Adenylate cyclase type

Overview
NameAdenylate cyclase type
Smed IDSMED30015994
Length (bp)3175
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015994

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30015994SMESG000009033.1 dd_Smed_v4_25342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015994SMESG000009033.1 dd_Smed_v4_25342_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015994SMESG000009033.1 dd_Smed_v6_25342_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY9 (adenylate cyclase 9 [Source:HGNC Symbol;Acc:HGNC:240])

HSP 1 Score: 223.402 bits (568), Expect = 6.111e-59
Identity = 132/387 (34.11%), Postives = 207/387 (53.49%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKR 1479
            ++S+ + ++ L+YT+  +   + + L + Y ++F + G +FR    ++          L             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG+++     S++ +Q+ G          L+TY +   + K  R
Sbjct:  223 SFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFR----DEACFPSPGAGAL-------------HWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSVVADQLKG----------LKTYLISGQRAKESR 580          

HSP 2 Score: 199.519 bits (506), Expect = 2.048e-51
Identity = 166/528 (31.44%), Postives = 259/528 (49.05%), Query Frame = 1
Query: 1651 EFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAF-----------ISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIG--NVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSF--QLFQICLLV---------------YYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMAS--DEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            ++F  PPINQ +L F D ++E  Y   T+ Q E I+   +K   F     S +    + T  ++ +      K+ +  +        V  A            I +++  E      +++  + +  L R  +   + SLP++ V+S   +E  + N H+     S  L A++   N    SS+  ++     +    P+ L+  +  P              L+  +N  + R  C  S    L +   L+               ++L RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I N FS +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   +  S   EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  740 DYFFKPPINQFSLNFLDQELERSY--RTSYQEEVIKNSPVKT--FASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIRMVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSE-YETNIHFPVFTGSAALIAVVHYCNFCQLSSW--MRSSLATVVGAGPLLLLYVSLCPDSSVLT------SPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVN-FSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 64.6994 bits (156), Expect = 1.063e-9
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 188.348 bits (477), Expect = 3.654e-52
Identity = 103/271 (38.01%), Postives = 159/271 (58.67%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            M G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E++G  G VHI++ T   +   Y  E G   E  S +K   H I           T+F++P   +
Sbjct:    1 MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLK--THNIE----------TFFIVPSHRR 257          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 188.348 bits (477), Expect = 3.654e-52
Identity = 103/271 (38.01%), Postives = 159/271 (58.67%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            M G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E++G  G VHI++ T   +   Y  E G   E  S +K   H I           T+F++P   +
Sbjct:    1 MYGVFVRILTERSQRKAFLQARSCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTGLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAAGLPGKVHITKTTLACLNGDYEVEPGYGHERNSFLK--THNIE----------TFFIVPSHRR 257          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY8 (adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:239])

HSP 1 Score: 194.512 bits (493), Expect = 6.565e-50
Identity = 97/248 (39.11%), Postives = 148/248 (59.68%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +V+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+ T   +   Y  E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 137.887 bits (346), Expect = 3.159e-32
Identity = 100/278 (35.97%), Postives = 145/278 (52.16%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTY-LVVRSLEKPFL 3165
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F YRG I VKG    +G++ TY L+ R    PF+
Sbjct:  912 VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQ-GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFI 1180          

HSP 3 Score: 103.219 bits (256), Expect = 1.756e-21
Identity = 69/251 (27.49%), Postives = 128/251 (51.00%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPI------PRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR-HAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN-----KRKLQSRISL 1503
            I+PS V  +FL++ R+N+    +Y ++++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG          +  H  +  +  L +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+TYL+++   + F+  GEI          + G+ ++   ++TYF++     N      R+L  + SL
Sbjct:  954 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSL 1192          

HSP 4 Score: 52.373 bits (124), Expect = 5.242e-6
Identity = 47/226 (20.80%), Postives = 95/226 (42.04%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-----YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + + YL+   ++   L      EA +R       N+  E L+ +++P+ V  E++    +  +E         Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL    ++     H    +     M   +R    +     +   ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  336 IFISYLSDRAQRQAFLETRRCVEARLR---LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRQD-----HAHCCVEMGLSMIKTIRYVRSRT---KHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 544          
BLAST of Adenylate cyclase type vs. Ensembl Human
Match: ADCY8 (adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:239])

HSP 1 Score: 194.126 bits (492), Expect = 6.943e-50
Identity = 97/248 (39.11%), Postives = 148/248 (59.68%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +V+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+ T   +   Y  E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 137.502 bits (345), Expect = 3.407e-32
Identity = 100/278 (35.97%), Postives = 145/278 (52.16%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTY-LVVRSLEKPFL 3165
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F YRG I VKG    +G++ TY L+ R    PF+
Sbjct:  781 VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQ-GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFI 1049          

HSP 3 Score: 102.834 bits (255), Expect = 1.983e-21
Identity = 69/251 (27.49%), Postives = 128/251 (51.00%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPI------PRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR-HAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN-----KRKLQSRISL 1503
            I+PS V  +FL++ R+N+    +Y ++++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG          +  H  +  +  L +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+TYL+++   + F+  GEI          + G+ ++   ++TYF++     N      R+L  + SL
Sbjct:  823 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSL 1061          

HSP 4 Score: 51.6026 bits (122), Expect = 9.591e-6
Identity = 48/220 (21.82%), Postives = 94/220 (42.73%), Query Frame = 1
Query: 2380 NEKNIRLNFYATR---EAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-----YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            +++  R  F  TR   EA +R       N+  E L+ +++P+ V  E++    +  +E         Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL    ++     H    +     M   +R    +     +   ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  342 SDRAQRQAFLETRRCVEARLR---LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRQD-----HAHCCVEMGLSMIKTIRYVRSRT---KHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 544          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-1 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19523])

HSP 1 Score: 218.779 bits (556), Expect = 5.246e-58
Identity = 130/368 (35.33%), Postives = 195/368 (52.99%), Query Frame = 1
Query:  442 IILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLK---RIRNNDMFSLVYCKA---------------------------FENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG-EILSIMKEQVHGISGMIQKSVPLRTYFV 1452
            ++LL+YT+  +   + +L+ ++Y ++F  +   +I                           EE  YI  + +L   +++ G++L     +R++  FLK+ Q+  AR  ++   + + + I+++MP  V +  LK    +R     +   C+                              NVSILFADI GFT MSSNK+A +LV LLNDL+ RFD   R    EKI TLGDCYYCV+GCP P  DHA   VEMGL M   I +F+ D  + VNMRVGIH+G+V+  ++G  RF+FDVFS DV +AN +ESSG AG VH+SE T  L++  Y  E+G +    ++ QV G    + K   ++T+F+
Sbjct:  162 VVLLIYTVIPLPLYLCILIGIIYSILFEILNKNKIG-------------------------LEEAGYI--KLVLHAGVHLLGVHLFILTQVRQRKTFLKVGQSMLARKDLELETQFKDHMIQSVMPKKVADELLKDASELRRPSASNDSNCRTSNATQVDQPLAKMVPEYRKFRPFTMNLMTNVSILFADIAGFTKMSSNKSADELVNLLNDLFGRFDTLCRLRGLEKISTLGDCYYCVAGCPEPCDDHACRTVEMGLDMIVAIRQFDIDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSGVAGRVHVSEATAKLLKGLYEIEEGPDYDGPLRMQVQGTERRV-KPESMKTFFI 501          

HSP 2 Score: 171.014 bits (432), Expect = 6.377e-43
Identity = 103/267 (38.58%), Postives = 155/267 (58.05%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEI-VGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEE--MASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKG-KGEMNTYLVV 3141
            +LV +L  + E   R++F+   +A             A+ LL N+IP    + +    K+S ++E            GV+FA I+N+ +  Y E+++GG   LR+L+ +I  FD LL +P +  +EKIKTI   YM ASGLN + ++  +   EHL  ++ FA  + + L +FNE  +   + F  K+G N GP+TAG+IGT+K  YDIWGDTVN+ASRMYST    + IQV ++  E L   ++F++R  I VKG  G M+TYL+V
Sbjct:  982 VLVAFLNYQFETAFRMSFFGDVQARRDTERMQIVRDQADWLLNNVIPAHAVESLKTDTKYSENHE----------TVGVLFASITNW-NDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEHLYQMVDFALAVQHVLSVFNEDLL--NFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTG-VLNRIQVSQHTREYLLDRYEFEFRDHIEVKGIDGGMDTYLLV 1234          

HSP 3 Score: 60.4622 bits (145), Expect = 6.396e-9
Identity = 65/270 (24.07%), Postives = 119/270 (44.07%), Query Frame = 1
Query:  658 ILLFLMYM--TGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSN--KTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDT--YLLVRHAYTFEDGEILSIMKEQVHGISG 1413
            ++ FL Y   T   + FF  ++        A+    R+++   ++ Q  W+   ++P+   E+     +        Y +  E V +LFA I  +  M     +   + + +LN++   FDE   +   T+ EKI T+G  Y   SG    R        +H    V+  L +  ++  FN+D    +   ++G++ G V A +IG  +  +D++   V IA+ + S+G    + +S+ T  YLL R+ + F D         +V GI G
Sbjct:  983 LVAFLNYQFETAFRMSFFGDVQ--------ARRDTERMQI---VRDQADWLLNNVIPAHAVESLKTDTK--------YSENHETVGVLFASITNWNDMYEENFEGGREFLRVLNEVIGDFDELLDRPDFTHIEKIKTIGPAYMAASGLNPERKKNMLHPKEHLYQMVDFALAVQHVLSVFNEDLLNFDFVCKLGLNIGPVTAGVIGTTKLYYDIWGDTVNIASRMYSTGVLNRIQVSQHTREYLLDRYEFEFRD-------HIEVKGIDG 1226          

HSP 4 Score: 53.1434 bits (126), Expect = 1.132e-6
Identity = 44/185 (23.78%), Postives = 82/185 (44.32%), Query Frame = 1
Query: 2575 NAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFK----YRGTISVKGKG 3117
            N  ++FA I+ F         K  +  + LL+ +   FD L +      LEKI T+ DCY   +G          D+H    +    DM   +R F+   I       +++G + G +  G++GT +  +D++ + V +A+ M S+      + V E   + LK  ++ +    Y G + ++ +G
Sbjct:  317 NVSILFADIAGFTK---MSSNKSADELVNLLNDLFGRFDTLCR---LRGLEKISTLGDCYYCVAGCPE-----PCDDHACRTVEMGLDMIVAIRQFD---IDRGQEVNMRVGIHTGKVMCGMVGTKRFKFDVFSNDVTLANEMESSG-VAGRVHVSEATAKLLKGLYEIEEGPDYDGPLRMQVQG 486          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-2 (Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16880])

HSP 1 Score: 161.77 bits (408), Expect = 3.920e-40
Identity = 93/250 (37.20%), Postives = 140/250 (56.00%), Query Frame = 1
Query:  814 MPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKN----------KNKR-----KLQSRISLNRNTS 1518
            +P + K N     +N+ +F  ++ +  +NVSILFADIV FT++++  TA  LV  LN+LY++FD   ++  C +I  LGDCYYCVSG P+ R +HA  CV MGL M   I +       +VNMR+G+H+G V+  I+G  +++FD++S DV +AN +ES+G  G VHI++ T  ++   Y   D        +  H +S       P  TY ++PDK           +N R      LQSR+S+    S
Sbjct:  288 VPRTGKNN----TKNHKLFHDLHVQVHDNVSILFADIVNFTVLAAQLTAKDLVRTLNELYSKFDRDAQRLQCMRIKFLGDCYYCVSGMPVNRPNHADMCVVMGLEMINTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDDVTLANHMESAGVPGAVHITKSTKDMLLGDYCIVDAN-----TDDPHVVS----YGQP--TYHILPDKTSAIERTASIYRNSRLSTSPALQSRMSMKAKVS 522          

HSP 2 Score: 119.398 bits (298), Expect = 5.556e-27
Identity = 93/287 (32.40%), Postives = 136/287 (47.39%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHA-NKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLN---SDHEEMASDE------------------HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM---------YSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKG-KGEMNTYLV 3138
            R+ E    ++F    + E R+ E     NKI   L+ NI+P  V  + +     + NE+   YA    N  V+FA I NF   +   D       LRLL+ I+C FD LL KP +  +EKIKT+   YM A+GLN   +D++++  ++                  +  +++ FA  M   L   N  +      F L+IG + GP+ AG+IG  KP YDIWG+TVN+ASRM         ++T      +Q   Y V+          RG I VKG K  M T+L+
Sbjct:  790 RKRESACHVSF----QNEERDVETMQDINKI---LIENILPSSVAAKFLSPD-RAVNEL---YARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQILDALNRDSF---QNFELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRMDTHGEPRKIHATTDMGRVLQTGGYRVQS---------RGKIRVKGVKEPMETFLI 1053          

HSP 3 Score: 73.9442 bits (180), Expect = 4.595e-13
Identity = 72/288 (25.00%), Postives = 125/288 (43.40%), Query Frame = 1
Query:  715 RRKSAFLKLAQNAEARLK-MQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF-TMMSSNKTAAQL--VYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRIDH--------------------------AISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSV--PLRTYFVIPDKNKN 1473
            +R+SA     QN E  ++ MQ   KI I   E I+PSSV   FL   R     + +Y +  ENV ++FA I  F    S   T  +L  + LLN++   FD+   + + ++ EKI T+G  Y   +G      D+                          A   +E  L M +++   N+D  +N  +R+G+  G ++A +IG  + ++D++   V +A+ +++ G    +H + D             G +L     +V     +  K V  P+ T+ +  D  +N
Sbjct:  791 KRESACHVSFQNEERDVETMQDINKILI---ENILPSSVAAKFLSPDR---AVNELYARQHENVCVMFASIPNFKDFWSEWDTNRKLECLRLLNEIVCEFDKLLSKPKFSSVEKIKTVGSTYMAAAGLNESEADYDDIYLEKQNSGKYNNNIRHGNMAFRNANLMIEFALAMSQILDALNRDSFQNFELRIGMSVGPLVAGVIGAQKPQYDIWGNTVNLASRMDTHGEPRKIHATTDM------------GRVLQTGGYRVQSRGKIRVKGVKEPMETFLIEVDSKRN 1060          

HSP 4 Score: 51.2174 bits (121), Expect = 4.792e-6
Identity = 61/241 (25.31%), Postives = 93/241 (38.59%), Query Frame = 1
Query: 2356 LVYYLARENEKNIRLNFYAT-REAEIRNAEATHANKIAESLLYNIIP----KQVFKEIV--------------GKKWSSSNEMAFSYAHA--FANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            LV  +A  NE   R        EA  R  E        E LL ++IP     QV K I+              GK  ++ N   F   H     N  ++FA I NF     +   K     +R L+ +   FD   ++   L+  +IK + DCY   SG+  +        H  + +    +M   +    +  I       ++IG + G +  GI+G  K  +DIW D V +A+ M S  
Sbjct:  219 LVGVVADSNEAGNRAEIARKLTEAVYRRTELETLKDRQEQLLLSVIPAYLADQVSKSIIQSSSTGSTVEVPRTGKN-NTKNHKLFHDLHVQVHDNVSILFADIVNFTVLAAQLTAKD---LVRTLNELYSKFDRDAQR---LQCMRIKFLGDCYYCVSGMPVNRPN-----HADMCVVMGLEM---INTIKQVRIATGVDVNMRIGVHTGSVLCGIMGLRKWQFDIWSDDVTLANHMESAG 444          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: acy-4 (Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q966F9])

HSP 1 Score: 159.073 bits (401), Expect = 2.209e-39
Identity = 84/245 (34.29%), Postives = 140/245 (57.14%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVK---ENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            I  + +++ L+ + G  + +     ++  F +  +  ++R+ +   +  Q   + A++P ++    +  ++      MF  +Y + +E++SILFADI GFT ++S      LV +LN+L+ RFD+      C +I  LGDCYYCV G P  + +HAI+ VEMG  M   I    +    NVNMRVGIH+G+    ++G  +++FDV+S DV +AN +ES G AG VHI++ T   ++ AY  E+G
Sbjct:  212 ILTRVMMVILVNVVGSLVYYPTEFVQRKTFHETRKCVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKDMQETHEERMFHKIYIRKYEDISILFADICGFTNLASEYNPKDLVLMLNELFARFDKVASIHQCMRIKILGDCYYCVCGVPEYQKNHAINTVEMGRDMIEAIRLVREMTLVNVNMRVGIHTGKAHCGVLGLKKWQFDVWSNDVTLANQMESGGLAGRVHITDATRSYLKGAYILEEG 456          

