742), Expect = 8.836e-97
Identity = 131/275 (47.64%), Postives = 195/275 (70.91%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDD-CQA 912
            T P+ + I +F+IG+ +G G+FG+VYL +EK+   V+A+K++ K+ +++  + +QL+REIEIHS L HPNILR Y YF+D  RV+L++E A +GE+Y+++Q+ GR+ ++R AT+M +++ AL+YCHE  V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  S+  ++D+WC+GVL YE L  + PFE  S  +T +RI  V+   P  V+  A D+I K+L  +P  RL L  +I HP++   S +V    CQ 
Sbjct:   25 TSPKTFTIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVLPPVCQP 299          
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:103024192])

HSP 1 Score: 290.426 bits (742), Expect = 1.185e-96
Identity = 131/275 (47.64%), Postives = 195/275 (70.91%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDD-CQA 912
            T P+ + I +F+IG+ +G G+FG+VYL +EK+   V+A+K++ K+ +++  + +QL+REIEIHS L HPNILR Y YF+D  RV+L++E A +GE+Y+++Q+ GR+ ++R AT+M +++ AL+YCHE  V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  S+  ++D+WC+GVL YE L  + PFE  S  +T +RI  V+   P  V+  A D+I K+L  +P  RL L  +I HP++   S +V    CQ 
Sbjct:   38 TSPKTFTIKDFHIGRPLGKGKFGNVYLAREKKLKVVVALKVLFKSQMEKEGVEHQLRREIEIHSRLRHPNILRFYNYFYDSSRVFLILEYAPRGEMYKELQRCGRFSDQRTATFMEEISDALQYCHENKVIHRDIKPENLLLGFRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHSHDEKVDLWCIGVLCYECLVGNPPFETASHSETYKRITKVDLHFPKVVSDGARDLISKLLRHSPTMRLPLKSVIDHPWVKTNSRRVLPPVCQP 312          
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 289.271 bits (739), Expect = 2.520e-95
Identity = 132/274 (48.18%), Postives = 191/274 (69.71%), Query Frame = 1
Query:   85 AMTEPQN-----WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            A  EP       W ++NF IG+ +G G+FGSVYL +E++  F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G + ++R+ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  S ++T  +I  VEF  P  V+  + ++I  +L  NP  RL +  ++ H ++ E S K
Sbjct:   91 AAAEPSKPDKMPWSLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWVVEHSTK 364          
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Match: aurka (aurora kinase C-like [Source:NCBI gene;Acc:103034578])

HSP 1 Score: 290.041 bits (741), Expect = 3.819e-95
Identity = 129/262 (49.24%), Postives = 188/262 (71.76%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            W ++NF IG+ +G G+FGSVYL +E++  F+LA+K++ K  +++  + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G + ++R+ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  S ++T  +I  VEF  P  V+  + ++I  +L  NP  RL +  ++ H ++ E S K
Sbjct:  149 WSLENFDIGRALGKGKFGSVYLARERQTKFILALKVLFKKQLEKAGVEHQLRREVEIQSHLRHPNILRLYGYFHDSARVYLILEFAPKGELYGELQRCGMFDDQRSATYIMELADALHYCHSKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGRPPFETKSHEETYRKISRVEFTYPAHVSEGSRNLINGLLKHNPMHRLPIQGVLTHYWVVEHSTK 410          
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Match: mark3a (microtubule affinity regulating kinase 3 [Source:NCBI gene;Acc:103040919])

HSP 1 Score: 172.94 bits (437), Expect = 6.449e-48
Identity = 88/269 (32.71%), Postives = 165/269 (61.34%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
            +E Q+  + N+ + K IG G F  V L +       +AIK+I K  +    L  +L RE+ I   L HPNI++L+     ++ ++L++E A+ GE+++ +  +GR   + A     Q+  A++YCH++H++HRD+K EN+L+ +    K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  +++K+ LV+NP  R +L+QI++  +I+  SE+
Sbjct:   47 SEEQHPHVGNYRLLKTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPTSLQ-KLFREVRIMKILNHPNIVKLFEVIETEKTLFLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTVGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPGKRGTLEQIMRDRWINAGSEE 314          
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Match: aurka (aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-161])

HSP 1 Score: 278.1 bits (710), Expect = 8.459e-93
Identity = 130/266 (48.87%), Postives = 190/266 (71.43%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVT 897
            + W +DNF IG+ +G G+FG+VYL +EK   F+LA+K++ K+ ++++ + +QL+REIEI SHL HPNILRLYGYFHD+ RVYL++E A +GELY+ +QK G++  ER+A+Y+  +A AL YCH + V+HRDIKPEN+L+G KG+ K+ADFGWSVH  +  R T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  +  +T  RI  V+   P  ++  A D+I  +L  NP  RL L  ++QHP++   ++++ 
Sbjct:    8 KQWSLDNFDIGRPLGKGKFGNVYLAREKSTKFILALKVLFKSQLEKSGVEHQLRREIEIQSHLRHPNILRLYGYFHDRTRVYLILEYAPRGELYKLLQKLGKFDEERSASYVADMADALIYCHSKKVIHRDIKPENLLLGLKGELKIADFGWSVHAPSSRRATLCGTLDYLPPEMIEGRTHDEKVDLWSLGVLCYEFLVGRPPFESETHNETYRRISKVDLRFPSHLSDGAKDLIANLLKHNPHTRLQLASVLQHPWVKANAKRIV 273          
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 167.548 bits (423), Expect = 2.120e-48
Identity = 84/261 (32.18%), Postives = 160/261 (61.30%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            Q   + N+ + K IG G F  V L K       +A+K+I K  +  + L  +L RE+ I   L HPNI++L+     ++ +YL++E ++ GE+++ +  +GR   + A     Q+  A++YCH++H++HRD+K EN+L+ +    K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  +++K+ LV++P  R SL+QI++  +++
Sbjct:   61 QTQRVGNYRLLKTIGKGNFAKVKLAKHTLTGQEVAVKIIDKTQLNTSSLQ-KLFREVRIMKVLNHPNIVKLFEVIEMEKTLYLVMEYSSGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLHPLKRGSLEQIMKDRWMN 320          
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Match: MARK3 (microtubule affinity regulating kinase 3 [Source:HGNC Symbol;Acc:HGNC:6897])

HSP 1 Score: 168.703 bits (426), Expect = 6.207e-47
Identity = 84/257 (32.68%), Postives = 158/257 (61.48%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            I  + + K IG G F  V L +       +A+K+I K  +  + L  +L RE+ I   L HPNI++L+     ++ +YL++E A+ GE+++ +  +GR   + A     Q+  A++YCH++H++HRD+K EN+L+ +    K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  +++K+ LV+NP  R SL+QI++  +++
Sbjct:   51 IGTYRLLKTIGKGNFAKVKLARHTLTGREVAVKIIDKTQLNPSSLQ-KLFREVRIMKILNHPNIVKLFEVIETEKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHIVHRDLKAENLLLDADMNIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKRFLVLNPAKRGSLEQIMKDRWMN 306          
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Match: snrka (SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040718-84])

HSP 1 Score: 162.155 bits (409), Expect = 3.569e-45
Identity = 87/251 (34.66%), Postives = 146/251 (58.17%), Query Frame = 1
Query:  133 KKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKY-GRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSK-GQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSY-TFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            K +G G F  V L +       +A+K+I K+ +      +  ++E+     + HPN++RLY     + ++YL++ELA  G+LY+ I ++ G    E A TY  Q+  A+ YCH  HV+HRD+KPEN++   K G  KL DFG+S  ++ G +  T CG+L Y APE++  D Y    +DIW LGV+LY ++    PF++ ++ +T+  I   ++ VP  ++    D+I ++L  +P+ R SL ++  HP++
Sbjct:   20 KTLGRGHFAVVKLARHVFTGEKVAVKVIDKSKLDPMATSHLFQQEVRCMKLVQHPNVVRLYEVIDTQTKLYLILELADGGDLYDYIMRHEGGLQEELAKTYFAQVVHAISYCHRLHVVHRDLKPENVVFFEKQGLVKLTDFGFSNLFQPGTKLATSCGSLAYSAPEILLGDEYDAPAVDIWSLGVILYMLVCGHPPFQEANDSETLTMIMDCKYTVPAHISRECKDLIARMLQRDPRRRASLQEMEGHPWL 270          
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002824.1 (pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215:-1 gene:ENSPMAG00000002574.1 transcript:ENSPMAT00000002824.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 153.68 bits (387), Expect = 1.706e-44
Identity = 82/270 (30.37%), Postives = 142/270 (52.59%), Query Frame = 1
Query:  118 NFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINE--RAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTG--VRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQAS 915
            +F +   +G G F  VY  +       +AIKMI K  ++   + ++++ E+EIHS L HP IL +YG F D   VYL++E+   GE+   ++  GR   E   A  ++ +++  L Y H   V+HRD+   N+L+ S    ++ADFG +         R T+CGT +Y++PE+  +  +    D W LG   Y ML    PF+  +   T+ R+ +  F +P  ++P A D+++++L  +P  R  L  +++HP++ +   + T    A 
Sbjct:   12 DFQVMNLLGKGSFACVYRARSCHTGIEVAIKMIDKQAMRRAGMVDRVRAEVEIHSQLKHPAILEMYGCFEDDNYVYLVLEMCHNGEMSRYLKNQGRPFTEEQEARQFLREISSGLLYLHAHGVIHRDLTLANLLLASDMSTRIADFGLAARLPLPGESRLTVCGTPNYMSPEVASRGPHGTPADAWALGCAAYAMLVGRPPFQASAVPATLARVLA-RFELPPTLSPAARDLLRRLLRRDPGKRPGLPAVLEHPFLADGGGETTAGLMAG 280          
BLAST of aurora kinase-1 vs. Ensembl Yeast
Match: IPL1 (Aurora kinase of chromosomal passenger complex; mediates release of mono-oriented kinetochores from microtubules in meiosis I, and kinetochore release from SPB clusters at meiotic exit; helps maintain condensed chromosomes during anaphase; required for SPB cohesion and prevention of multipolar spindle formation; promotes telomerase release at G2/M; Iocalizes to nuclear foci that diffuse upon DNA replication stress; required for inhibition of karyopherin Pse1p upon SAC arrest [Source:SGD;Acc:S000006130])

HSP 1 Score: 216.083 bits (549), Expect = 7.646e-68
Identity = 111/256 (43.36%), Postives = 174/256 (67.97%), Query Frame = 1
Query:  109 CIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWS-VHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
             +D+F +GKK+G G+FG VY V+ +   ++ A+K++ K  I + +L  Q +RE+EI + L HPN+ + YGYFHD++RVYL++E    GE+Y+ ++ +G + +  A+ Y++Q+A AL Y H+++++HRDIKPENILIG     KL DFGWS ++     R T+CGT+DYL+PEMVE   Y   ID W LGVL +E+LT + PFE+  +  T +RI +++  +P  ++ +A D+I K+L  +PK R+ L  +  HP+I
Sbjct:  100 SLDDFELGKKLGKGKFGKVYCVRHRSTGYICALKVMEKEEIIKYNLQKQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRLHGPFNDILASDYIYQIANALDYMHKKNIIHRDIKPENILIGFNNVIKLTDFGWSIINPPENRRKTVCGTIDYLSPEMVESREYDHTIDAWALGVLAFELLTGAPPFEEEMKDTTYKRIAALDIKMPSNISQDAQDLILKLLKYDPKDRMRLGDVKMHPWI 355          
BLAST of aurora kinase-1 vs. Ensembl Yeast
Match: TPK3 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk2p; localizes to P-bodies during stationary phase; TPK3 has a paralog, TPK1, that arose from the whole genome duplication [Source:SGD;Acc:S000001649])