HSP 2 Score: 140.969 bits (354), Expect = 1.206e-33
Identity = 99/269 (36.80%), Postives = 142/269 (52.79%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPI----YLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLVV 3141
            LLV +  R +E   R +F    +A     +    ++   S+L NI+P  V K  V    S S      Y  +  NA ++FA ++ F   Y   D    G   LRLL+ II  FD +L + +    + K+EKIKTI+  YM+ASGL     E   + H++ +  FA ++   L      NI     F L+IG N GP+ AG+IG+ KP YDIWG++VNVASRM  +      IQV E V   L+ L ++F+ RG I+VKGKG M T+ ++
Sbjct:  744 LLVVFSTRRSELISRYDFIWKLQALDEQLQMKRKHEQNRSVLENILPSHVAKHFVEDATSVSK----LYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGLAG--RECGDNSHVEAIALFARELLVKLE---STNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRM-DSGGVAGRIQVTEEVKSILEPLGYNFECRGQINVKGKGMMETFFLL 1002          

HSP 3 Score: 72.7886 bits (177), Expect = 1.047e-12
Identity = 84/351 (23.93%), Postives = 154/351 (43.87%), Query Frame = 1
Query:  463 LFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM----SSNKTAAQLVYLLNDLYNRFDEQGRQ-------TNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKF---NKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDT-YLLVRHAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKN 1467
            +  + FM  +L+S++Y   F  +   ++  + Q E  +ST ++                +    C+ L L+  +    R    I R     KL Q  + +L+M+   +     +E I+PS V ++F   + +    S +Y ++ +N  I+FA +  F         N    + + LLN++ + FD+   Q          EKI T+   Y   SG              + L    L+VK    N     N N+R+GI+ G V+A +IG+ +  +D++   V +A+ ++S G AG + ++E+   +L    Y FE  G+I       V G  GM++      T+F++P ++
Sbjct:  692 ILSVDFMTKLLMSMIYFSSFTVLITAKLIRINQYEALLSTYAN----------------FCVLSCLTLLLVVFST---RRSELISRYDFIWKL-QALDEQLQMKRKHEQNRSVLENILPSHVAKHF---VEDATSVSKLYHESRDNACIMFATLTEFDKFYIECDGNNEGVECLRLLNEIISDFDQILDQILDREEFKKIEKIKTISTTYMVASGLAGRECGDNSHVEAIALFARELLVKLESTNIHSFNNFNLRIGINVGPVVAGVIGSDKPHYDIWGNSVNVASRMDSGGVAGRIQVTEEVKSILEPLGYNFECRGQI------NVKG-KGMME------TFFLLPPED 1006          

HSP 4 Score: 50.447 bits (119), Expect = 8.769e-6
Identity = 51/220 (23.18%), Postives = 91/220 (41.36%), Query Frame = 1
Query: 2356 LVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYS 3009
            LVYY     E   R  F+ TR+               E +L  ++PK +  E+      +  E  F   Y   + +  ++FA I  F  +    +Y   ++ L +L+ +   FD   K     +  +IK + DCY    G+    +  A +      +    DM   +RL  E  +V      +++G + G    G++G  K  +D+W + V +A++M S
Sbjct:  228 LVYY---PTEFVQRKTFHETRKCVQSRMLLDKEMHRQEKILLAVLPKNIAFEVKKDMQETHEERMFHKIYIRKYEDISILFADICGF--TNLASEYNPKDLVL-MLNELFARFD---KVASIHQCMRIKILGDCYYCVCGVPEYQKNHAINT-----VEMGRDMIEAIRLVREMTLVNVN---MRVGIHTGKAHCGVLGLKKWQFDVWSNDVTLANQMES 430          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: gcy-13 (Receptor-type guanylate cyclase gcy-13 [Source:UniProtKB/Swiss-Prot;Acc:Q19768])

HSP 1 Score: 113.235 bits (282), Expect = 3.728e-25
Identity = 70/196 (35.71%), Postives = 111/196 (56.63%), Query Frame = 1
Query:  877 VYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPR---IDHAISCVEMGLGMCRLIVKFNKDH--KENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAY----TFEDGEILSIMKE--QVHGISGMIQKSV 1431
            V  +AFE+V+I F+D+VGFT++++  T  Q+V LLNDLY  FD    + +  K+ T+GD Y  VSG  +PR    +H  +   M L +   +  F   H  +E V +R+G+HSG  +A ++G    R+ +F   V  A+ +ES+G+ GF+H+S D Y L+   Y    T   GE++   K   Q + + GM ++S 
Sbjct:  835 VEPEAFESVTIFFSDVVGFTVLANKSTPLQVVNLLNDLYTTFDAIIEKNDSYKVETIGDAYLVVSG--LPRRNGTEHVANIANMSLELMDSLQAFKIPHLPQEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTYWLLGMKEESA 1028          

HSP 2 Score: 74.7146 bits (182), Expect = 2.994e-13
Identity = 67/243 (27.57%), Postives = 115/243 (47.33%), Query Frame = 1
Query: 2419 EAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEY-VVEKLKLYFDFKYRGTISVKGKGEMNTYLVV 3141
            E + R  E     K ++ LLY ++P+QV + +  K   S    AF     F +  V F  ++N  +             + LL+ +  TFD +++K    K+E   TI D Y++ SGL   +      EH+  +   + ++   L+ F   ++       ++IG + G   AG++G + P Y ++GDTVN ASRM S   P    +    Y ++  L   ++ + RG + +KGKG M TY ++
Sbjct:  798 EVQERMKELVEEKKKSDILLYRMLPQQVAERL--KLGQSVEPEAFESVTIFFSDVVGFTVLANKSTPLQ---------VVNLLNDLYTTFDAIIEKNDSYKVE---TIGDAYLVVSGLPRRN----GTEHVANIANMSLELMDSLQAFKIPHLP-QEKVQIRIGMHSGSCVAGVVGLTMPRYCLFGDTVNTASRMESNGKPGFIHLSSDCYDLLTSLYKEYNTESRGEVIIKGKGVMQTYWLL 1021          
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Match: gcy-28 (Receptor-type guanylate cyclase gcy-28 [Source:UniProtKB/Swiss-Prot;Acc:Q86GV3])

HSP 1 Score: 110.153 bits (274), Expect = 4.685e-24
Identity = 60/164 (36.59%), Postives = 94/164 (57.32%), Query Frame = 1
Query:  877 VYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHK--ENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFE 1362
            V  ++++ V+I F+DIVGFT +SS  T  Q+V LLNDLY  FD         K+ T+GD Y  VSG P  R DHA    +M L +   +  F   H+  E + +R+G+HSG V+A ++G+   R+ +F   V  ++ +ES+G    +H+S+ TY ++     F+
Sbjct: 1077 VQAESYDCVTIYFSDIVGFTSLSSQSTPMQVVTLLNDLYLAFDGVVDNFKVYKVETIGDAYMVVSGLPERRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQLKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFK 1240          

HSP 2 Score: 71.633 bits (174), Expect = 3.124e-12
Identity = 61/245 (24.90%), Postives = 107/245 (43.67%), Query Frame = 1
Query: 2425 EIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLF------NEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLV 3138
            E R  E     K  E LL+ ++P  +   ++  +           A ++    + F+ I  F S   +         + LL+ +   FD ++      K+ K++TI D YM+ SGL         D+H   +   +  + + ++ F      +EQ         L+IG + G + AG++G+  P Y ++GDTVN +SRM S   P    +    Y +   +  F  + RG++ +KGKG   TY +
Sbjct: 1042 EERTQEYLAEKKKVEELLHQLLPPAIADTLIAGR--------AVQAESYDCVTIYFSDIVGFTSLSSQSTPM---QVVTLLNDLYLAFDGVVDN---FKVYKVETIGDAYMVVSGLPE-----RRDDHANQIAQMSLSLLHKVKNFVIRHRPHEQ-------LKLRIGMHSGSVVAGVVGSKMPRYCLFGDTVNTSSRMESNGLPLKIHVSQQTYDILMQEAGFKLELRGSVEMKGKGMQTTYWL 1260          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0074073)

HSP 1 Score: 223.402 bits (568), Expect = 4.114e-59
Identity = 112/256 (43.75%), Postives = 158/256 (61.72%), Query Frame = 1
Query:  673 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKE--------------------NFLKRIRNNDMFSLV---YCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGE 1371
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +                    ++++   +ND+ SL    +  + ENVSILFADIVGFT MSS KTA QLV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSG+   VHIS++T   +  AY  E+GE
Sbjct:  255 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGE 510          

HSP 2 Score: 164.466 bits (415), Expect = 1.243e-40
Identity = 104/263 (39.54%), Postives = 140/263 (53.23%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPF 3162
            RE E   RL FY    A        +    A+ LL+NIIPK V + +        N   +S  H   N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   +   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +  +  L   ++F+ RG++ VKGK  M  +L     + P 
Sbjct: 1323 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHL-------KNTAKYSENHH--NIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFLYTTRRDNPL 1571          

HSP 3 Score: 70.8626 bits (172), Expect = 6.228e-12
Identity = 77/353 (21.81%), Postives = 159/353 (45.04%), Query Frame = 1
Query:  358 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---IDHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFE 1362
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+     +        Y +   N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E N+ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + + +D    + + Y FE
Sbjct: 1211 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1545          

HSP 4 Score: 57.7658 bits (138), Expect = 5.928e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2557 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  347 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEGVK---MRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 485          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0100142)

HSP 1 Score: 223.402 bits (568), Expect = 4.114e-59
Identity = 112/256 (43.75%), Postives = 158/256 (61.72%), Query Frame = 1
Query:  673 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKE--------------------NFLKRIRNNDMFSLV---YCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGE 1371
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +                    ++++   +ND+ SL    +  + ENVSILFADIVGFT MSS KTA QLV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSG+   VHIS++T   +  AY  E+GE
Sbjct:  255 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGE 510          

HSP 2 Score: 164.466 bits (415), Expect = 1.243e-40
Identity = 104/263 (39.54%), Postives = 140/263 (53.23%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPF 3162
            RE E   RL FY    A        +    A+ LL+NIIPK V + +        N   +S  H   N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   +   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +  +  L   ++F+ RG++ VKGK  M  +L     + P 
Sbjct: 1323 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHL-------KNTAKYSENHH--NIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFLYTTRRDNPL 1571          

HSP 3 Score: 70.8626 bits (172), Expect = 6.228e-12
Identity = 77/353 (21.81%), Postives = 159/353 (45.04%), Query Frame = 1
Query:  358 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---IDHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFE 1362
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+     +        Y +   N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E N+ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + + +D    + + Y FE
Sbjct: 1211 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1545          

HSP 4 Score: 57.7658 bits (138), Expect = 5.928e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2557 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  347 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEGVK---MRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 485          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: Ac13E (gene:FBgn0022710 transcript:FBtr0332497)

HSP 1 Score: 223.402 bits (568), Expect = 4.184e-59
Identity = 112/256 (43.75%), Postives = 158/256 (61.72%), Query Frame = 1
Query:  673 MYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKE--------------------NFLKRIRNNDMFSLV---YCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGE 1371
            +++ G+++   N +R +  F+K+ QN   R +++   +++   I ++MP  V +                    ++++   +ND+ SL    +  + ENVSILFADIVGFT MSS KTA QLV +LNDL+ RFD+    + CEKI TLGDCYYCVSGCP PR DHAI CVEMGLGM   +  F+    E V MRVG+H+G V+  I+G  R +FDV+S DV +AN +ESSG+   VHIS++T   +  AY  E+GE
Sbjct:  268 VHLVGVHVLIMNLVRMRGTFMKVGQNLLVRRQLEMEKQLKEKMIHSVMPPKVADMLLNEGGPSGLDAGGLPPESHYMRPRASNDVKSLFRPFHMHSMENVSILFADIVGFTRMSSTKTAEQLVEILNDLFERFDDLCSLSGCEKISTLGDCYYCVSGCPEPRADHAICCVEMGLGMIDAMRCFDAQRHEGVKMRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSGKPEQVHISQETSSFLGDAYYLEEGE 523          

HSP 2 Score: 164.466 bits (415), Expect = 1.061e-40
Identity = 104/263 (39.54%), Postives = 140/263 (53.23%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPF 3162
            RE E   RL FY    A        +    A+ LL+NIIPK V + +        N   +S  H   N  +IFA I NF +  Y E Y GG+  LR+L+ +I  FD LL +P +  +EKIKTI   +M ASGL+  H     DEH+  LM F+  M   +  FN+  +   +   L+IG N G +TAG+IGTSK  YDIWGD VNVASRM ST    + IQV +  +  L   ++F+ RG++ VKGK  M  +L     + P 
Sbjct: 1336 REFEIGYRLTFYGNAVANQDKVRVQNMKNQADMLLHNIIPKHVAEHL-------KNTAKYSENHH--NIAIIFASIVNF-NEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTG-DEHIHTLMEFSIAMQEVVDAFNKDLL--EFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTG-LPNRIQVGKDCLPFLTNRYEFEPRGSVYVKGKDHMEVFLYTTRRDNPL 1584          

HSP 3 Score: 70.8626 bits (172), Expect = 5.979e-12
Identity = 77/353 (21.81%), Postives = 159/353 (45.04%), Query Frame = 1
Query:  358 VIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLF-RMKFMVVMLLSLLYILIFVSIGNFRI------KYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPR---IDHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFE 1362
            V++ +   +LL  +  E  E +Y  ++ + ++ +  F ++   V  +L+ L  L F+ I   ++      +  +Q++   S  + +++  + +  +I+ +   I      L   +  G  L F+ +          A   + ++++Q+        +  I+P  V E+     +        Y +   N++I+FA IV F  M   S     + + +LN+L   FDE   +      EKI T+G  +   SG  P  R    +H  + +E  + M  ++  FNKD  E N+ +R+G++ G V A +IG  +  +D++   V +A+ ++S+G    + + +D    + + Y FE
Sbjct: 1224 VLLIIANFLLLDLEQLEAFEYHYGFLIFVCIVHFCNFTQLNCWVRNVLAFLAALCFIGIAVSQLMVYSHNRSDQQQDQEASNFIQEIKWFQDYHVEIYLDLLLILVLVWFLNREFEIGYRLTFYGN----------AVANQDKVRVQNMKNQADMLLHNIIPKHVAEHLKNTAK--------YSENHHNIAIIFASIVNFNEMYDESYLGGKEFLRVLNELIGDFDELLSRPEFRAVEKIKTIGSTFMAASGLDPSHRGTGDEHIHTLMEFSIAMQEVVDAFNKDLLEFNLILRIGMNIGDVTAGVIGTSKLYYDIWGDAVNVASRMDSTGLPNRIQVGKDCLPFLTNRYEFE 1558          

HSP 4 Score: 58.151 bits (139), Expect = 5.273e-8
Identity = 41/153 (26.80%), Postives = 70/153 (45.75%), Query Frame = 1
Query: 2557 YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + H+  N  ++FA I  F         K  E  + +L+ +   FD+L         EKI T+ DCY   SG      E  +D H    +     M   +R F+ Q   G     +++G + G +  GI+GT +  +D+W + V++A++M S+ 
Sbjct:  360 HMHSMENVSILFADIVGF---TRMSSTKTAEQLVEILNDLFERFDDLCS---LSGCEKISTLGDCYYCVSGC----PEPRAD-HAICCVEMGLGMIDAMRCFDAQRHEGVK---MRVGVHTGTVLCGIVGTRRVKFDVWSNDVSLANKMESSG 498          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: CG43373 (gene:FBgn0263131 transcript:FBtr0307367)

HSP 1 Score: 189.504 bits (480), Expect = 1.361e-48
Identity = 113/291 (38.83%), Postives = 165/291 (56.70%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIP-DKNKNKRKLQSRISLNRNTSNKL 1527
            +TG+Y  +     ++ AF++  Q  EARL+ Q   + Q   + +++P  V    K++   + R+   F  +Y +  ENVSILFADI GFT +S   TA +LV LLN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA   VEMGL M   I    +    NVNMRVGIH+GRV   ++G  +++FDV+S DV +AN +ES G  G VHI+++T   +   Y  E G   E  S +K+              + TY ++P D  +  +K ++R+ +N N S +L
Sbjct:  653 LTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQ-FHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDH------------QIETYLIVPGDIYRPHKKSRNRLQVNGNISKEL 930          

HSP 2 Score: 65.4698 bits (158), Expect = 2.382e-10
Identity = 70/263 (26.62%), Postives = 105/263 (39.92%), Query Frame = 1
Query: 2383 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYV---VEKLKLYFDFKYRGTISVKGKG-EMNTYLVVRSLE 3153
            EK  R  F  TR+           N+  E LL +++P+ V  E+         +  F   Y     N  ++FA I  F S     D    E  +RLL+ +   FD L  +   L+   IK + DCY   SGL          +H    +    DM   + L  E   V      +++G + G +  G++G  K  +D+W + V +A+ M S         +P  V    E LK   D  Y   +   GKG E N+YL    +E
Sbjct:  663 EKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTS---LSDQCTAEELVRLLNELFARFDRLAAEHHCLR---IKLLGDCYYCVSGLPE-----PRPDHAHCAVEMGLDMIDAIALVRE---VMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGG-------IPGRVHITKETLKC-LDGDYEVEV---GKGNERNSYLKDHQIE 900          
BLAST of Adenylate cyclase type vs. Ensembl Fly
Match: CG43373 (gene:FBgn0263131 transcript:FBtr0307368)

HSP 1 Score: 189.504 bits (480), Expect = 2.107e-48
Identity = 113/291 (38.83%), Postives = 165/291 (56.70%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIP-DKNKNKRKLQSRISLNRNTSNKL 1527
            +TG+Y  +     ++ AF++  Q  EARL+ Q   + Q   + +++P  V    K++   + R+   F  +Y +  ENVSILFADI GFT +S   TA +LV LLN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA   VEMGL M   I    +    NVNMRVGIH+GRV   ++G  +++FDV+S DV +AN +ES G  G VHI+++T   +   Y  E G   E  S +K+              + TY ++P D  +  +K ++R+ +N N S +L
Sbjct:  653 LTGVYTHWPKEKAQRKAFIETRQCIEARLRTQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDT-QFHKIYIQRHENVSILFADICGFTSLSDQCTAEELVRLLNELFARFDRLAAEHHCLRIKLLGDCYYCVSGLPEPRPDHAHCAVEMGLDMIDAIALVREVMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGGIPGRVHITKETLKCLDGDYEVEVGKGNERNSYLKDH------------QIETYLIVPGDIYRPHKKSRNRLQVNGNISKEL 930          

HSP 2 Score: 132.109 bits (331), Expect = 1.068e-30
Identity = 92/272 (33.82%), Postives = 136/272 (50.00%), Query Frame = 1
Query: 2338 LFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYR-EDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFN---EQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLV 3138
            LF   L + + + + E   RL+F    +A     +  H       LL NI+P  V +  + ++      +   Y     +  ++FA I NF   Y   E    G   LRLL+ II  FD LL +  +  +EKIK+    YM ASGL ++  +  +  H+  +  +A      L+LF+   E N+     F ++IG N GP+ AG+IG  KP YDIWG+ VNVASRM ST      IQV + + + L+   F+   RG++ VKGKG M TY +
Sbjct: 1217 LFAFMLALIFHSHQTEATYRLDFIWKLQATEEKEDMEHLQAYNRKLLENILPVHVAEHFLSRE----KHLDDLYHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYA------LQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTG-LVDHIQVTQEMQQILEGRGFELTCRGSVDVKGKGSMITYFL 1477          

HSP 3 Score: 70.8626 bits (172), Expect = 5.978e-12
Identity = 52/187 (27.81%), Postives = 91/187 (48.66%), Query Frame = 1
Query:  802 IEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTM----MSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISED 1326
            +E I+P  V E+FL R ++ D     Y +  ++V ILFA I  F+     +  N    + + LLN++   FDE   + R    EKI + G  Y   SG     C      H  +  +  L +   I + N     N  MR+GI+ G V+A +IG  + ++D++   V +A+ ++S+G    + ++++
Sbjct: 1263 LENILPVHVAEHFLSREKHLDDL---YHEQCDSVCILFASIPNFSEFYVELEGNNEGVECLRLLNEIIADFDELLSEERFRCIEKIKSTGATYMAASGLTANTCDRVNFSHVTAMADYALQLFDKIEEVNMHSFNNFRMRIGINIGPVVAGVIGACKPQYDIWGNAVNVASRMDSTGLVDHIQVTQE 1446          

HSP 4 Score: 65.4698 bits (158), Expect = 2.780e-10
Identity = 75/266 (28.20%), Postives = 110/266 (41.35%), Query Frame = 1
Query: 2383 EKNIRLNFYATR---EAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYV---VEKLKLYFDFKYRGTISVKGKG-EMNTYLVVRSLE 3153
            EK  R  F  TR   EA +R       N+  E LL +++P+ V  E+         +  F   Y     N  ++FA I  F S     D    E  +RLL+ +   FD L  +   L+   IK + DCY   SGL     + A   H  + M    DM   + L  E   V      +++G + G +  G++G  K  +D+W + V +A+ M S         +P  V    E LK   D  Y   +   GKG E N+YL    +E
Sbjct:  663 EKAQRKAFIETRQCIEARLR---TQRENQQQERLLLSVLPRHVAMEMKDDIAGQPRDTQFHKIYIQRHENVSILFADICGFTS---LSDQCTAEELVRLLNELFARFDRLAAEHHCLR---IKLLGDCYYCVSGLPEPRPDHA---HCAVEM--GLDMIDAIALVRE---VMAVNVNMRVGIHTGRVHCGVLGLVKWQFDVWSNDVTLANHMESGG-------IPGRVHITKETLKC-LDGDYEVEV---GKGNERNSYLKDHQIE 900          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 212.616 bits (540), Expect = 1.008e-55
Identity = 136/383 (35.51%), Postives = 203/383 (53.00%), Query Frame = 1
Query:  490 MLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKR----------------------------------------IRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQV-HGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNR 1509
            +LL LLY +++ ++G     ++   +L+ S V   E I    +      +   G+ +L    ++ G+++   + +R +S FLK+ Q       L+++ A+K ++  I ++MP SV +  +K+                                         R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T+CEKI TLGDCYYCV+GCP P  DHA  CVEMGLGM + I +F ++  E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +   Y  EDG ++    E+V H ++  ++    L+TY +      + RKL S+   ++
Sbjct:  252 VLLGLLYSVLYEALG-----WLHLAQLDESYVGSREGISGTLS------WLGPGKFLLHLCAHVVGIHIFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRSVADELMKQGDEESESSGKRYSAGTCSVAAAAAVTSSSPKSHKRKKNSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTSCEKISTLGDCYYCVAGCPEPLTDHAYCCVEMGLGMIQAIEQFCQEMSETVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSEVTAGFLDDRYEREDGRVI----ERVGHSVTDQLKG---LKTYLI------SGRKLGSQCGCSQ 608          

HSP 2 Score: 187.963 bits (476), Expect = 5.887e-48
Identity = 115/259 (44.40%), Postives = 157/259 (60.62%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEY---VVEKLKLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA+    +       A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL++P +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E    V+ ++   FD  YRGT++VKGKG+M TYL
Sbjct:  990 REFEVSYRLHYHGNVEADKHRIKIQTMRDQADWLLRNIIPIHVAEQL---------KVNQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCVLSRMNYAFD--YRGTVNVKGKGQMRTYL 1233          

HSP 3 Score: 78.1814 bits (191), Expect = 4.536e-14
Identity = 68/223 (30.49%), Postives = 113/223 (50.67%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCV--EMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    +++ N  +S    K  +NV ++FA IV F+     S +   +   +LN+L   FDE  RQ   +N EKI T+G  Y   SG     C      HA  C   +  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + +SE+++ +L R  Y F+
Sbjct: 1003 NVEADKHRIKIQT-MRDQADWLLRNIIPIHVAE----QLKVNQSYS----KNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCVLSRMNYAFD 1216          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: CR339059.2 (pep chromosome:GRCz11:CHR_ALT_CTG3_1_31:9711779:9713274:-1 gene:ENSDARG00000116370.1 transcript:ENSDART00000164250.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR339059.2)

HSP 1 Score: 185.652 bits (470), Expect = 1.686e-51
Identity = 114/267 (42.70%), Postives = 164/267 (61.42%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE-----HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLE 3153
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+K  +  +EKIKTI   YM ASGLN+   +  SD+     HL+ L  F+ +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E  Y V    + ++F YRGT++VKGKG+M TYL  +S +
Sbjct:   21 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNT---QQCSDQNHPHAHLRALFEFSLEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLS-GMDYEFDYRGTVNVKGKGQMKTYLYPKSAD 270          

HSP 2 Score: 72.7886 bits (177), Expect = 4.319e-13
Identity = 63/215 (29.30%), Postives = 105/215 (48.84%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSG-----CPIPRIDHA--ISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E            +  Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R++   N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V +SE++Y ++
Sbjct:   34 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--------KVTQSYSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNTQQCSDQNHPHAHLRALFEFSLEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 239          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: CR339059.1 (pep chromosome:GRCz11:3:9737490:9738985:-1 gene:ENSDARG00000103847.2 transcript:ENSDART00000160102.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR339059.1)

HSP 1 Score: 185.652 bits (470), Expect = 1.686e-51
Identity = 114/267 (42.70%), Postives = 164/267 (61.42%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE-----HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLE 3153
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+K  +  +EKIKTI   YM ASGLN+   +  SD+     HL+ L  F+ +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E  Y V    + ++F YRGT++VKGKG+M TYL  +S +
Sbjct:   21 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNT---QQCSDQNHPHAHLRALFEFSLEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLS-GMDYEFDYRGTVNVKGKGQMKTYLYPKSAD 270          

HSP 2 Score: 72.7886 bits (177), Expect = 4.319e-13
Identity = 63/215 (29.30%), Postives = 105/215 (48.84%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSG-----CPIPRIDHA--ISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E            +  Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R++   N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V +SE++Y ++
Sbjct:   34 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQL--------KVTQSYSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKSDFSNIEKIKTIGATYMAASGLNTQQCSDQNHPHAHLRALFEFSLEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 239          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 187.963 bits (476), Expect = 1.823e-48
Identity = 115/259 (44.40%), Postives = 157/259 (60.62%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEY---VVEKLKLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA+    +       A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL++P +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E    V+ ++   FD  YRGT++VKGKG+M TYL
Sbjct:  532 REFEVSYRLHYHGNVEADKHRIKIQTMRDQADWLLRNIIPIHVAEQL---------KVNQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFN-KNMLG-FKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCVLSRMNYAFD--YRGTVNVKGKGQMRTYL 775          

HSP 2 Score: 77.7962 bits (190), Expect = 5.229e-14
Identity = 68/223 (30.49%), Postives = 113/223 (50.67%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCV--EMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            N EA   R+K+Q+ ++ Q  W+   I+P  V E    +++ N  +S    K  +NV ++FA IV F+     S +   +   +LN+L   FDE  RQ   +N EKI T+G  Y   SG     C      HA  C   +  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + +SE+++ +L R  Y F+
Sbjct:  545 NVEADKHRIKIQT-MRDQADWLLRNIIPIHVAE----QLKVNQSYS----KNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRQPAFSNVEKIKTIGATYMAASGLNGQQCQEQPHPHAHLCALFDFALEMMRVVDDFNKNMLGFKFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCVLSRMNYAFD 758          
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Match: adcy1a (adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070705-302])

HSP 1 Score: 186.422 bits (472), Expect = 1.414e-47
Identity = 95/246 (38.62%), Postives = 151/246 (61.38%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +    +LL  + ++G+++R      ++ AFL+     + RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI++ T   +   Y  E G
Sbjct:  207 LVANAVLLVGVNLSGVFVRVRTERAQRKAFLQARNCIQQRLQLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMMEAGGLPGKVHITKATLECLNGDYEVEPG 450          

HSP 2 Score: 150.984 bits (380), Expect = 1.480e-36
Identity = 100/271 (36.90%), Postives = 141/271 (52.03%), Query Frame = 1
Query: 2338 LFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLV 3138
            LF   L+++   R+ +  +RL++    +AE    +        + +L+N++P  V +  +    S+   M   Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L+ K  Y  +EKIKTI   YM A GL        + +   HL  +  +A +M   L   N Q+      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   L  Y+DF  RG +SVKGKG+M TY +
Sbjct:  786 LFSGALVLH--CRQLDLKLRLDYLWATQAEEERDDMERVKLDNKRILFNLLPAHVAQHFL---LSNPRNMDLYY-QSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDALMDKECYRDIEKIKTIGSTYMAAVGLVPTEGSKVKKSISAHLCTVADYAIEMFDVLDAINYQSY---NDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVFRLLSGYYDFNCRGQVSVKGKGQMLTYFL 1046          

HSP 3 Score: 72.4034 bits (176), Expect = 2.640e-12
Identity = 64/270 (23.70%), Postives = 127/270 (47.04%), Query Frame = 1
Query:  610 FRTKIFEEYYYITGQCILLFLMYMTG---LYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-KRIRNNDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFD---EQGRQTNCEKIGTLGDCYYCVSGCPIP----RIDHAISC-----VEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTF 1359
            +R  +   +++  G   +L ++  +G   L+ R  + ++ +  +L   Q  E R  M+         +  ++P+ V ++FL    RN D+    Y +++  V +LFA I  F      +  N    + + LLN++   FD   ++    + EKI T+G  Y    G  +P    ++  +IS       +  + M  ++   N     +  +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + ++ED + L+   Y F
Sbjct:  764 YRKAVGGGFFHTHGYDPVLAMLLFSGALVLHCRQLD-LKLRLDYLWATQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLLSNPRNMDL----YYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDALMDKECYRDIEKIKTIGSTYMAAVGL-VPTEGSKVKKSISAHLCTVADYAIEMFDVLDAINYQSYNDFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVFRLLSGYYDF 1027          

HSP 4 Score: 51.6026 bits (122), Expect = 6.305e-6
Identity = 49/210 (23.33%), Postives = 84/210 (40.00%), Query Frame = 1
Query: 2380 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3003
             E+  R  F   R    +  +    N+  E LL +++P+ V  E+  + +    E  F   Y     N  ++FA I  F S          +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   V      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:  228 TERAQRKAFLQARNCIQQRLQLEDENEKQERLLMSLLPRNVAMEM-KEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTS---LASQCTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKADHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANMM 422          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY9 (adenylate cyclase 9 [Source:NCBI gene;Acc:100126441])

HSP 1 Score: 217.238 bits (552), Expect = 4.171e-57
Identity = 128/364 (35.16%), Postives = 198/364 (54.40%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFE-EYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILS-----IMKEQVHGI 1407
            ++S+ V ++LL+YT+  +   +   L + Y ++F + G +FR +                  R F   +    ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+  +                            +F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM   I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  ED  ++      +  +Q+ G+
Sbjct:  217 SFSICVEVLLLLYTVMHLPLYLSACLGVAYSILFETFGYHFRDE------------------RCFGPLVGRMAHWELLSKALLHICIHAIGVHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQKTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQIVAADQLKGL 560          