HSP 1 Score: 180.259 bits (456), Expect = 9.814e-54
Identity = 93/266 (34.96%), Postives = 155/266 (58.27%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYI---KENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARL-----SLDQIIQHPYIDE 879
            + + +F I + +G+G FG V+L++   N    A+K ++K+ I   K+ +  N  +R + I SH   P I+R++G F D ++V+++++    GEL+  ++K  R+ N  A  Y  ++ LAL+Y H + +++RD+KPENIL+   G  K+ DFG++  Y   V  T+CGT DY+APE+V    Y   +D W  GVL+YEML    PF + +  KT E I + E   P F +P+A D++KK++  +   RL       + +  HP+ +E
Sbjct:   83 YSLSDFQILRTLGTGSFGRVHLIRSNHNGRFYALKTLKKHTIVKLKQVEHTNDERRMLSIVSH---PFIIRMWGTFQDSQQVFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFA-KYVPDVTYTLCGTPDYIAPEVVSTKPYNKSVDWWSFGVLIYEMLAGYTPFYNSNTMKTYENILNAELKFPPFFHPDAQDLLKKLITRDLSERLGNLQNGSEDVKNHPWFNE 344          
BLAST of aurora kinase-1 vs. Ensembl Yeast
Match: TPK1 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; inhibited by regulatory subunit Bcy1p in the absence of cAMP; phosphorylates and inhibits Whi3p to promote G1/S phase passage; partially redundant with Tpk2p and Tpk3p; phosphorylates pre-Tom40p, which impairs its import into mitochondria under non-respiratory conditions; TPK1 has a paralog, TPK3, that arose from the whole genome duplication [Source:SGD;Acc:S000003700])

HSP 1 Score: 173.326 bits (438), Expect = 4.037e-51
Identity = 86/263 (32.70%), Postives = 148/263 (56.27%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARL-----SLDQIIQHPYIDE 879
            + + +F I + +G+G FG V+L++ + N    A+K+++K  +           E  + S + HP I+R++G F D ++++++++    GEL+  ++K  R+ N  A  Y  ++ LAL+Y H + +++RD+KPENIL+   G  K+ DFG++  Y   V  T+CGT DY+APE+V    Y   ID W  G+L+YEML    PF D +  KT E+I + E   P F N +  D++ +++  +   RL       + +  HP+  E
Sbjct:   82 YSLQDFQILRTLGTGSFGRVHLIRSRHNGRYYAMKVLKKEIVVRLKQVEHTNDERLMLSIVTHPFIIRMWGTFQDAQQIFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALEYLHSKDIIYRDLKPENILLDKNGHIKITDFGFA-KYVPDVTYTLCGTPDYIAPEVVSTKPYNKSIDWWSFGILIYEMLAGYTPFYDSNTMKTYEKILNAELRFPPFFNEDVKDLLSRLITRDLSQRLGNLQNGTEDVKNHPWFKE 343          
BLAST of aurora kinase-1 vs. Ensembl Yeast
Match: TPK2 (cAMP-dependent protein kinase catalytic subunit; promotes vegetative growth in response to nutrients via the Ras-cAMP signaling pathway; partially redundant with Tpk1p and Tpk3p; localizes to P-bodies during stationary phase; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000006124])

HSP 1 Score: 168.703 bits (426), Expect = 1.523e-49
Identity = 88/266 (33.08%), Postives = 153/266 (57.52%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYI---KENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQ-----IIQHPYIDE 879
            + + +F I + +G+G FG V+LV+   N    AIK+++K  +   K+ +  N  +R +++   + HP ++R++G F D   ++++++    GEL+  ++K  R+ N  A  Y  ++ LAL+Y H  ++++RD+KPENIL+   G  K+ DFG++   +T V  T+CGT DY+APE++    Y   +D W LGVL+YEML    PF D +  KT E+I   +   P + +P+  D++ K++  +   R+   Q     I  HP+  E
Sbjct:   65 YTLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTNDERRMLKL---VEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFAKEVQT-VTWTLCGTPDYIAPEVITTKPYNKSVDWWSLGVLIYEMLAGYTPFYDTTPMKTYEKILQGKVVYPPYFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWFSE 326          
BLAST of aurora kinase-1 vs. Ensembl Yeast
Match: SNF1 (AMP-activated S/T protein kinase; forms a complex with Snf4p and members of the Sip1p/Sip2p/Gal83p family; required for transcription of glucose-repressed genes, thermotolerance, sporulation, and peroxisome biogenesis; regulates nucleocytoplasmic shuttling of Hxk2p; regulates filamentous growth and acts as a non-canonical GEF, activating Arf3p during invasive growth; SUMOylation by Mms21p inhibits its function and targets Snf1p for destruction via the Slx5-Slx8 Ub ligase [Source:SGD;Acc:S000002885])

HSP 1 Score: 166.007 bits (419), Expect = 1.132e-46
Identity = 87/252 (34.52%), Postives = 147/252 (58.33%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTG-VRNTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQ 861
            I N+ I K +G G FG V L         +A+K+I K  + ++D+  +++REI     L HP+I++LY     K+ + +++E A   EL++ I +  +   + A  +  Q+  A++YCH   ++HRD+KPEN+L+      K+ADFG S     G    T CG+ +Y APE++    Y   E+D+W  GV+LY ML + +PF+D S     + I +  + +P F++P AA +IK++L++NP  R+S+ +I+Q
Sbjct:   52 IGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAG-NELFDYIVQRDKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDESIPVLFKNISNGVYTLPKFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302          
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Match: EDO35437 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLH0])