HSP 2 Score: 213.001 bits (541), Expect = 1.005e-55
Identity = 173/523 (33.08%), Postives = 263/523 (50.29%), Query Frame = 1
Query: 1651 EFFQNPPINQITLAFKDPQIEYQYLFHTTDQI---EPIQIY-SIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEIT---NKTL---RKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIG--NVISTSSF--SLIKHITTAI------FTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRN-----LLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD--EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            ++F  PPIN ++L F D ++E  Y     +++    P++ + S K +  +D +    +   +L+ A  + P         P + +       ++ F+SL+    +T      L   R++    S  L R ++   +  LP+  VFS   ++    N HY     S  L  ++   N    SS+  S +  I  A         +CP  L +  E   E         +E  ++ R      LL   I   +    F + LLV++L RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ SY+    +AGVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN    + +S    HL+ L  FA +M   +  FN  N +  + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQ  E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  721 DYFFKPPINPLSLNFLDKELETSYRGSYQEEVLRMAPVKTFASAKFSSLLDVLLCF-FIFILLSVACFLKPGTD--PVSPPTLALVLLSVCGLLGFLSLLVSVRMTFYLEDMLLCTRRLLEIISGWLPRHFIGTVLVCLPAAVVFSYLSSD-FYTNIHYTMFLCSALLIPMVQYCNFCQLSSWLRSSLATIAGATMLTLLYLPLCPEKLRLAPETDIEGNMSTSNSSFEAEDNARTEFPFTLLGQEIAVAY----FLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQSYSKNHDDAGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDDFN--NNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQASEESYRVLVKMGYDFDYRGTVNVKGKGQMKTYL 1222          

HSP 3 Score: 62.3882 bits (150), Expect = 5.145e-9
Identity = 60/216 (27.78%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPRID------HAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +   +  EKI T+G  Y   SG  P    D      H  +  E    M  ++  FN +    N  +R+G + G + A +IG  +  +D++   V IA+ ++++G    +  SE++Y +LV+  Y F+
Sbjct:  999 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQSYSKNHDDAGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKMGYDFD 1205          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 189.889 bits (481), Expect = 1.015e-48
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  658 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI+++T   +   Y  E G   E  S +K+  H I           T+F++P   +
Sbjct:   68 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPGYGHERNSFLKK--HNI----------ETFFIVPSHRR 331          

HSP 2 Score: 146.362 bits (368), Expect = 4.481e-35
Identity = 98/261 (37.55%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 2371 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLV 3138
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +    S+   M   Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG +SVKGKGEM TY +
Sbjct:  652 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFL---MSNPRNMDL-YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTYFL 904          

HSP 3 Score: 71.2478 bits (173), Expect = 8.090e-12
Identity = 63/267 (23.60%), Postives = 122/267 (45.69%), Query Frame = 1
Query:  601 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-KRIRNNDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRI---------DHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR 1344
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL    RN D+    Y +++  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P            H  +  +  + M  ++ + N        +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + ++ED + +++
Sbjct:  618 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL----YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 879          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 190.274 bits (482), Expect = 1.267e-48
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  658 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI+++T   +   Y  E G   E  S +K+  H I           T+F++P   +
Sbjct:  202 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPGYGHERNSFLKK--HNI----------ETFFIVPSHRR 465          

HSP 2 Score: 146.747 bits (369), Expect = 4.296e-35
Identity = 98/261 (37.55%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 2371 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLV 3138
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +    S+   M   Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG +SVKGKGEM TY +
Sbjct:  779 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFL---MSNPRNMDL-YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTYFL 1031          

HSP 3 Score: 71.2478 bits (173), Expect = 9.159e-12
Identity = 63/267 (23.60%), Postives = 122/267 (45.69%), Query Frame = 1
Query:  601 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-KRIRNNDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRI---------DHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR 1344
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL    RN D+    Y +++  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P            H  +  +  + M  ++ + N        +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + ++ED + +++
Sbjct:  745 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL----YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 1006          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: ADCY1 (adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:100492373])

HSP 1 Score: 189.889 bits (481), Expect = 1.342e-48
Identity = 104/278 (37.41%), Postives = 164/278 (58.99%), Query Frame = 1
Query:  658 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG---EILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            IL   + ++G+++R      ++ AFL+     E RL+++   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI+++T   +   Y  E G   E  S +K+  H I           T+F++P   +
Sbjct:  205 ILFVSVNLSGVFVRILTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKNTLECLNGDYEVEPGYGHERNSFLKK--HNI----------ETFFIVPSHRR 468          

HSP 2 Score: 146.747 bits (369), Expect = 4.539e-35
Identity = 98/261 (37.55%), Postives = 136/261 (52.11%), Query Frame = 1
Query: 2371 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE---HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLV 3138
            +R+ +  +RL++    +AE    +        + +L+N++P  V +  +    S+   M   Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD L++K  Y  +EKIKTI   YM A GL       A      HL  L  F+ +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   LK   ++F  RG +SVKGKGEM TY +
Sbjct:  789 SRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFL---MSNPRNMDL-YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGLVPTTGTKAKKSIYSHLSTLADFSIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQ-GKIQVTEDVHRILKSCNYEFVCRGKVSVKGKGEMLTYFL 1041          

HSP 3 Score: 71.2478 bits (173), Expect = 9.188e-12
Identity = 63/267 (23.60%), Postives = 122/267 (45.69%), Query Frame = 1
Query:  601 IRRFRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-KRIRNNDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRI---------DHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR 1344
            I  +R  +  +  Y+ G + IL  L++   L L      ++ +  +L   Q  E R  M+         +  ++P+ V ++FL    RN D+    Y +++  V ++FA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P            H  +  +  + M  ++ + N        +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + ++ED + +++
Sbjct:  755 ISGYRKTLGGDTSYMRGYEPILAILLFSCSLALHSRQVDLKLRLDYLWAVQAEEERDDMERVKLDNKRILFNLLPAHVAQHFLMSNPRNMDL----YYQSYSQVGVMFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMEKECYKDIEKIKTIGSTYMGAVGL-VPTTGTKAKKSIYSHLSTLADFSIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVQGKIQVTEDVHRILK 1016          
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Match: crabp2 (cellular retinoic acid binding protein 2 [Source:Xenbase;Acc:XB-GENE-959098])

HSP 1 Score: 182.956 bits (463), Expect = 1.636e-46
Identity = 90/227 (39.65%), Postives = 137/227 (60.35%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAG 1305
            I  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G
Sbjct:  291 IVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHKIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPG 517          

HSP 2 Score: 98.5969 bits (244), Expect = 3.483e-20
Identity = 63/167 (37.72%), Postives = 95/167 (56.89%), Query Frame = 1
Query: 2695 LLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTYLVVRSLEKPFLYLK 3174
            LL +  +  +EKIKTI   YM  SGL+ + ++      HL  +  F+  ++  ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F+YRG I VKG    +G++ TY ++  ++   L L+
Sbjct:  732 LLGEERFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCAVADFSIALNESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEDTYLILKER-GFAFEYRGEIYVKGISEQEGKIKTYFLLGRVQPNPLILQ 893          

HSP 3 Score: 74.7146 bits (182), Expect = 7.793e-13
Identity = 48/169 (28.40%), Postives = 85/169 (50.30%), Query Frame = 1
Query: 1015 RQTNCEKIGTLGDCYYCVSG-------CPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRH-AYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSR 1494
            R  + EKI T+G  Y  VSG       C   +  H  +  +  + +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + EDTYL+++   + FE  GEI          + G+ ++   ++TYF++     N   LQ R
Sbjct:  737 RFQDIEKIKTIGSTYMAVSGLSPEKQQCE-DKWGHLCAVADFSIALNESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEDTYLILKERGFAFEYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPLILQPR 895          

HSP 4 Score: 55.8398 bits (133), Expect = 4.635e-7
Identity = 51/243 (20.99%), Postives = 104/243 (42.80%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-----YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQ-VPEYVVEKL 3063
            + + YL+   ++   L      EA +R       N+  E L+ +++P+ V  E++    +  +E         Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL    ++     H    +     M   +R    +     +   ++IG + G +  G++G  K  +D+W   V++A+++ S     +SI  +P ++ + L
Sbjct:  306 IFISYLSDRAQRQAFLETRRCVEARLR---LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHKIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRQD-----HAHCCVEMGLSMIKTIRYVRSRT---KHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGNSINLLPNHLAQAL 531          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 225.328 bits (573), Expect = 9.828e-60
Identity = 128/363 (35.26%), Postives = 201/363 (55.37%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGI 1407
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG ++     S++ +Q+ G+
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGL 566          

HSP 2 Score: 196.438 bits (498), Expect = 1.497e-50
Identity = 115/257 (44.75%), Postives = 159/257 (61.87%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 63.929 bits (154), Expect = 1.223e-9
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 225.328 bits (573), Expect = 9.828e-60
Identity = 128/363 (35.26%), Postives = 201/363 (55.37%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGI 1407
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG ++     S++ +Q+ G+
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGL 566          

HSP 2 Score: 196.438 bits (498), Expect = 1.497e-50
Identity = 115/257 (44.75%), Postives = 159/257 (61.87%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 63.929 bits (154), Expect = 1.223e-9
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy9 (adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108450])

HSP 1 Score: 218.394 bits (555), Expect = 1.049e-57
Identity = 117/291 (40.21%), Postives = 170/291 (58.42%), Query Frame = 1
Query:  634 YYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGI 1407
            ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG ++     S++ +Q+ G+
Sbjct:   41 HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGL 329          

HSP 2 Score: 196.052 bits (497), Expect = 1.278e-50
Identity = 115/257 (44.75%), Postives = 159/257 (61.87%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  761 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1004          

HSP 3 Score: 63.5438 bits (153), Expect = 1.377e-9
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct:  781 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 987          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy8 (adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:1341110])

HSP 1 Score: 193.356 bits (490), Expect = 1.122e-49
Identity = 97/248 (39.11%), Postives = 148/248 (59.68%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +V+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+ T   +   Y  E+G
Sbjct:  319 VLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 566          

HSP 2 Score: 138.272 bits (347), Expect = 1.878e-32
Identity = 100/278 (35.97%), Postives = 145/278 (52.16%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTY-LVVRSLEKPFL 3165
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F YRG I VKG    +G++ TY L+ R    PF+
Sbjct:  880 VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQ-GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFI 1148          

HSP 3 Score: 103.219 bits (256), Expect = 1.159e-21
Identity = 70/252 (27.78%), Postives = 129/252 (51.19%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSG-------CPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR-HAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN-----KRKLQSRISL 1503
            I+PS V  +FL++ R+N+    +Y ++++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG       C   +  H  +  +  L +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+TYL+++   + F+  GEI          + G+ ++   ++TYF++     N      R+L  + SL
Sbjct:  922 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCE-DKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSL 1160          

HSP 4 Score: 53.1434 bits (126), Expect = 2.136e-6
Identity = 50/229 (21.83%), Postives = 99/229 (43.23%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-----YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + + YL+   ++   L      EA +R       N+  E L+ +++P+ V  E++    +  +E         Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  F     +R   + ++       ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  334 IFISYLSDRAQRQAFLETRRCVEARLR---LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRF-----VRSRTKHDV------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 542          
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Match: Adcy8 (adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:1341110])

HSP 1 Score: 193.356 bits (490), Expect = 1.163e-49
Identity = 97/248 (39.11%), Postives = 148/248 (59.68%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +V+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+ T   +   Y  E+G
Sbjct:  319 VLAQVVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRFVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 566          

HSP 2 Score: 137.887 bits (346), Expect = 1.954e-32
Identity = 100/278 (35.97%), Postives = 145/278 (52.16%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTY-LVVRSLEKPFL 3165
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F YRG I VKG    +G++ TY L+ R    PF+
Sbjct:  910 VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQ-GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFI 1178          

HSP 3 Score: 102.834 bits (255), Expect = 1.215e-21
Identity = 69/251 (27.49%), Postives = 128/251 (51.00%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPI------PRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR-HAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN-----KRKLQSRISL 1503
            I+PS V  +FL++ R+N+    +Y ++++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG          +  H  +  +  L +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+TYL+++   + F+  GEI          + G+ ++   ++TYF++     N      R+L  + SL
Sbjct:  952 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSL 1190          

HSP 4 Score: 53.1434 bits (126), Expect = 2.057e-6
Identity = 50/229 (21.83%), Postives = 99/229 (43.23%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-----YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + + YL+   ++   L      EA +R       N+  E L+ +++P+ V  E++    +  +E         Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  F     +R   + ++       ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  334 IFISYLSDRAQRQAFLETRRCVEARLR---LETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRRDHAHCCVEMGLSMIKTIRF-----VRSRTKHDV------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 542          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P51830|ADCY9_MOUSE (Adenylate cyclase type 9 OS=Mus musculus OX=10090 GN=Adcy9 PE=1 SV=1)

HSP 1 Score: 225.328 bits (573), Expect = 6.874e-59
Identity = 128/363 (35.26%), Postives = 201/363 (55.37%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGI 1407
            ++S+ + ++LL+YT+ ++   + + L ++Y ++F + G +FR +         +                  ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    QT CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG ++     S++ +Q+ G+
Sbjct:  223 SFSICIEVLLLLYTVMQLPLYLSLFLGVVYSVLFETFGYHFRNEDCYPSPGPGAL-----------------HWELLSRALLHVCIHAIGIHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEQTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGRVIERLGQSVVADQLKGL 566          

HSP 2 Score: 196.438 bits (498), Expect = 1.047e-49
Identity = 115/257 (44.75%), Postives = 159/257 (61.87%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+    E     EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  998 REFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 63.929 bits (154), Expect = 8.556e-9
Identity = 59/216 (27.31%), Postives = 100/216 (46.30%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +    + EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYNSIEKIKTIGATYMAASGLNTAQCQEGGHPQEHLRILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|Q9DGG6|ADCY9_CHICK (Adenylate cyclase type 9 OS=Gallus gallus OX=9031 GN=ADCY9 PE=1 SV=1)

HSP 1 Score: 224.557 bits (571), Expect = 1.287e-58
Identity = 137/378 (36.24%), Postives = 203/378 (53.70%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNK 1470
            ++S+ V ++LL+YT+  +   + + L L Y ++F     FR +      L    V                Y+ +  +  L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+  +                            +F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG++     E+V G S +  +   L+TY +   K K
Sbjct:  215 SFSMCVEVLLLLYTVMHLPLYLSLFLGLSYSVLF-ETSAFRDESCTL--LGGGAV----------------YWELLSKAFLHVCIHAIGIHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSTSSPKNRKKKPSIQKTPIIFRPFKMQQIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEDTKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKV----TERV-GQSAVADQLKGLKTYLISGQKVK 566          

HSP 2 Score: 193.741 bits (491), Expect = 6.795e-49
Identity = 168/541 (31.05%), Postives = 271/541 (50.09%), Query Frame = 1
Query: 1651 EFFQNPPINQITLAFKDPQIEYQYLFHTTDQI---EPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLM-------YKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIG--NVISTSSF--SLIKHITTAIF------TICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQ-----------------LFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYLVVRSLE 3153
            ++F  PPI++++L F D  +E  Y     +++    P++ ++  +A F   +   + TT  L  +     ++       P   V  ++  +++  +SL+       +  E+   T +++    S  L R +L   + SLP++ VFS F ++  + N HY        L A++   N    SS+  SL+  +  A+       ++CP   +   E  H             L+  +NL + +  C  S                   +F + LLV++L R  E + RL+++   EA++   +        +S + NIIP  V  E+         +++ SY+    + GVIFA I NF S +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   + ++  H  L+ L  FA +M   +  FN  N +  + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +    C  IQV E     L K+ +DF YRGT++VKGKG+M TYL  + ++
Sbjct:  722 DYFFKPPISKLSLNFLDQDLEMAYRTSYQEEVMRNAPVKTFA--SATFSSLLDVFLSTTVFLILSVTCFLKHGMVASPPPPAAVVVFVIAILLEVLSLVISVRMVFFLEEVMACT-KRLLELISGWLPRHFLGAILVSLPALAVFSHFTSD-FETNIHYTMFMCCAILIAIVQYCNFCQLSSWMRSLLATVVGAVLLILLYVSLCPDSSV---ETLH-------------LDLAQNLSSRKSPCNSSMPADVKRPADLIGQEVILAVFLLLLLVWFLNRSFEVSYRLHYHGDVEADLHRTKIQSMRDQPDSCVRNIIPYHVADEL---------KVSQSYSKNHDSGGVIFASIVNF-SEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSSIEKIKTIGATYMAASGLNTSQCQDSNHPHGHLQTLFEFAKEMMRVVDDFN--NNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTIGVEC-RIQVSEETYRILSKMGYDFDYRGTVNVKGKGQMKTYLYPKCMD 1229          