HSP 1 Score: 277.33 bits (708), Expect = 5.521e-92
Identity = 127/271 (46.86%), Postives = 186/271 (68.63%), Query Frame = 1
Query:  106 WCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASR 918
            W + +F IGK +G G+FG+VYL +EK++ +++A+K++ K+ ++++++ +QL+REIEI SHL H NILRL+GYF+D  RVYL++E A +GELY+++    ++  +RAA Y+ QLA AL YCH + V+HRDIKPEN+L+  KG  K+ADFGWSVH  +  R T+CGTLDYL PEM+E   +  ++D+W +GVL YE L    PFE     +T  RI  V+   P  V+P A D+I K+L  NP  RL L  ++ HP+I   +  V +   AS+
Sbjct:   43 WNLSDFDIGKPLGKGKFGNVYLAREKKSKYIVALKVLFKSQLQKSNVEHQLRREIEIQSHLRHNNILRLFGYFYDDTRVYLILEYAPRGELYKELTACEKFDEKRAAKYIRQLADALAYCHSKKVIHRDIKPENLLLNYKGDIKIADFGWSVHAPSSRRTTLCGTLDYLPPEMIEGKEHDEKVDLWSIGVLCYEFLVGKPPFEAEGHNETYRRISRVDLRFPSHVSPGARDLISKLLQHNPNNRLPLKAVLNHPWIRMHATPVLEQKPASQ 313          
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Match: EDO36587 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI81])

HSP 1 Score: 164.466 bits (415), Expect = 6.778e-48
Identity = 86/255 (33.73%), Postives = 149/255 (58.43%), Query Frame = 1
Query:  127 IGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYM-HQLALALKYCHERHVMHRDIKPEN-ILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSY-TFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDE 879
            +G+ +G G F  V + +       +A+K+I K  + E    + LK E+     + HPN++RLY       ++YL++EL   G++Y+ I  + + + E  A Y   Q+ LA+ YCH+ HV+HRD+KPEN I   ++   KL DFG+S ++    + +T CG+L Y APE++  D+Y    +D+W LGV+LY ++    PF + ++ +T+ +I    + VPD V+P   ++I ++L+  P  R SL +I+ HP++ +
Sbjct:   21 LGETLGRGHFAVVKVARHVITGERVAVKVIDKTKLDEVSREHLLK-EVRCMKLVQHPNVVRLYQVIDTNTKLYLILELGDGGDMYDYIMNHDKGLPEEKARYFFRQIVLAIDYCHKLHVVHRDLKPENVIFFKNQDMAKLTDFGFSNNFIPNEKLDTACGSLAYSAPEVLLGDAYEAPAVDVWSLGVILYMLVCGQAPFSEANDSETLTKIMDCRYDVPDHVSPLCKNLISRMLIREPHNRASLGEIMSHPWLQQ 274          
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Match: EDO30768 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZV3])

HSP 1 Score: 170.629 bits (431), Expect = 6.909e-48
Identity = 87/257 (33.85%), Postives = 155/257 (60.31%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYID 876
            I  + + K IG G F  V L K       +AIK+I K  +  + L  +L RE+ I   L HPNI++LY      + +YL++E A+ GE+++ +  +GR   + A     Q+  A++YCH++HV+HRD+K EN+L+ +    K+ADFG+S  +  G + +T CG+  Y APE+ +   Y   E+D+W LGV+LY +++ S+PF+  + ++  ER+   ++ +P +++ +  +++KK LV+NP+ R  L+Q +   +++
Sbjct:   35 IGRYRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQ-KLFREVRIMKFLDHPNIVKLYEVIETDKTLYLVMEYASGGEVFDYLVAHGRMKEKEARAKFRQIVSAVQYCHQKHVIHRDLKAENLLLDADMNIKIADFGFSNEFTPGNKLDTFCGSPPYAAPELFQGKKYDGPEVDVWSLGVILYTLVSGSLPFDGQNLKELRERVLRGKYRIPFYMSTDCENLLKKFLVLNPQKRARLEQTMTDKWMN 290          
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Match: EDO46035 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR22])

HSP 1 Score: 162.925 bits (411), Expect = 2.601e-47
Identity = 87/261 (33.33%), Postives = 153/261 (58.62%), Query Frame = 1
Query:  118 NFY-IGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVR-NTMCGTLDYLAPEMVEQDSYTF-EIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK 891
             FY I K IG G F  V L         +A+K+I K+ + +++L  ++KRE+++   L HP+I++L+     +  +YL+ E A+KGE+++ +  +GR   + A    +Q+  A++YCH+ +++HRD+K EN+L+      K+ADFG+S  ++   +  T CG+  Y APE+ E   Y   E+DIW LGV+LY ++  ++PF+  + Q    R+    F +P F++     +I+ +LV +P  R ++ QI QH ++ E + K
Sbjct:   18 GFYNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDKSQLDDDNL-TKVKREVKVMKKLAHPHIIKLHEVMETERMLYLVTEYASKGEIFDYLVAHGRMQEKEAKNTFNQIVSAIEYCHKMNIVHRDLKAENLLLDEDMNIKIADFGFSNIFQADKKLKTWCGSPPYAAPELFEGKEYLGPEVDIWSLGVVLYVLVCGALPFDGSTLQSLRSRVLDGRFRIPFFMSTECEHLIRHMLVRDPVKRFTIPQIRQHKWMAEVTGK 277          
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Match: EDO34707 (Serine/threonine-protein kinase PLK4 [Source:UniProtKB/Swiss-Prot;Acc:A7SNN5])

HSP 1 Score: 168.703 bits (426), Expect = 1.818e-46
Identity = 92/264 (34.85%), Postives = 145/264 (54.92%), Query Frame = 1
Query:  109 CIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATY-MHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSV--------HYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
             I++F +   +G G F  VY  +       +AIKMI K  ++   + N++  E+EIH  L HP+IL LY YF D   VYL++ELA  GE    ++K G  + E      M Q+   + Y H   ++HRD+   NIL+ S    K+ADFG +         HY      TMCGT +Y++PE+  +D +  E D+W +G +L+ +L    PF+  + + T+ ++   E+ +P+ V+  A D+I K+L  NP+ RL+L  I+ HP+I
Sbjct:    9 SIEDFQVLDLLGKGGFACVYRGRCLATGQEVAIKMIDKKAMRTAGMVNRVCNEVEIHCRLKHPSILELYTYFEDDNYVYLVLELAENGEANRYLRKQGHTLKESEVRRIMLQVVKGVLYLHSHGIIHRDLSLGNILLSSDMDAKIADFGLATRLSLPDEKHY------TMCGTPNYISPEIATRDPHGLESDVWSIGCMLFTLLVGKPPFDTEAVRSTLNKVVLAEYDIPNHVSIEARDLISKLLKKNPQDRLTLSGILDHPFI 266          
BLAST of aurora kinase-1 vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 284.648 bits (727), Expect = 1.620e-94
Identity = 126/270 (46.67%), Postives = 196/270 (72.59%), Query Frame = 1
Query:   85 AMTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            +++ P+   ID+F IG+ +G G+FG+VYL + K+   ++A+K++ K+ +++  + +QL+REIEI +HL HPNILR Y YFHD++RV+L++E A +GE+Y+++QKY R+ ++R ATYM +++ AL YCHE+ V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  +++ ++D+WC+GVL +E L  + PFE  S   T +RI  V+   P  V+  A D+I K+L  NP  RL L +++ HP++   S ++
Sbjct:   33 SVSPPKKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRL 302          
BLAST of aurora kinase-1 vs. Ensembl Medaka
Match: aurkb (aurora kinase B [Source:NCBI gene;Acc:100301584])

HSP 1 Score: 285.034 bits (728), Expect = 2.564e-94
Identity = 126/270 (46.67%), Postives = 196/270 (72.59%), Query Frame = 1
Query:   85 AMTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            +++ P+   ID+F IG+ +G G+FG+VYL + K+   ++A+K++ K+ +++  + +QL+REIEI +HL HPNILR Y YFHD++RV+L++E A +GE+Y+++QKY R+ ++R ATYM +++ AL YCHE+ V+HRDIKPEN+L+G +G+ K+ADFGWSVH  +  R TMCGTLDYL PEM+E  +++ ++D+WC+GVL +E L  + PFE  S   T +RI  V+   P  V+  A D+I K+L  NP  RL L +++ HP++   S ++
Sbjct:   53 SVSPPKKISIDDFDIGRPLGKGKFGNVYLARVKKLQAIVALKVLFKSQMEKEGVEHQLRREIEIQAHLKHPNILRFYNYFHDRKRVFLVLEYAPRGEMYKELQKYQRFDDQRTATYMEEISDALLYCHEKKVIHRDIKPENLLLGYRGELKIADFGWSVHAPSLRRRTMCGTLDYLPPEMIEGHTHSEKVDLWCIGVLCFECLVGNPPFETASHTDTYKRIMKVDLNFPKVVSDGARDLISKLLRHNPNDRLPLQKVMDHPWVRTNSHRL 322          
BLAST of aurora kinase-1 vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 286.189 bits (731), Expect = 5.020e-94
Identity = 130/280 (46.43%), Postives = 195/280 (69.64%), Query Frame = 1
Query:   91 TEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDF--VNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK----VTDDCQA 912
            T  + W +++F IG+ +G G+FG+VYL +E++  F+LA+K++ K  ++   + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G +  +R+ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  +  +T  RI  VE+  P    ++  A D++ K+L  NP  RL +  ++ HP++ + S +    +TD+ Q+
Sbjct:  112 TSKKRWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHSTRKPTPLTDEEQS 391          
BLAST of aurora kinase-1 vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 286.574 bits (732), Expect = 1.083e-93
Identity = 130/282 (46.10%), Postives = 195/282 (69.15%), Query Frame = 1
Query:   85 AMTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDF--VNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK----VTDDCQA 912
              T  + W +++F IG+ +G G+FG+VYL +E++  F+LA+K++ K  ++   + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G +  +R+ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  +  +T  RI  VE+  P    ++  A D++ K+L  NP  RL +  ++ HP++ + S +    +TD+ Q+
Sbjct:  146 GSTSKKRWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHSTRKPTPLTDEEQS 427          
BLAST of aurora kinase-1 vs. Ensembl Medaka
Match: aurka (aurora kinase A [Source:NCBI gene;Acc:101165631])

HSP 1 Score: 285.034 bits (728), Expect = 6.038e-93
Identity = 129/277 (46.57%), Postives = 194/277 (70.04%), Query Frame = 1
Query:  100 QNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDF--VNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEK----VTDDCQA 912
            + W +++F IG+ +G G+FG+VYL +E++  F+LA+K++ K  ++   + +QL+RE+EI SHL HPNILRLYGYFHD  RVYL++E A KGELY ++Q+ G +  +R+ATY+ +LA AL YCH + V+HRDIKPEN+L+G+ G+ K+ADFGWSVH  +  R+T+CGTLDYL PEM+E  ++  ++D+W LGVL YE L    PFE  +  +T  RI  VE+  P    ++  A D++ K+L  NP  RL +  ++ HP++ + S +    +TD+ Q+
Sbjct:  162 KRWSLEDFDIGRPLGKGKFGNVYLARERQTKFILALKVLFKKQLERAGVEHQLRREVEIQSHLRHPNILRLYGYFHDASRVYLILEFAPKGELYGELQRCGSFPEDRSATYIMELADALHYCHTKKVIHRDIKPENLLLGANGELKIADFGWSVHTPSSRRSTLCGTLDYLPPEMIEGKTHDEKVDLWSLGVLCYEFLVGKPPFEAKTNDETYRRISRVEYTYPAHAAISDGAKDLVAKLLKHNPMHRLPIQGVLCHPWLLQHSTRKPTPLTDEEQS 438          
BLAST of aurora kinase-1 vs. Planmine SMEST
Match: SMESG000006604.1 (SMESG000006604.1)