HSP 3 Score: 61.2326 bits (147), Expect = 4.966e-8
Identity = 56/215 (26.05%), Postives = 96/215 (44.65%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRID-------HAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS        +  I+P  V +            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +         H  +  E    M R++  FN +    N  +R+G + G + A +IG  +  +D++   V IA+ +++ G    + +SE+TY +L +  Y F+
Sbjct: 1000 RTKIQSMRDQPDSCVRNIIPYHVADEL--------KVSQSYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPHYSSIEKIKTIGATYMAASGLNTSQCQDSNHPHGHLQTLFEFAKEMMRVVDDFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTIGVECRIQVSEETYRILSKMGYDFD 1206          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|O60503|ADCY9_HUMAN (Adenylate cyclase type 9 OS=Homo sapiens OX=9606 GN=ADCY9 PE=1 SV=4)

HSP 1 Score: 223.402 bits (568), Expect = 2.935e-58
Identity = 132/387 (34.11%), Postives = 207/387 (53.49%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKR 1479
            ++S+ + ++ L+YT+  +   + + L + Y ++F + G +FR    ++          L             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+                                F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM + I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  EDG+++     S++ +Q+ G          L+TY +   + K  R
Sbjct:  223 SFSMCIEVLFLLYTVMHLPLYLSLCLGVAYSVLFETFGYHFR----DEACFPSPGAGAL-------------HWELLSRGLLHGCIHAIGVHLFVMSQVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDEESENSVKRHATSSPKNRKKKSSIQKAPIAFRPFKMQQIEEVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRADHAYCCIEMGLGMIKAIEQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEATAKYLDDRYEMEDGKVIERLGQSVVADQLKG----------LKTYLISGQRAKESR 580          

HSP 2 Score: 199.519 bits (506), Expect = 9.837e-51
Identity = 166/528 (31.44%), Postives = 259/528 (49.05%), Query Frame = 1
Query: 1651 EFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAF-----------ISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIG--NVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSF--QLFQICLLV---------------YYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMAS--DEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            ++F  PPINQ +L F D ++E  Y   T+ Q E I+   +K   F     S +    + T  ++ +      K+ +  +        V  A            I +++  E      +++  + +  L R  +   + SLP++ V+S   +E  + N H+     S  L A++   N    SS+  ++     +    P+ L+  +  P              L+  +N  + R  C  S    L +   L+               ++L RE E + RL+++   EA++   +       A+ LL NIIP  V +++         +++ +Y+    + GVIFA I N FS +Y E+Y+GG+   R+L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN+   +  S   EHL+IL  FA +M   +  FN  N +  + F L++G+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQV E     L K+ +DF YRGT++VKGKG+M TYL
Sbjct:  740 DYFFKPPINQFSLNFLDQELERSY--RTSYQEEVIKNSPVKT--FASPTFSSLLDVFLSTTVFLTLSTTCFLKYEAATVPPPPAALAVFSAALLLEVLSLAVSIRMVFFLEDVMACTKRLLEWIAGWLPRHCIGAILVSLPALAVYSHVTSE-YETNIHFPVFTGSAALIAVVHYCNFCQLSSW--MRSSLATVVGAGPLLLLYVSLCPDSSVLT------SPLDAVQNFSSERNPCNSSVPRDLRRPASLIGQEVVLVFFLLLLLVWFLNREFEVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQTYSKNHDSGGVIFASIVN-FSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFN--NNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQVSEESYRVLSKMGYDFDYRGTVNVKGKGQMKTYL 1241          

HSP 3 Score: 64.6994 bits (156), Expect = 5.104e-9
Identity = 59/216 (27.31%), Postives = 101/216 (46.76%), Query Frame = 1
Query:  760 RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRI-------DHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y +LN+L   FDE   +   ++ EKI T+G  Y   SG    +        +H     E    M R++  FN +    N  +RVG + G + A +IG  +  +D++   V IA+ ++++G    + +SE++Y +L +  Y F+
Sbjct: 1018 RTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQTYSKNHDSGGVIFASIVNFSEFYEENYEGGKECYRVLNELIGDFDELLSKPDYSSIEKIKTIGATYMAASGLNTAQAQDGSHPQEHLQILFEFAKEMMRVVDDFNNNMLWFNFKLRVGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQVSEESYRVLSKMGYDFD 1224          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P98999|ADCY9_XENLA (Adenylate cyclase type 9 OS=Xenopus laevis OX=8355 GN=adcy9 PE=1 SV=2)

HSP 1 Score: 216.468 bits (550), Expect = 4.467e-56
Identity = 128/363 (35.26%), Postives = 198/363 (54.55%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIG-NFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNND--------------------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILS-----IMKEQVHGI 1407
            ++S+ V ++LL+YT+  +   +   L + Y ++F + G +FR      +   V  V  +             ++ +  + +L   ++  G++L   + +R +S FLK+ Q+      L+++ A+K ++  I ++MP  + ++ +K+  +                            +F     +  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD    +T CEKI TLGDCYYCV+GCP PR DHA  C+EMGLGM   I +F ++ KE VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VHISE T   +   Y  ED  ++      +  +Q+ G+
Sbjct:  217 SFSICVEVLLLLYTVMHLPLYLSACLGVAYSILFETFGYHFR-----DESCFVLLVGRMA------------HWELLSKALLHVCIHAIGVHLFIMSEVRSRSTFLKVGQSIMHGKDLEVEKALKERM--IHSVMPRIIADDLMKQGDDESENSVKRHSASSPKSRKKKSSIQKTPIIFRPFKMQRIEQVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEETKCEKISTLGDCYYCVAGCPEPRPDHAYCCIEMGLGMIEAIDQFCQEKKEMVNMRVGVHTGTVLCGILGMRRFKFDVWSNDVNLANLMEQLGVAGKVHISEKTARYLDDRYLMEDSMVVERLGQIVAADQLKGL 560          

HSP 2 Score: 214.157 bits (544), Expect = 2.088e-55
Identity = 166/517 (32.11%), Postives = 262/517 (50.68%), Query Frame = 1
Query: 1651 EFFQNPPINQITLAFKDPQIEYQYLFHTTDQI---EPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLM-------YKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIG--NVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEG-------CYEILEHFRNLLN-VRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD--EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTY 3132
            ++F  PPIN ++L F D ++E  Y     +++    P++ ++      +  +    +   +L+ A ++ P         P + +       ++ F+SL+       Y  ++   T R++    S  + R ++   +  LP+  +FS   ++   D  HY     S  L  ++   N    SS +L+    T    +  IYL +  + P       +E         YE L++ R  L   R+    +   F + LLV++L RE + + RL+++   EA++   +       A+ LL NIIP  V +++         +++ SY+    +AGVIFA I NF S +Y E+Y+GG+   R L+ +I  FD LL KP Y  +EKIKTI   YM ASGLN    + +S    HL+ L  FA +M   +  FN  N +  + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  IQ  E     L K+ +DF YRGT++VKGKG+M TY
Sbjct:  732 DYFFKPPINPLSLNFLDKELETSYRASYQEEVIRMAPVKTFASATFSSLQDVLLNYFIFVLLSVACLLKPGTN--TVSPPTLALVLLSVCGLLGFLSLLVSVRMAFYLEDMLLCT-RRLLEIISGWVPRHFIGTVLVCLPAAVIFSYLSSDFYTD-IHYTMFLCSALLIPMVQYCNFCQLSSSALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTELPFTRLGQEIAVAYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQSMRDQADWLLRNIIPYHVAEQL---------KVSQSYSKNHDDAGVIFASIVNF-SEFYEENYEGGKECYRALNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFN--NNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RIQASEESYRVLVKMGYDFDYRGTVNVKGKGQMKTY 1231          

HSP 3 Score: 62.003 bits (149), Expect = 3.127e-8
Identity = 94/368 (25.54%), Postives = 165/368 (44.84%), Query Frame = 1
Query:  352 AMVIICMTYTVLLGTDSSEL-MELNYSL----VVLIILLMYTLFRMKFMVVMLLSL-----LYILIFVSIGNFR--IKYVEQKELNVSTV-SDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-PIPRID------HAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
              V++C+   V+    SS+   +++Y++     +LI ++ Y  F       +LL+      + ILI++ +   R  +      E N+ST  S  E++   RT++    +   GQ I +   ++  L + F N     S  L    + EA   R K+QS ++ Q  W+   I+P  V E            S  Y K  ++  ++FA IV F+     N    +  Y  LN+L   FDE   +   +  EKI T+G  Y   SG  P    D      H  +  E    M  ++ +FN +    N  +R+G + G + A +IG  +  +D++   V IA+ ++++G    +  SE++Y +LV+  Y F+
Sbjct:  861 GTVLVCLPAAVIFSYLSSDFYTDIHYTMFLCSALLIPMVQYCNFCQLSSSALLLATITGATMLILIYLPLCPQRPPLDPGTDIEANLSTSNSSYETLDNPRTEL---PFTRLGQEIAV-AYFLLLLLVWFLNREFDVSYRLHYHGDVEADLHRTKIQS-MRDQADWLLRNIIPYHVAEQL--------KVSQSYSKNHDDAGVIFASIVNFSEFYEENYEGGKECYRALNELIGDFDELLSKPHYSCIEKIKTIGATYMAASGLNPSQCQDSSQPHRHLQTLFEFAKEMMSVVDEFNNNMLWFNFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRIQASEESYRVLVKMGYDFD 1215          
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Match: sp|P40145|ADCY8_HUMAN (Adenylate cyclase type 8 OS=Homo sapiens OX=9606 GN=ADCY8 PE=1 SV=1)

HSP 1 Score: 194.512 bits (493), Expect = 3.153e-49
Identity = 97/248 (39.11%), Postives = 148/248 (59.68%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRN------NDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ + +   ++ AFL+  +  EARL++++  + Q   + +++P  V    +  + N         F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +V+MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+ T   +   Y  E+G
Sbjct:  321 VVAQAVLFMCMNTAGIFISYLSDRAQRQAFLETRRCVEARLRLETENQRQERLVLSVLPRFVVLEMINDMTNVEDEHLQHQFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRQDHAHCCVEMGLSMIKTIRYVRSRTKHDVDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKATLDCLNGDYNVEEG 568          

HSP 2 Score: 137.887 bits (346), Expect = 1.517e-31
Identity = 100/278 (35.97%), Postives = 145/278 (52.16%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKG----KGEMNTY-LVVRSLEKPFL 3165
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++   GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  F+  +   ++  N+ +      F L+IG + G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE  Y++ K +  F F YRG I VKG    +G++ TY L+ R    PF+
Sbjct:  912 VFYHGQQLEYTARLDFLWRVQAKEEINEMKELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSF---NNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-VSGRIQVPEETYLILKDQ-GFAFDYRGEIYVKGISEQEGKIKTYFLLGRVQPNPFI 1180          

HSP 3 Score: 103.219 bits (256), Expect = 8.435e-21
Identity = 69/251 (27.49%), Postives = 128/251 (51.00%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPI------PRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR-HAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN-----KRKLQSRISL 1503
            I+PS V  +FL++ R+N+    +Y ++++ V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG          +  H  +  +  L +   I + NK    N  +R+GI  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+TYL+++   + F+  GEI          + G+ ++   ++TYF++     N      R+L  + SL
Sbjct:  954 ILPSHVARHFLEKDRDNEE---LYSQSYDAVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFSLALTESIQEINKHSFNNFELRIGISHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGVSGRIQVPEETYLILKDQGFAFDYRGEIY---------VKGISEQEGKIKTYFLLGRVQPNPFILPPRRLPGQYSL 1192          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A4S2M9J2 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_001674 PE=4 SV=1)

HSP 1 Score: 628.246 bits (1619), Expect = 0.000e+0
Identity = 374/880 (42.50%), Postives = 520/880 (59.09%), Query Frame = 1
Query:  649 GQCILLF-LMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL---KRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIP---------DKNKNKRKLQSRISL---------------------NRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLM----YKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSL---FQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE----HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSL 3150
            GQ ILL  L+Y+  +Y+  +N +RR+  F +LA N   R  M  A+  +I WIEAIMPS V   F    K+  NND    VY KA +NV+ILFAD+VGFT MSSNKTA QLV LLNDL++RFDE  + T+CEKIGTLGDCYYCV+GCP PR DHA SCVEMGLGMCR+I  FN DH E VNMRVGIH+GRV AAIIG  RFR+DV+SYDV IAN++ESSGR G VHISE+T+  V+H Y    GE L + KE++ GI+GM      ++TYFV P         +K   K  ++S+ S                       R+++ + +++  +    + +   K   E  +  ++++  LQ DPER + FF+ PP++     F + +IE+ Y  H+ +   P  I + KA+   D+    +    +LT   V+    V F+    IIY   +   + + F  L+    Y+ ++    L+ ++   S    +  +   +   P+++  +L     +  +   + YI  +L+     LI + +  SS  L + ++      C I LI+ TE    HE   +E C    E  + +    ++    F++    +L+  +ARENE+  RL FY TRE  I +  +  A + A+ LL+NIIP+ +++E+        +  +FSYA +  N GV FACISNFFS YYREDYKGGE +LRLL++IICTFD LL++P    +EKIKTINDCYM+A+GLN  ++ +  +E    HL  LM +   +   L  FN++ I+GT  F +KIGYNFGP+TAGIIGT+KP YDIWGDTVNVASRMYST  P    IQVPE V+  L+ YFDF YRG I VKGKG+M TY+  + L
Sbjct:  239 GQEILLCALIYLVAVYVAMWNQLRRRFVFNRLATNVRMRKAMTKALDDKIRWIEAIMPSQVTAEFYQLYKQYSNNDSHMWVYNKALDNVTILFADMVGFTRMSSNKTATQLVMLLNDLFSRFDELCQLTHCEKIGTLGDCYYCVAGCPEPRADHAESCVEMGLGMCRIIKVFNYDHSEQVNMRVGIHTGRVNAAIIGKQRFRYDVYSYDVSIANAMESSGRPGRVHISEETFERVKHVYNVSCGEDLYVKKEEMLGIAGMALAERAMKTYFVDPRSSLIRRRHEKFGKKTNVRSKASWIAQLDDDSDSSSSVEDNGCETKRDSTIRRSKQPFRTPLSRCREKNKDDLEHLERQIELIHDLQTDPERQIAFFRVPPLHPYLFQFLNAEIEWHYRHHSREIRAPTYIDAKKASSIADACVLAIVNVIVLTICTVIQVVCVDFETVDLIIYTCVFATAIALFFALLLSATFYQDQLKPGWLKAIHRILSGLFVQEVILSVLCLCPTLYFLNLRYSLGDRVLFSEHTYIAVHLAGV--CLIVHCLPISSAYLGRTVS------CLITLII-TEFISSHE-TAVELCVLKSEDVKQISWWSVRYLLLFEMLFSFVLITRIARENERISRLCFYVTREMSIASDLSQIAEQDAQKLLFNIIPEYIYRELKCAGQGDLSHGSFSYAVSLQNVGVSFACISNFFSGYYREDYKGGEASLRLLNSIICTFDELLERPELKDVEKIKTINDCYMVAAGLN--YQAIKKNENKQSHLISLMHYCHLLKESLDEFNDKYIIGTENFVVKIGYNFGPVTAGIIGTTKPFYDIWGDTVNVASRMYSTGLP--GEIQVPETVIPVLEYYFDFHYRGDIFVKGKGDMRTYVCKKKL 1104          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A2H1CUG7 (Adenylate/guanylate cyclase catalytic domain protein OS=Fasciola hepatica OX=6192 GN=D915_01279 PE=4 SV=1)