HSP 1 Score: 615.92 bits (1587), Expect = 0.000e+0
Identity = 293/293 (100.00%), Postives = 293/293 (100.00%), Query Frame = 1
Query:   88 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH 966
            MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH
Sbjct:    1 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH 293          
BLAST of aurora kinase-1 vs. Planmine SMEST
Match: SMESG000036830.1 (SMESG000036830.1)

HSP 1 Score: 271.552 bits (693), Expect = 5.891e-90
Identity = 131/282 (46.45%), Postives = 182/282 (64.54%), Query Frame = 1
Query:   88 MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMV-EQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWA 930
            M +P N  I  F IG  +G G+FG V++VKEK  NF   +KMI K+ I EN+L  QLKREI+I  +L HPNILRL  +FHD +R+Y+++E A  G++  DI KYG Y N RAATY+ QL  ++ YCH + VMHRDIK  NILI S GQ KLADFGWSVH          G++ Y APE+V  +    +E DIW +GV+LYEMLT ++PF   +     +R    +F +P  ++P A  +++ IL +NP+ R++L+ I+ H ++  FSE    +C+AS +MW 
Sbjct:    1 MNKPLN--ISMFDIGTMLGDGRFGKVFIVKEKETNFKFGLKMINKSDINENNLFRQLKREIQIQKNLCHPNILRLLNHFHDHKRIYILLEFAHNGDVSNDISKYGPYSNARAATYLQQLVDSVSYCHSKFVMHRDIKSANILICSNGQIKLADFGWSVHKNNSRNLNYVGSIFYRAPEVVLRKFPLGYETDIWSIGVVLYEMLTGTLPFYHENSLTVDKRTVEGDFRIPGNISPKAIVLLRGILAVNPQQRMTLNSILNHEFVKSFSENTLQECKASEIMWT 280          
BLAST of aurora kinase-1 vs. Planmine SMEST
Match: SMESG000004605.1 (SMESG000004605.1)

HSP 1 Score: 234.572 bits (597), Expect = 5.225e-75
Identity = 117/261 (44.83%), Postives = 168/261 (64.37%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKV 894
            + +F +G  +G+G+FG VYL K  +  FV A+K++ K+ +  ++L +Q  REI+I  HL HPNIL+LY +FHD++ VYL++E A  G+++  +QK  R+ +  AATY+HQL  AL YCH++ V+HRDIKPEN+LI    + KLADFGWS+H     R TMCGTLDYL PE+V    Y  +ID W  G+LLYEML    PFE  ++Q+T   I+         +   A D+I +IL +    RLS  +I  HP++ ++  KV
Sbjct:   48 LKDFDVGMPLGTGKFGHVYLAKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKRKTMCGTLDYLPPEIVNYKEYDEKIDHWMTGILLYEMLHGCPPFERANKQETYAAIRGNTIKFRSDIVLEARDLITRILKLRATERLSFPEIQNHPWMLKYVSKV 308          
BLAST of aurora kinase-1 vs. Planmine SMEST
Match: SMESG000016505.1 (SMESG000016505.1)

HSP 1 Score: 233.032 bits (593), Expect = 1.786e-74
Identity = 116/254 (45.67%), Postives = 164/254 (64.57%), Query Frame = 1
Query:  112 IDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYI 873
            + +F IG  +G+G+FG VYLVK  +  FV A+K++ K+ +  ++L +Q  REI+I  HL HPNIL+LY +FHD++ VYL++E A  G+++  +QK  R+ +  AATY+HQL  AL YCH++ V+HRDIKPEN+LI    + KLADFGWS+H     R T+CGTLDYL PEMV    Y  +ID W  G+LLYEML    PFE   +Q+T   I++        +   A D+I +IL +    RL+   I  HP++
Sbjct:   33 LKDFDIGMPLGTGKFGHVYLVKTVKEGFVCALKIMFKSQLTRHNLEHQFLREIDIMVHLDHPNILKLYTWFHDEKHVYLVLEYAWFGQMFTILQKKQRFTDIEAATYLHQLCDALSYCHQKGVIHRDIKPENLLISLDMELKLADFGWSIHTNLMKRKTLCGTLDYLPPEMVNSKEYDEKIDHWMTGILLYEMLHGFPPFEKAKKQETYAAIRANSIEFRSDIVLEARDLITRILKLKSVERLTFVAIQNHPWM 286          
BLAST of aurora kinase-1 vs. Planmine SMEST
Match: SMESG000060356.1 (SMESG000060356.1)

HSP 1 Score: 208.379 bits (529), Expect = 1.552e-64
Identity = 106/271 (39.11%), Postives = 160/271 (59.04%), Query Frame = 1
Query:  118 NFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKENDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYEDIQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCKLADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYEMLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKARLSLDQIIQHPYIDEFSEKVTDDCQASRLMWA 930
            +F I +K+G GQF  VY   EK    V+A+K I K+   +    N ++ E++IH  L HPN+L+L+G F D    YL++E    GE+  DI K   Y NERAATY++Q++ AL+YCH   ++HRDIK ENIL+ S G  K+ADFG S   +  +R+T CGTL ++APE++     T  +DIW LGVL YEML    PF   +  +  + I++V +  P   + +    +  +L  +   RL+  Q++  P+I ++SE    +C+A+   WA
Sbjct:    9 DFSILEKVGDGQFAKVYKAIEKNIKRVVALKKISKSKFGKTRSKNTIESEVKIHFSLKHPNLLQLFGTFTDDNATYLILEFCGCGEMRRDILKCKGYPNERAATYVYQISSALEYCHNNSIIHRDIKSENILLTSAGAVKIADFGCSKLLEKQLRHTFCGTLAFVAPEILNGAEQTAMVDIWSLGVLCYEMLFVRTPFHAENVSEIRDNIRNVRYEFPPKSDISVEYFLNSLLRKDTYERLTASQVLAFPFILKYSENTLKECKAAIDQWA 279          
The following BLAST results are available for this feature:
BLAST of aurora kinase-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AURKA1.072e-9849.63aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.072e-9849.63aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.072e-9849.63aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.072e-9849.63aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
AURKA1.072e-9849.63aurora kinase A [Source:HGNC Symbol;Acc:HGNC:11393... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
air-27.324e-8845.00Aurora/IPL1-related protein kinase 2 [Source:UniP... [more]
air-12.590e-8345.15Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
air-12.590e-8345.15Aurora/Ipl1 Related kinase; Aurora/Ipl1-related pr... [more]
unc-431.003e-4734.48Calcium/calmodulin-dependent protein kinase type I... [more]
unc-431.003e-4734.48Calcium/calmodulin-dependent protein kinase type I... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurA8.376e-8847.19gene:FBgn0000147 transcript:FBtr0082483[more]
aurB8.712e-7541.13gene:FBgn0024227 transcript:FBtr0080180[more]
Sik21.078e-5138.04gene:FBgn0025625 transcript:FBtr0070340[more]
SAK9.910e-5035.41gene:FBgn0026371 transcript:FBtr0078387[more]
par-12.133e-4732.71gene:FBgn0260934 transcript:FBtr0301503[more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka1.374e-9850.00aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
aurkb4.940e-9448.47aurora kinase B [Source:NCBI gene;Acc:791894][more]
aurka2.169e-6355.13aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
mark3a4.917e-4933.07MAP/microtubule affinity-regulating kinase 3a [Sou... [more]
MARK44.226e-4833.07si:dkey-31m14.7 [Source:ZFIN;Acc:ZDB-GENE-121214-9... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb4.299e-10249.81aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb4.558e-10249.81aurora kinase B [Source:NCBI gene;Acc:549613][more]
aurkb7.321e-10249.81aurora kinase B [Source:NCBI gene;Acc:549613][more]
zbtb397.050e-9850.00zinc finger and BTB domain containing 39 [Source:X... [more]
ENSXETT00000045494.14.187e-4832.06MAP/microtubule affinity-regulating kinase 4 [Sour... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Aurka5.443e-9949.81aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka5.443e-9949.81aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurka2.235e-9849.81aurora kinase A [Source:MGI Symbol;Acc:MGI:894678][more]
Aurkb2.483e-9548.68aurora kinase B [Source:MGI Symbol;Acc:MGI:107168][more]
Aurkb2.483e-9548.68aurora kinase B [Source:MGI Symbol;Acc:MGI:107168][more]
back to top
BLAST of aurora kinase-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6GPL3|AUKBB_XENLA3.276e-10250.57Aurora kinase B-B OS=Xenopus laevis OX=8355 GN=aur... [more]
sp|Q6DE08|AUKBA_XENLA7.038e-10250.57Aurora kinase B-A OS=Xenopus laevis OX=8355 GN=aur... [more]
sp|A4IGM9|AURKB_XENTR2.277e-10149.81Aurora kinase B OS=Xenopus tropicalis OX=8364 GN=a... [more]
sp|P97477|AURKA_MOUSE3.808e-9849.81Aurora kinase A OS=Mus musculus OX=10090 GN=Aurka ... [more]
sp|O14965|AURKA_HUMAN4.234e-9849.63Aurora kinase A OS=Homo sapiens OX=9606 GN=AURKA P... [more]
back to top
BLAST of aurora kinase-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIC80.000e+0100.00Aurora kinase-1 OS=Schmidtea mediterranea OX=79327... [more]
A0A0P7V4G28.612e-10050.18Protein kinase domain-containing protein OS=Sclero... [more]
A0A1L8H3C52.086e-9950.57Protein kinase domain-containing protein OS=Xenopu... [more]
A0A0P7UMX55.975e-9951.14Aurora kinase A-B-like (Fragment) OS=Scleropages f... [more]
A0A5G3KNV37.157e-9949.81Aurora kinase B OS=Xenopus tropicalis OX=8364 GN=a... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb8.836e-9747.64aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurkb1.185e-9647.64aurora kinase B [Source:NCBI gene;Acc:103024192][more]
aurka2.520e-9548.18aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
aurka3.819e-9549.24aurora kinase C-like [Source:NCBI gene;Acc:1030345... [more]
mark3a6.449e-4832.71microtubule affinity regulating kinase 3 [Source:N... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurka8.459e-9348.87aurora kinase A [Source:ZFIN;Acc:ZDB-GENE-040801-1... [more]
MARK32.120e-4832.18microtubule affinity regulating kinase 3 [Source:H... [more]
MARK36.207e-4732.68microtubule affinity regulating kinase 3 [Source:H... [more]
snrka3.569e-4534.66SNF related kinase a [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ENSPMAT00000002824.11.706e-4430.37pep scaffold:Pmarinus_7.0:GL476598:1893846:1903215... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
IPL17.646e-6843.36Aurora kinase of chromosomal passenger complex; me... [more]
TPK39.814e-5434.96cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK14.037e-5132.70cAMP-dependent protein kinase catalytic subunit; p... [more]
TPK21.523e-4933.08cAMP-dependent protein kinase catalytic subunit; p... [more]
SNF11.132e-4634.52AMP-activated S/T protein kinase; forms a complex ... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO354375.521e-9246.86Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365876.778e-4833.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO307686.909e-4833.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460352.601e-4733.33Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347071.818e-4634.85Serine/threonine-protein kinase PLK4 [Source:UniP... [more]
back to top
BLAST of aurora kinase-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
aurkb1.620e-9446.67aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurkb2.564e-9446.67aurora kinase B [Source:NCBI gene;Acc:100301584][more]
aurka5.020e-9446.43aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka1.083e-9346.10aurora kinase A [Source:NCBI gene;Acc:101165631][more]
aurka6.038e-9346.57aurora kinase A [Source:NCBI gene;Acc:101165631][more]
back to top
BLAST of aurora kinase-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006604.10.000e+0100.00SMESG000006604.1[more]
SMESG000036830.15.891e-9046.45SMESG000036830.1[more]
SMESG000004605.15.225e-7544.83SMESG000004605.1[more]
SMESG000016505.11.786e-7445.67SMESG000016505.1[more]
SMESG000060356.11.552e-6439.11SMESG000060356.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015999
GenBankAFJ24782.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015999 ID=SMED30015999|Name=aurora kinase-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1059bp
TTGATAATCCATAAAGACATTATTTTCAAATTATTTATAAACTTTTTATT
AATTAGTTTTTAAGAAAATTATATTAGATATTTTGCTATGACCGAACCTC
AGAATTGGTGTATAGATAATTTCTACATTGGTAAAAAAATAGGTTCTGGT
CAATTTGGCAGTGTCTATTTAGTCAAAGAAAAGCGTAATAATTTCGTTTT
AGCTATCAAGATGATTAGGAAGAATTATATCAAAGAAAATGACTTGCACA
ATCAGCTTAAGAGAGAAATTGAAATACACTCGCATTTACTACATCCAAAT
ATTTTACGATTGTATGGTTATTTTCACGATAAAGAACGTGTATATTTAAT
GGTGGAGTTGGCAACAAAAGGAGAATTATACGAAGATATTCAAAAATATG
GTAGATACATTAATGAACGAGCTGCTACCTATATGCATCAATTAGCACTA
GCTCTCAAGTACTGCCACGAAAGACATGTAATGCACCGTGACATAAAGCC
AGAAAACATTCTAATCGGTTCCAAAGGCCAGTGTAAGTTGGCGGATTTCG
GCTGGTCGGTTCACTACAAAACAGGCGTTCGCAACACTATGTGTGGTACC
TTAGATTATCTGGCCCCTGAAATGGTTGAGCAAGATTCCTATACTTTTGA
AATCGATATTTGGTGCTTAGGAGTTTTATTGTATGAAATGCTGACAAAAA
GTGTTCCATTTGAAGACCCTTCAGAACAGAAGACAATGGAACGGATAAAA
TCTGTAGAATTTGCGGTGCCTGATTTCGTAAACCCCAATGCAGCTGATAT
GATCAAAAAAATATTGGTTATGAACCCGAAAGCTAGGCTGTCATTGGACC
AAATCATACAGCATCCGTATATTGACGAGTTCTCTGAAAAAGTCACCGAT
GATTGCCAAGCCTCGCGTTTGATGTGGGCAGCAGGCTTAAATAATTTACC
CGATAAAGAAAATCATTAAATTCACTGACTATATTGATTGTTATTTTCAG
CTATCTAGATTTTGTGTTTATGTCAATTTCAAAAGTTAGAATAAAAATAT
GATTGTTGA
back to top