HSP 1 Score: 621.698 bits (1602), Expect = 0.000e+0
Identity = 385/977 (39.41%), Postives = 546/977 (55.89%), Query Frame = 1
Query:  364 ICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFR---TKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFS---LVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQ----------------------------SRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIP-----------QNVG-FKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSI-FVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNS--DHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVR 3144
            IC +  VL+  DS         +V  +ILL  +        VM  +L +++ +    +  +     ++   ++  D ++ RR+    T  F+ Y     + IL  L ++  +Y+ F+N +RR+  F +L+++   R ++Q+A+  ++ WIEAIMP+ V   + +  R N+       VY +AF+ VSILFADIVGFT MSSNK+A Q+V LLNDL++RFDE    T CEKIGTLGDCYYCVSGCP PR +HA  CVEMGLGMCR+I  FN DH+E VNMRVG+H+GRV AAIIG+ RFR+DV+SYDVI+AN +ESSGR G VHISE TY LV+  Y    GE + I +E+  GI+GM   +V +RTYFV P  +  +R+ +                             R+ + +N +     +S  I     K + K +  + + D++ ++ LQ DPE+ ++   +PP+N + L F + +IE+ Y  H+     P  I S+K  +  D++A        LT A++MI            +  G +  Y     +   +   +I F S +Y  ++ ++ LR++Y   +H   R  L   +SSLP+I FV         Q+    I     L    ++ + I  SS +  + I   I   C I    R  +P +  F     C +  +         ++     +L    ++V  + R+NE+N RL FY TREAEI N  +    + A+  LYNIIPK V+ E+           +FSYA    NAGV+FAC++NFFS YYREDYKGGE +L LL++IICTFDNLL +P    +EKIKTINDCYM ASGLN           +HL  LM +   +   L  FN+  IVG+  F +KIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST  P    IQV E+V+  L+  F F++RG + VKGKGEM T++  R
Sbjct:  136 ICWSRCVLVRRDSRTFANAFAVIVCSVILLPVSRANAFIFSVMSYALEFLVQYHRNMDLDVNQYGTEQYQNTSWIDFDNFRRYTVLTTADFKSYMKQIAEGILHILAFLIAVYVSFWNGLRRRFVFYRLSKSILLRNEVQTALIDKVRWIEAIMPTQVTAEYHQMQRQNEEAGNNMWVYSRAFDPVSILFADIVGFTKMSSNKSAIQIVTLLNDLFSRFDELCLTTKCEKIGTLGDCYYCVSGCPEPRPNHAQLCVEMGLGMCRIIKVFNCDHQEEVNMRVGVHTGRVNAAIIGSRRFRYDVYSYDVIVANLMESSGRPGRVHISERTYNLVKSVYNVSQGEDVQIKREERSGIAGMALTTVTMRTYFVDPRSSTMRRRHEHFGTHLKLRAVGPDRKDQIENTQLETGPDRLEVPKNFTKFGRIRSSTIGDQYMKTIGKWEIIQLENDIRQIQLLQTDPEKQIDLLNSPPLNPLVLNFLNHEIEWHYRTHSVYYKVPTYIESLKMTVLSDAMA--------LTCAHIMITVICALEHKQSNEWTGIYAMYYISSLLVSGLLWGLILFSSTVYADQLESRLLRQIYLIVAHIYGRECLLALLSSLPTISFVIFRLAITDYQEIMDRIVLLQKLAAVCILIHGIPQSSVTWCRLIC-CIGCSCLIRSTYRI-SPGQSRF-----CIQADDPMIGATMTGLRYLNLLELVFYTVIVNMIGRKNERNCRLCFYVTREAEIVNDLSQRTVQQAQQFLYNIIPKYVYHELQASGHGDLASGSFSYATLVPNAGVMFACVANFFSCYYREDYKGGEGSLTLLNSIICTFDNLLNRPDMKDVEKIKTINDCYMAASGLNQAETRRNFNHRQHLVHLMEYCHLIKESLDQFNDLYIVGSENFVVKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTGLP--GEIQVAEHVITLLEDLFRFEFRGLVFVKGKGEMRTFVCHR 1095          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A183B296 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS13331 PE=4 SV=1)

HSP 1 Score: 620.157 bits (1598), Expect = 0.000e+0
Identity = 376/909 (41.36%), Postives = 530/909 (58.31%), Query Frame = 1
Query:  562 KELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFS---LVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRK---LQSRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXX---------------------------XXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIA---SMVYTTTILTAAYVMIPQNVG-FKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDN--YHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTIC------PIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSD--HEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVR 3144
            +  NV + SD + +  F          I G  IL FL ++ G+Y+  +N IRR+  F +L++N   R   Q+A+  ++ WIEAIMP+ V  +F +  + N+       VY + F+ VSILFADIVGFT MSSNK+A QLV LLNDL++RFDE  + T CEKIGTLGDCYYCVSGCP PR+DHA  CVEMGLGMCR+I  FN DH+E VNMRVG+H+GRV AAIIG  RFR+DV+SYDVI+AN +ESSG+ G VHISE TY LV+  Y    GE + I +E+  GI+G+   +  ++TYFV P  +  +R+    ++ + L    ++ L+E  + +   K + +  ++                             + + D+++++ LQ D ER +  F++PP+N + L F   + E+ Y  HT     P  I S+K A+  DS+A     +  T I   A+ + P   G +  Y   + +   + + ++ F S MY  +  +  L+++Y   +H   R  L   +S+ P+I  F +F+   + ++    YI  + +L    ++ + +  SS +  + I     ++C      P    VR  A  +    GL          R L ++ +  F    LF I L V  +ARE+E+N RL FY TRE+EI +  +    + A+ LL+NIIPK V+ E+      + +  AFSYA    NAGV+FAC++NFFS+YYREDYKGGE AL LL++I+CTFD LL +P    +EKIKTINDCYM A+GLNS          EHL +LM +   +   L  FN   I+GT  F +KIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST  P    IQV E+VV  L  +F F++RG + VKGKG+M TY+  R
Sbjct:  223 RRYNVLSESDFKPVAEF----------IAGA-ILQFLGFLLGIYVDCWNGIRRQIVFYRLSKNVRIRNAAQAALVDKVRWIEAIMPAQVTADFYQIQKRNEEAGKTMWVYNRVFDPVSILFADIVGFTKMSSNKSAIQLVTLLNDLFSRFDELCQLTRCEKIGTLGDCYYCVSGCPEPRVDHAQCCVEMGLGMCRIIKVFNCDHQETVNMRVGVHTGRVNAAIIGAQRFRYDVYSYDVIVANLMESSGQPGRVHISESTYNLVKSVYNVAPGEDMLIKREERSGIAGLALTTKTMKTYFVDPRSSILRRRHERFRAHVQLRAVDTDLLSEPVQIVADTKRETISARRTPSYARFSRGQMSLTGAQHTSIFCQREMARLEQDIELIQNLQTDSERQINLFRSPPLNPLMLNFLHHETEWHYRTHTVHHKVPTYIESLKVAILSDSLALTSVHIVITCICVLAHKLTPDWNGIYAMYYLAVLMFALVLLCLLLFSSTMYADQCQSPQLKQIYLCVAHNYGREVLIALLSTAPTI-SFLIFRQAIVTEHCISDYIGLFENLCWLCVLIHGLPQSSATWCRLICCVTCSVCIHKSYRPTRAQVRFCAWADDFVFGLS--------VRGLRHMHVLDF----LFCIAL-VSIIARESERNCRLCFYVTRESEIASDLSDITVQEAQQLLFNIIPKYVYDELQTNGRENFSGSAFSYATLVPNAGVMFACVANFFSNYYREDYKGGEGALILLNSIMCTFDELLNRPEMKDVEKIKTINDCYMAAAGLNSAAVGRNPNKREHLILLMEYCHLVKEALDQFNALYIIGTDNFTVKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTGLP--GEIQVAEHVVPVLSDFFLFEFRGNVFVKGKGDMRTYVCRR 1104          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A3R7H2B8 (Adenylate cyclase type 3 OS=Clonorchis sinensis OX=79923 GN=ADCY3 PE=4 SV=1)

HSP 1 Score: 619.002 bits (1595), Expect = 0.000e+0
Identity = 382/885 (43.16%), Postives = 519/885 (58.64%), Query Frame = 1
Query:  649 GQCILLF-LMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL---KRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIP------------DKNKNKRKLQSRIS-------------------LNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLM----YKSEITNKTLRKVYSFFSHPLTRLYLSVYISSL----PSIFVFSL---FQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE----HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSL 3150
            GQ ILL  L+Y   +Y+  +N +RR+  F +LA N   R  M  A+  ++ WI+AIMPS V   F    K+   ND    VY KA +NV+ILFAD+VGFT MSSNKTA QLV LLNDL++RFDE  + T+CEKIGTLGDCYYCV+GCP PR DHA SCVEMGLGMCR+I  FN DH E VNMRVGIH+GRV AAIIG  RFR+DV+SYDV IAN++ESSGR G VHISE+T+  V+H Y    GE L + KE++ GI+GM      ++TYFV P             KN N     S I+                     ++++ K +++  +    K +   K   E  +  ++++  LQ DPER + FF+ PP++     F + +IE+ Y  H  +   P  I + KA+   D+    +    +LT   V+    V F     +IY + ++ ++ + F  L+    Y+ ++    L+ ++ F    L+RL++   I S+    P++    L     +  +   Y YI  +  L    LI + +  SS  L + ++     I   ++ +R E P E   +  E     LE F +  +VR    F   LF   +L+  +ARENE+  RL FY TRE  I +  +  A + A+ LL+NIIP+ +++E+        +  +FSYA +  N GV FACISNFFSSYYREDYKGGE +LRLL+ IICTFD LL++P    +EKIKTINDCYM+A+GLN  H+ +  +E    HL  LM +   +   L  FN + I+GT  F +KIGYNFGP+TAGIIGT+KP YDIWGDTVNVASRMYST  P    IQVPE V+  L+ YFDF YRG I VKGKG+M TY+  + L
Sbjct:  239 GQEILLCALIYSVAVYIAMWNQLRRRFVFNRLATNVRMRKAMTKALDDKVRWIQAIMPSQVTAEFYQLYKQYSENDSHMWVYNKALDNVTILFADMVGFTRMSSNKTATQLVMLLNDLFSRFDELCQLTHCEKIGTLGDCYYCVAGCPEPRADHAESCVEMGLGMCRIIKVFNCDHSEQVNMRVGIHTGRVNAAIIGKQRFRYDVYSYDVSIANAMESSGRPGRVHISEETFERVKHVYNVSCGEDLYVKKEEMLGIAGMALTERAMKTYFVDPRSSLIRRRHEKFGKNTNVLSKASWIAQLDDDFDKSSSSAEDDGFETKQDSTIKNSKQPFRTPLSKCREKNKDDLEHLERQIELIHDLQTDPERQIAFFRVPPLHPYLFEFLNAEIEWHYRHHCREIRTPTYIDAKKASSIADACVLAIVNAIVLTVCAVIQIVCVQFDMLDLMIYTSVFVTVITLFFALLLSATFYQDQLKPGLLKAIHRF----LSRLFVQEVILSILCLSPTLCFLDLRRSLGDRVLFSEYTYIAVH--LVGVCLIVHCLPVSSAYLGRTLSCLTTLIITEFMDLR-ETPTELCVLKSED----LEKF-SWWSVRRLLLFEM-LFSF-VLITRIARENERISRLCFYVTREMSIASDLSQIAGQDAQKLLFNIIPEYIYRELKCAGQGDLSAGSFSYAVSLQNVGVSFACISNFFSSYYREDYKGGEASLRLLNGIICTFDGLLEQPEMKDVEKIKTINDCYMVAAGLN--HQAIKKNENKQSHLISLMHYCHLLKESLDEFNNKYIIGTENFVVKIGYNFGPVTAGIIGTTKPFYDIWGDTVNVASRMYSTGLP--GEIQVPETVIPVLEYYFDFHYRGDIFVKGKGDMRTYVCKKKL 1105          
BLAST of Adenylate cyclase type vs. TrEMBL
Match: A0A4E0RZP9 (Adenylate cyclase type OS=Fasciola hepatica OX=6192 GN=D915_000865 PE=4 SV=1)

HSP 1 Score: 618.616 bits (1594), Expect = 0.000e+0
Identity = 375/916 (40.94%), Postives = 524/916 (57.21%), Query Frame = 1
Query:  547 KYVEQKELNVSTVSDLESIRRFR---TKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFS---LVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQ----------------------------SRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIP-----------QNVG-FKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSI-FVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNS--DHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVR 3144
            +Y  ++  N S + D ++ RR+    T  F+ Y     + IL  L ++  +Y+ F+N +RR+  F +L+++   R ++Q+A+  ++ WIEAIMP+ V   + +  R N+       VY +AF+ VSILFADIVGFT MSSNK+A Q+V LLNDL++RFDE    T CEKIGTLGDCYYCVSGCP PR +HA  CVEMGLGMCR+I  FN DH+E VNMRVG+H+GRV AAIIG+ RFR+DV+SYDVI+AN +ESSGR G VHISE TY LV+  Y    GE + I +E+  GI+GM   +V +RTYFV P  +  +R+ +                             R+ + +N +     +S  I     K + K +  + + D++ ++ LQ DPE+ ++   +PP+N + L F + +IE+ Y  H+     P  I S+K  +  D++A        LT A++MI            +  G +  Y     +   +   +I F S +Y  ++ ++ LR++Y   +H   R  L   +SSLP+I FV         Q+    I     L    ++ + I  SS +  + I   I   C I    R  +P +  F     C +  +         ++     +L    ++V  + R+NE+N RL FY TREAEI N  +    + A+  LYNIIPK V+ E+           +FSYA    NAGV+FAC++NFFS YYREDYKGGE +L LL++IICTFDNLL +P    +EKIKTINDCYM ASGLN           +HL  LM +   +   L  FN+  IVG+  F +KIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST  P    IQV E+V+  L+  F F++RG + VKGKGEM T++  R
Sbjct:   28 QYGTEQYQNTSWI-DFDNFRRYTVLTTADFKSYMKQIAEGILHILAFLIAVYVSFWNGLRRRFVFYRLSKSILLRNEVQTALIDKVRWIEAIMPTQVTAEYHQMQRQNEEAGNNMWVYSRAFDPVSILFADIVGFTKMSSNKSAIQIVTLLNDLFSRFDELCLTTKCEKIGTLGDCYYCVSGCPEPRPNHAQLCVEMGLGMCRIIKVFNCDHQEEVNMRVGVHTGRVNAAIIGSRRFRYDVYSYDVIVANLMESSGRPGRVHISERTYNLVKSVYNVSQGEDVQIKREERSGIAGMALTTVTMRTYFVDPRSSTMRRRHEHFGTHLKLRAVGPDRKDQIENTQLETGPDRLEVPKNFTKFGRIRSSTIGDQYMKTIGKWEIIQLENDIRQIQLLQTDPEKQIDLLNSPPLNPLVLNFLNHEIEWHYRTHSVYYKVPTYIESLKMTVLSDAMA--------LTCAHIMITVICALEHKQSNEWTGIYAMYYISSLLVSGLLWGLILFSSTVYADQLESRLLRQIYLIVAHIYGRECLLALLSSLPTISFVIFRLAITDYQEIMDRIVLLQKLAAVCILIHGIPQSSVTWCRLIC-CIGCSCLIRSTYRI-SPGQSRF-----CIQADDPMIGATMTGLRYLNLLELVFYTVIVNMIGRKNERNCRLCFYVTREAEIVNDLSQRTVQQAQQFLYNIIPKYVYHELQASGHGDLASGSFSYATLVPNAGVMFACVANFFSCYYREDYKGGEGSLTLLNSIICTFDNLLNRPDMKDVEKIKTINDCYMAASGLNQAETRRNFNHRQHLVHLMEYCHLIKESLDQFNDLYIVGSENFVVKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTGLP--GEIQVAEHVITLLEDLFRFEFRGLVFVKGKGEMRTFVCHR 925          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 225.328 bits (573), Expect = 6.217e-60
Identity = 139/393 (35.37%), Postives = 216/393 (54.96%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKR----------------------------IRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRN 1512
            +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V +  +K+                             R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +   Y  EDG ++    + V       ++   L+TY +      + +K+ S+ S ++N
Sbjct:  233 FSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSV------TEQLKGLKTYLI------SGKKVSSQCSCSQN 595          