protein sequence of SMED30015999-orf-1

>SMED30015999-orf-1 ID=SMED30015999-orf-1|Name=SMED30015999-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=294bp
MTEPQNWCIDNFYIGKKIGSGQFGSVYLVKEKRNNFVLAIKMIRKNYIKE
NDLHNQLKREIEIHSHLLHPNILRLYGYFHDKERVYLMVELATKGELYED
IQKYGRYINERAATYMHQLALALKYCHERHVMHRDIKPENILIGSKGQCK
LADFGWSVHYKTGVRNTMCGTLDYLAPEMVEQDSYTFEIDIWCLGVLLYE
MLTKSVPFEDPSEQKTMERIKSVEFAVPDFVNPNAADMIKKILVMNPKAR
LSLDQIIQHPYIDEFSEKVTDDCQASRLMWAAGLNNLPDKENH*
back to top
Aliases
The feature 'aurora kinase-1' has the following synonyms
Synonym
aurora_kinase-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR030616Aur
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0004674protein serine/threonine kinase activity
GO:0016301kinase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007049cell cycle
GO:0016310phosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 12..262
e-value: 1.4E-92
score: 323.5
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 14..262
e-value: 6.2E-73
score: 245.4
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 12..262
score: 49.94
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 95..265
e-value: 2.0E-61
score: 208.6
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 1..94
e-value: 8.4E-30
score: 104.6
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 4..280
e-value: 1.8E-31
score: 107.0
NoneNo IPR availablePANTHERPTHR24350:SF0AURORA Acoord: 3..270
NoneNo IPR availableCDDcd14007STKc_Auroracoord: 11..262
e-value: 7.59088E-142
score: 397.616
IPR030616Aurora kinasePANTHERPTHR24350SERINE/THREONINE-PROTEIN KINASE IAL-RELATEDcoord: 3..270
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 131..143
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 18..45
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 7..266