HSP 2 Score: 191.43 bits (485), Expect = 3.596e-49
Identity = 115/257 (44.75%), Postives = 157/257 (61.09%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M + +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGT++VKGKG+M TYL
Sbjct:  925 REFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1168          

HSP 3 Score: 72.0182 bits (175), Expect = 2.706e-12
Identity = 64/215 (29.77%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCV--EMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E  LK  ++       Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + +SE+++ ++
Sbjct:  938 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQ-LKVTQS-------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1143          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 220.32 bits (560), Expect = 2.935e-58
Identity = 139/407 (34.15%), Postives = 216/407 (53.07%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKR------------------------------------------IRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRN 1512
            +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V +  +K+                                           R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +   Y  EDG ++    + V       ++   L+TY +      + +K+ S+ S ++N
Sbjct:  233 FSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRYSATGTGQASASTGPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSV------TEQLKGLKTYLI------SGKKVSSQCSCSQN 609          

HSP 2 Score: 191.43 bits (485), Expect = 5.041e-49
Identity = 115/257 (44.75%), Postives = 157/257 (61.09%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M + +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGT++VKGKG+M TYL
Sbjct:  990 REFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1233          

HSP 3 Score: 72.4034 bits (176), Expect = 2.699e-12
Identity = 64/215 (29.77%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCV--EMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E  LK  ++       Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + +SE+++ ++
Sbjct: 1003 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQ-LKVTQS-------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1208          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy9 (adenylate cyclase 9 [Source:NCBI gene;Acc:103022434])

HSP 1 Score: 220.32 bits (560), Expect = 3.244e-58
Identity = 139/407 (34.15%), Postives = 216/407 (53.07%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKR------------------------------------------IRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRN 1512
            +SL + ++LL+Y++  ++    +LL +LY ++F ++G F + +V+ +E   S++  L                + G+ +L    ++ G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V +  +K+                                           R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +   Y  EDG ++    + V       ++   L+TY +      + +K+ S+ S ++N
Sbjct:  233 FSLCMEVLLLLYSMLHLRLYASVLLGILYSVLFETLGWFHLTHVDGEEEANSSLMQL----------------VLGKVLLHLCAHVIGIHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPQVVADELMKQGDDESENSGKRYSATGTGQASASTGPTSSSSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCELTRCEKISTLGDCYYCVAGCPEPREDHAYCCVEMGLGMIQAIEQFCQETRETVDMRVGVHTGTVLCGILGIKRFKFDVWSNDVNLANLMEQLGMAGKVHLSEATASFLDDRYVREDGRVMERAGQSV------TEQLKGLKTYLI------SGKKVSSQCSCSQN 609          

HSP 2 Score: 191.045 bits (484), Expect = 6.026e-49
Identity = 115/257 (44.75%), Postives = 157/257 (61.09%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDH--EEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYL 3135
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN     E+     HL  L  FA +M + +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  IQV E     L  + + F YRGT++VKGKG+M TYL
Sbjct: 1023 REFEVSYRLHYHGNVEADKHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFN-KNMLG-FQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RIQVSEESHCILSGMNYAFDYRGTVNVKGKGQMRTYL 1266          

HSP 3 Score: 72.0182 bits (175), Expect = 3.273e-12
Identity = 62/215 (28.84%), Postives = 104/215 (48.37%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHAISCV--EMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E            +  Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+   +N EKI T+G  Y   SG     C      HA  C   E  L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    + +SE+++ ++
Sbjct: 1036 NVEADKHRIKIQN-MRDQADWLLRNIIPIHVAEQL--------KVTQSYSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPTFSNVEKIKTIGATYMAASGLNGRQCREQTHPHAHLCALFEFALEMMHVVDDFNKNMLGFQFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRIQVSEESHCIL 1241          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: ENSAMXT00000038087.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:30673120:30684373:-1 gene:ENSAMXG00000033231.1 transcript:ENSAMXT00000038087.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 178.718 bits (452), Expect = 2.438e-49
Identity = 94/231 (40.69%), Postives = 137/231 (59.31%), Query Frame = 1
Query:  685 GLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRI---RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            G+   +   + ++ AF +     +ARL +Q   + Q   + +++P  V       I   + + MF  +Y +  +NVSILFADI GFT ++S  TA +LV  LN+L+ RFD+   + +C +I  LGDCYYCVSG P PR DHA  CVEMG+ M   I    +    NVNMRVGIHSGRV   ++G  +++FDV+S DV +AN +E+ G+AG +HI++ T   +   Y  E G
Sbjct:    3 GICTHYPAEVSQRQAFQETRGYIQARLHLQRENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLASENHCLRIKILGDCYYCVSGLPEPRADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLQYLNGDYEVEPG 233          

HSP 2 Score: 57.7658 bits (138), Expect = 2.760e-8
Identity = 58/235 (24.68%), Postives = 98/235 (41.70%), Query Frame = 1
Query: 2455 NKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLE 3153
            N+  E LL +++P+ V  E+     +   +M F   Y     N  ++FA I  F S          E+ +  L+ +   FD L  +   L+   IK + DCY   SGL     E  +D H    +    DM   + L  E   V      +++G + G +  G++G  K  +D+W + V +A+ M +       I + +  ++    Y +  Y   +     GE N YL   S+E
Sbjct:   35 NQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTS--LASQCTAQELVM-TLNELFARFDKLASENHCLR---IKILGDCYYCVSGL----PEPRAD-HAHCCVEMGVDMIEAISLVRE---VTGVNVNMRVGIHSGRVHCGVLGLRKWQFDVWSNDVTLANHMEAGGK-AGRIHITKATLQ----YLNGDYE--VEPGFGGERNAYLKENSIE 248          
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Match: adcy8 (adenylate cyclase 8 [Source:NCBI gene;Acc:103024991])

HSP 1 Score: 186.037 bits (471), Expect = 1.815e-47
Identity = 96/253 (37.94%), Postives = 148/253 (58.50%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMP-----------SSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +  Q +L   M   G+++ +     ++ AFL+  +  EARL++++  + Q   + +++P           S+V++  L+       F  +Y   +ENVSILFAD+ GFT +S+  +A +LV +LN+L+ RFD    + +C +I  LGDCYYCVSG P PR DHA  CVEMGL M + I       K +++MR+GIHSG V+  ++G  +++FDV+S+DV IAN LES G  G +HIS+     +   Y  E G
Sbjct:  291 LCAQVLLFVCMNTAGVFISYLADRAQRQAFLETRRCIEARLRLETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQH-----QFHRIYIHRYENVSILFADVKGFTNLSTTLSAQELVRMLNELFARFDRLAHEHHCLRIKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRYVRSRTKHDIDMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGGIPGRIHISKAALDCLNGDYEVEAG 538          

HSP 2 Score: 137.117 bits (344), Expect = 3.155e-32
Identity = 97/279 (34.77%), Postives = 145/279 (51.97%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASD-EHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKG----KGEMNTYLVVRSLEKPFLYLK 3174
            V+Y  ++ E   RL+F    +A+    E     +  E++L NI+P  V +  + K     NE    Y+ ++ + GV+FA I  F   Y + +    G   LRLL+ II  FD LL +  +  +EKIKTI   YM  SGL+ + ++      HL  L  FA  ++  ++  N+ +      F L+IG   G + AG+IG  KP YDIWG TVN+ASRM ST      IQVPE     L +  F F+YRG I VKG    +G++ T+ ++  ++   L L+
Sbjct:  889 VFYHGQQLEYTARLDFLWRVQAKEEINEMRELREHNENMLRNILPSHVARHFLEK--DRDNEEL--YSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCEDKWGHLCALADFAIALNESIQEINKHSF---NNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTG-ISGKIQVPEETFTILTERGFAFEYRGEIYVKGISEQEGKIRTHFLMGRVQPNPLILQ 1159          

HSP 3 Score: 101.293 bits (251), Expect = 3.304e-21
Identity = 67/244 (27.46%), Postives = 125/244 (51.23%), Query Frame = 1
Query:  811 IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSG-------CPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE-DGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSR 1494
            I+PS V  +FL++ R+N+    +Y +++++V ++FA I GF    +    N    + + LLN++   FDE   + R  + EKI T+G  Y  VSG       C   +  H  +  +  + +   I + NK    N  +R+G+  G V+A +IG  + ++D++   V +A+ ++S+G +G + + E+T+ +L    + FE  GEI          + G+ ++   +RT+F++     N   LQ R
Sbjct:  931 ILPSHVARHFLEKDRDNEE---LYSQSYDSVGVMFASIPGFADFYSQTEMNNQGVECLRLLNEIIADFDELLGEDRFQDIEKIKTIGSTYMAVSGLSPEKQQCE-DKWGHLCALADFAIALNESIQEINKHSFNNFQLRIGMAHGSVVAGVIGAKKPQYDIWGKTVNLASRMDSTGISGKIQVPEETFTILTERGFAFEYRGEIY---------VKGISEQEGKIRTHFLMGRVQPNPLILQPR 1161          

HSP 4 Score: 53.1434 bits (126), Expect = 1.990e-6
Identity = 52/229 (22.71%), Postives = 100/229 (43.67%), Query Frame = 1
Query: 2353 LLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNE---MAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            + + YLA   ++   L      EA +R       N+  E L+ +++P+ V  E++    +  +E     F   Y H + N  ++FA +  F +          +  +R+L+ +   FD L  +   L+   IK + DCY   SGL     DH     +  L ++ T  +     +R   + +I       ++IG + G +  G++G  K  +D+W   V++A+++ S  
Sbjct:  306 VFISYLADRAQRQAFLETRRCIEARLR---LETENQRQERLVLSVLPRFVVLEMINDMSTVEDENLQHQFHRIYIHRYENVSILFADVKGFTN---LSTTLSAQELVRMLNELFARFDRLAHEHHCLR---IKILGDCYYCVSGLPEPRPDHAHCCVEMGLSMIKTIRY-----VRSRTKHDI------DMRIGIHSGSVLCGVLGLRKWQFDVWSWDVDIANKLESGG 514          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: adcy9 (adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-050208-455])

HSP 1 Score: 239.58 bits (610), Expect = 3.132e-65
Identity = 139/382 (36.39%), Postives = 209/382 (54.71%), Query Frame = 1
Query:  421 NYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDM---------------------------FSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTY-FVIPDKNKNK 1476
            ++++ V ++LL+YT   +      LL L Y ++F  +G      +    ++   +S      R  T+       + G+  L   ++  G+++   + +R +S FLK+ Q+      L+++ A+K ++  I A+MP  + +  L++  ++D                            F     K    VS+LFADIVGFT MS+NK+AA LV LLNDL+ RFD+    T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM   I +F +D++E V+MRVG+H+G V+  I+G  RF+FDV S DV +AN +E  G AG VH+SE T L +   YT EDG +     E++   + + ++   LR Y F IPD + N+
Sbjct:  145 SFAVCVEVLLLLYTAMPLPLYACALLGLSYSVLFEVVGQLWSTGLLLPNVSAGWLS------RAHTEGLAAT--VVGKAFLHLCIHAIGIHIFIMSQVRSRSTFLKVGQSIIHGKELEVEKALKEKM--IHAVMPRMIADELLRQQGDDDSEASAPTTASNPGPRKKKKGSIPREQLPFRPFTMKRMSEVSVLFADIVGFTKMSANKSAATLVRLLNDLFGRFDKLCEVTGCEKISTLGDCYYCVAGCPEPRTDHAACCVEMGLGMIAAIEQFCRDNRETVDMRVGVHTGTVLCGILGMKRFKFDVLSNDVNLANMMEQLGVAGKVHVSEATALCLDERYTMEDGRLF----ERIGPNAVLAEQLKALRWYLFSIPDPSSNR 512          

HSP 2 Score: 198.364 bits (503), Expect = 4.686e-52
Identity = 117/263 (44.49%), Postives = 159/263 (60.46%), Query Frame = 1
Query: 2359 VYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEI-VGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYL 3135
            +++L RE E   RLN++   EAE+   +  H    A+ LL+NIIP  V  ++ V   +S ++E          + GVIFA I NF S +Y E+Y+GG+   R+LH ++   D LL +  Y  +EKIKTI   YM ASGLN   E  A D H  L+ L  FA DM   +  FN+  +   + F L+IG+N GP+TAG+IGT+KPLYDIWGDTVN+ASRM ST   C  +QV +     L  + + F YRGT++VKGKG+M TYL
Sbjct:  927 IWFLNREFEVAYRLNYHGNVEAELHQRKIQHMKNQADLLLHNIIPGHVADQLKVQPHYSKNHE----------DVGVIFASIVNF-SEFYEENYEGGKECYRVLHELMSDLDQLLARDHYGGIEKIKTIGATYMAASGLNVP-EPRAGDAHAHLRTLFEFARDMMSIVEDFNKDML--WFNFRLRIGFNHGPLTAGVIGTTKPLYDIWGDTVNIASRMDSTGVDC-RVQVSQESYHVLCDMGYQFDYRGTVNVKGKGQMKTYL 1174          

HSP 3 Score: 63.929 bits (154), Expect = 2.084e-10
Identity = 51/174 (29.31%), Postives = 85/174 (48.85%), Query Frame = 1
Query:  880 YCKAFENVSILFADIVGFTMM-SSNKTAAQLVY-LLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSG--CPIPRID----HAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            Y K  E+V ++FA IV F+     N    +  Y +L++L +  D+   +      EKI T+G  Y   SG   P PR      H  +  E    M  ++  FNKD    N  +R+G + G + A +IG  +  +D++   V IA+ ++S+G    V +S+++Y +L    Y F+
Sbjct:  984 YSKNHEDVGVIFASIVNFSEFYEENYEGGKECYRVLHELMSDLDQLLARDHYGGIEKIKTIGATYMAASGLNVPEPRAGDAHAHLRTLFEFARDMMSIVEDFNKDMLWFNFRLRIGFNHGPLTAGVIGTTKPLYDIWGDTVNIASRMDSTGVDCRVQVSQESYHVLCDMGYQFD 1157          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008766.1 (pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1 gene:ENSPMAG00000007932.1 transcript:ENSPMAT00000008766.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 175.637 bits (444), Expect = 3.338e-49
Identity = 94/233 (40.34%), Postives = 138/233 (59.23%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRI---RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            M G+   +   + ++ AF +  +  +ARL+ Q   + Q   + +++P  V       I   + + MF  +Y +  +NVSILFADI GFT ++S  TA +LV  LN+L+ RFD+   + +C +I  LGDCYYCVSG P  R DHA  CVEMG+ M   I    +    NVNMRVGIHSGRV   ++G  +++FDV+S DV +AN +E+ G+AG +HI++ T   +   Y  E G
Sbjct:   24 MAGVCTHYPTEVAQRQAFHETRECIKARLRTQKENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTSLASQCTAQELVMTLNELFARFDKLAAENHCLRIKILGDCYYCVSGLPEARADHAHCCVEMGVDMIEAISLVREVTGVNVNMRVGIHSGRVHCGVLGLIKWQFDVWSNDVTLANHMEAGGKAGRIHITKATLRYLNGDYEVEAG 256          

HSP 2 Score: 60.4622 bits (145), Expect = 6.502e-10
Identity = 62/255 (24.31%), Postives = 102/255 (40.00%), Query Frame = 1
Query: 2395 RLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLE 3153
            R  F+ TRE           N+  E LL +++P+ V  E+     +   +M F   Y     N  ++FA I  F S          E+ + L + +   FD L  +   L+   IK + DCY   SGL       A  +H    +    DM   + L  E   V      +++G + G +  G++G  K  +D+W + V +A+ M +       I + +  +     Y +  Y   +     GE N YL   S+E
Sbjct:   38 RQAFHETRECIKARLRTQKENQQQERLLLSVLPRHVAMEMKADINAKKEDMMFHKIYIQKHDNVSILFADIEGFTS--LASQCTAQELVMTL-NELFARFDKLAAENHCLR---IKILGDCYYCVSGLPE-----ARADHAHCCVEMGVDMIEAISLVRE---VTGVNVNMRVGIHSGRVHCGVLGLIKWQFDVWSNDVTLANHMEAGGK-AGRIHITKATLR----YLNGDYE--VEAGHGGERNAYLKTHSIE 271          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ADCY1 (adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:232])

HSP 1 Score: 185.652 bits (470), Expect = 1.763e-48
Identity = 94/234 (40.17%), Postives = 144/234 (61.54%), Query Frame = 1
Query:  679 MTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            ++G ++R      ++ AFL+     E RL+++   + Q   + +++P  V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + ++NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI++ T   +   Y  E G
Sbjct:   28 LSGAFIRVLTERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRHVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKADHAHCCVEMGLDMIDTITSVAEATEVDLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITKSTLDCLNGDYEVEPG 259          

HSP 2 Score: 145.206 bits (365), Expect = 1.029e-35
Identity = 99/273 (36.26%), Postives = 144/273 (52.75%), Query Frame = 1
Query: 2338 LFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGL---NSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA-PYCSSIQVPEYVVEKLKLY-FDFKYRGTISVKGKGEMNTYLV 3138
            L  IC +  + +R+ +  +RL++    +AE    +        + +L+N++P  V +  +    S+   M   Y  +++  GV+FA I NF   Y   D    G   LRLL+ II  FD LL K  +  +EKIKTI   YM A GL   +    + +   HL  +  FA +M     + +E N      F L++G + GP+ AG+IG  +P YDIWG+TVNVASRM ST  P    IQV E V + LK   ++F  RG ++VKGKGEM TY +
Sbjct:  594 LLFICAMGLH-SRQLDLKLRLDYLWASQAEDERGDMERVKNDNKRILFNLLPAHVAQHFL---QSNPRNMDL-YYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELLDKECFKDIEKIKTIGSTYMAAVGLVPTSGTKAKCSIISHLSSVADFAMEM---FDVVDEINYQSYNDFVLRVGISVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGLP--GKIQVSEDVYKILKQSNYEFTCRGKVTVKGKGEMLTYFL 856          

HSP 3 Score: 67.0106 bits (162), Expect = 2.120e-11
Identity = 84/343 (24.49%), Postives = 152/343 (44.31%), Query Frame = 1
Query:  505 LYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLK-RIRNNDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG----------CPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHA-YTFE---------DGEILSIMKEQVHGISGMIQKSVPLRTYF 1449
            +Y+L+ + +G +R         +++  S L        K +E         ILLF+  M GL+ R  + ++ +  +L  +Q  + R  M+         +  ++P+ V ++FL+   RN D+    Y +++  V +LFA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G          C I  I H  S  +  + M  ++ + N     +  +RVGI  G V+A +IG  R ++D++   V +A+ ++S+G  G + +SED Y +++ + Y F           GE+L+   E   G+     +    R  F
Sbjct:  563 VYVLV-LELGGYR---------HIAGTSAL------YMKAYEPVLT-----ILLFICAM-GLHSRQLD-LKLRLDYLWASQAEDERGDMERVKNDNKRILFNLLPAHVAQHFLQSNPRNMDL----YYQSYSQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELLDKECFKDIEKIKTIGSTYMAAVGLVPTSGTKAKCSI--ISHLSSVADFAMEMFDVVDEINYQSYNDFVLRVGISVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGLPGKIQVSEDVYKILKQSNYEFTCRGKVTVKGKGEMLTYFLEGKQGLESCPAEGRLARASF 876          

HSP 4 Score: 49.6766 bits (117), Expect = 4.156e-6
Identity = 49/209 (23.44%), Postives = 83/209 (39.71%), Query Frame = 1
Query: 2383 EKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3003
            E+  R  F   R            N+  E LL +++P+ V  E+  + +    E  F   Y     N  ++FA I  F S   +      +  ++LL+ +   FD L  +       +IK + DCY   SGL          +H    +    DM   +    E   V      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:   38 ERAQRKAFLQARNCIEDRLRLEDENEKQERLLMSLLPRHVAMEM-KEDFLKPPERIFHKIYIQRHDNVSILFADIVGFTSLASQ---CTAQELVKLLNELFGKFDELATEN---HCRRIKILGDCYYCVSGLTQ-----PKADHAHCCVEMGLDMIDTITSVAEATEV---DLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVM 231          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006025.1 (pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 gene:ENSPMAG00000005435.1 transcript:ENSPMAT00000006025.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 179.104 bits (453), Expect = 1.381e-47
Identity = 96/241 (39.83%), Postives = 146/241 (60.58%), Query Frame = 1
Query:  658 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            +LL      G  +R F    ++S F +  ++   RL +    + Q   + +++P  V    +++FLK    N +F  VY +  ENVSILFADIVGFT M+S  TA +LV LLN+L+++FDE   + +C +I  LGDCYYCVSG  + + DHA  CV+MGL M   I    +  +  +NMRVG+H+GRV+  ++G  ++++DV+S DV +AN++E+ G  G VHI++ T   +R  Y  E G
Sbjct:  172 VLLVSACACGGAVRIFTERVQRSTFRRTWESVRQRLLLDDENEKQERLLVSLLPRHVAIELRQDFLKP--PNHIFHKVYIQRHENVSILFADIVGFTGMASQCTAQELVKLLNELFSKFDELATENHCRRIKILGDCYYCVSGLALAKADHAHCCVKMGLDMIDTIDLVAEAMEVRLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANAMEAGGLPGKVHITKATLDGLRGDYEVEPG 410          

HSP 2 Score: 53.9138 bits (128), Expect = 1.492e-7
Identity = 50/209 (23.92%), Postives = 85/209 (40.67%), Query Frame = 1
Query: 2380 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFS-YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRM 3003
             E+  R  F  T E+  +       N+  E LL +++P+ V  E+        N +    Y     N  ++FA I  F            +  ++LL+ +   FD L  +       +IK + DCY   SGL      +A  +H    +    DM   + L  E   V      +++G + G +  G++G  K  YD+W + V +A+ M
Sbjct:  188 TERVQRSTFRRTWESVRQRLLLDDENEKQERLLVSLLPRHVAIELRQDFLKPPNHIFHKVYIQRHENVSILFADIVGFTGM---ASQCTAQELVKLLNELFSKFDELATEN---HCRRIKILGDCYYCVSGL-----ALAKADHAHCCVKMGLDMIDTIDLVAEAMEV---RLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANAM 382          
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Match: adcy2a (adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061109-1])

HSP 1 Score: 168.703 bits (426), Expect = 4.083e-43
Identity = 77/172 (44.77%), Postives = 116/172 (67.44%), Query Frame = 1
Query:  853 RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
             N++ F  +Y +  ++VSIL+ADIVGFT ++S+ + A+LV+ LN L+ +FD+  +  +C +I  LGDCYYCVSG PI    HA +CV+MG+ MC  I K       ++NMRVG+HSG V+  +IG  ++++DV+S+DV +AN +E+ G  G VHI+E T   +  AY  E+G
Sbjct:   40 ENSNNFHNLYVRRHKSVSILYADIVGFTRLASDCSPAELVHTLNQLFGKFDQIAKDNDCMRIKILGDCYYCVSGLPISLPSHAKNCVKMGIDMCEAIKKVRYATGVDINMRVGVHSGNVLCGVIGLQKWQYDVWSHDVTLANHMEAGGVPGRVHITEATLEHLHGAYEVEEG 211          

HSP 2 Score: 151.369 bits (381), Expect = 1.402e-37
Identity = 101/283 (35.69%), Postives = 149/283 (52.65%), Query Frame = 1
Query: 2347 ICLLVYY-----LARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDY-KGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDE------HLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK-LYFDFKYRGTISVKGKGEMNTYLVVRSLEK 3156
            I L+V++     LAR+NE   RL+F   ++ +    E      +   LL N++P  V +  +     + +     Y  ++    V+FA I +F   Y   D  K G   LRLL+ II  FD LL KP +  +EKIKTI   YM A+GLN+   +    E      H+ I++ FA  +   L + N+ +      F L++G N GP+ AG+IG  KP YDIWG++VNV+SRM ST      IQV E   + L+ L ++ + RG I VKGKGE+ T+ VV  + +
Sbjct:  582 IWLIVFFFTLLVLARQNEYYCRLDFLWKQKFKKEREEIETMENLNRVLLENVLPAHVAEHFLTHHRKNED----LYHQSYECVCVMFASIPDFKEFYQESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAAVGQENGQEPERQYAHIGIMVEFAMALMGKLDVINKHSF---NNFRLRVGINHGPVIAGVIGAQKPQYDIWGNSVNVSSRMDSTG-VLGKIQVTEETSDILQTLGYNCQCRGMIKVKGKGELKTFFVVTEMTR 856          

HSP 3 Score: 81.2629 bits (199), Expect = 7.756e-16
Identity = 63/242 (26.03%), Postives = 116/242 (47.93%), Query Frame = 1
Query:  658 ILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM----SSNKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGC-----------PIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDT 1329
            I L + + T L L   N    +  FL   +  + R ++++   +    +E ++P+ V E+FL   R N+    +Y +++E V ++FA I  F         NK   + + LLN++   FDE   + + +  EKI T+G  Y   +G            P  +  H    VE  + +   +   NK    N  +RVGI+ G VIA +IG  + ++D++   V +++ ++S+G  G + ++E+T
Sbjct:  582 IWLIVFFFTLLVLARQNEYYCRLDFLWKQKFKKEREEIETMENLNRVLLENVLPAHVAEHFLTHHRKNED---LYHQSYECVCVMFASIPDFKEFYQESDVNKEGLECLRLLNEIIADFDELLSKPKFSGVEKIKTIGSTYMAATGLNAAVGQENGQEPERQYAHIGIMVEFAMALMGKLDVINKHSFNNFRLRVGINHGPVIAGVIGAQKPQYDIWGNSVNVSSRMDSTGVLGKIQVTEET 820          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO47010 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RN58])

HSP 1 Score: 217.624 bits (553), Expect = 5.012e-58
Identity = 142/392 (36.22%), Postives = 210/392 (53.57%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSL-LYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL---------------------KRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLR---TYFVIPDKNKNKRKLQSRISLNRNTSNK 1524
            +S+    IL++YT         ML SL LYI IF+++  F I +    E+  +   + +  +R + +  E    I    +L   +++ G+ + F   +R +S F K+ Q+  AR  ++   +++   I ++MP  V ++ L                     K  +   +F        ENVSILFADIVGFT MSSNK+A QLV LLNDL+ RFD      +CEKI TLGDCYYCV+GCP P  +HA  CVEMGL M   I +F+ D   +V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E++G  G VHI+E T   +R  Y  E+G          HG +    ++  L+   TYF++  KN  K+ ++    LN N  +K
Sbjct:  128 FSVCTCFILVIYT---------MLHSLRLYICIFITVA-FSIAH----EVLYAFFGNSKG-QRLKGQGEE----IASIVLLHACIHLIGISIFFMAQVRERSTFWKVGQSYVARRDLEIEKQVKERMIRSVMPEIVADSLLNVDDEDENKNGNGREMGNGKRKHKKAKMVFRPFQMHRMENVSILFADIVGFTKMSSNKSADQLVRLLNDLFGRFDRLTEYNHCEKISTLGDCYYCVAGCPKPTPNHATYCVEMGLDMLEQIKEFDNDTDNDVDMRVGVHTGTVLCGIVGTKRFKFDVWSNDVTLANRMETAGLPGRVHITEATVGFLRDQYIVENG----------HGET----RNAALKGITTYFIVGRKNGMKKPIE---LLNANNQSK 483          

HSP 2 Score: 180.259 bits (456), Expect = 3.821e-46
Identity = 110/259 (42.47%), Postives = 158/259 (61.00%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREA-EIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTIN-DCYMLASGLNSD---HEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYL 3135
            R+ E  +R NF    EA +++     H  + A+ LL ++ PK V         S + + +  Y+  + NAGV+FA I NF S +Y E+++GG+  +R+L+ ++  FD LL    Y+++EKIKT+N   +M  +GLN +     E+   EHLK L+ FA +M   +  FNE  ++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST      IQV E   E L  +F F+ RGTI VKGKG + TYL
Sbjct:  847 RQLEMGVRRNFSGDAEAAKVKKKSQVHKQQ-ADWLLLSLFPKHV---------SEALKTSDHYSMNYNNAGVMFASIVNF-SDFYEENFEGGKECIRVLNELVGDFDELLDNIEYMEVEKIKTVNGSTFMAGAGLNQEDNIRREIHPYEHLKQLVEFALEMFNVVDRFNEH-MLG-FKFKLRIGFNAGPVTAGVIGTTKLLYDIWGDTVNLASRMDSTG-VPEKIQVSESTKEMLNDFFIFERRGTIPVKGKGYVTTYL 1091          

HSP 3 Score: 63.5438 bits (153), Expect = 4.032e-10
Identity = 81/364 (22.25%), Postives = 146/364 (40.11%), Query Frame = 1
Query: 2089 YHYITAYLSL-TLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEF-------VGLEGCYEIL-EHFRNLLNVRIKC----FFSFQLFQICL-----LVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIV------------------GKKWSSSNEMAFS--YAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLK 3066
            Y    AY+SL T   LI   ++T +F L +   TA F++C  +++V     H           V     +E+L   F N    R+K       S  L   C+      ++++A+  E   R  F+   ++ +   +     ++ E ++ +++P+ V   ++                  GK+     +M F     H   N  ++FA I  F         K  +  +RLL+ +   FD L +   Y   EKI T+ DCY   +G         +  H    +    DM   ++ F+           +++G + G +  GI+GT +  +D+W + V +A+RM  TA     + + E  V  L+
Sbjct:   93 YKKCAAYISLFTSLWLITAELATYTF-LEEFSITARFSVCTCFILVIYTMLHSLRLYICIFITVAFSIAHEVLYAFFGNSKGQRLKGQGEEIASIVLLHACIHLIGISIFFMAQVRE---RSTFWKVGQSYVARRDLEIEKQVKERMIRSVMPEIVADSLLNVDDEDENKNGNGREMGNGKRKHKKAKMVFRPFQMHRMENVSILFADIVGFTK---MSSNKSADQLVRLLNDLFGRFDRLTE---YNHCEKISTLGDCYYCVAGCPK-----PTPNHATYCVEMGLDMLEQIKEFDNDT---DNDVDMRVGVHTGTVLCGIVGTKRFKFDVWSNDVTLANRM-ETAGLPGRVHITEATVGFLR 437          

HSP 4 Score: 60.077 bits (144), Expect = 4.803e-9
Identity = 55/219 (25.11%), Postives = 102/219 (46.58%), Query Frame = 1
Query:  757 ARLKMQSAI-KIQIYWIE-AIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSN--KTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTL-GDCYYCVSGC--------PIPRIDHAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFE 1362
            A++K +S + K Q  W+  ++ P  V E     ++ +D +S+ Y     N  ++FA IV F+       +   + + +LN+L   FDE          EKI T+ G  +   +G          I   +H    VE  L M  ++ +FN+        +R+G ++G V A +IG  +  +D++   V +A+ ++S+G    + +SE T  ++   + FE
Sbjct:  864 AKVKKKSQVHKQQADWLLLSLFPKHVSE----ALKTSDHYSMNY----NNAGVMFASIVNFSDFYEENFEGGKECIRVLNELVGDFDELLDNIEYMEVEKIKTVNGSTFMAGAGLNQEDNIRREIHPYEHLKQLVEFALEMFNVVDRFNEHMLGFKFKLRIGFNAGPVTAGVIGTTKLLYDIWGDTVNLASRMDSTGVPEKIQVSESTKEMLNDFFIFE 1074          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO45868 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRQ7])

HSP 1 Score: 191.43 bits (485), Expect = 8.343e-50
Identity = 100/246 (40.65%), Postives = 147/246 (59.76%), Query Frame = 1
Query:  643 ITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDG 1368
            + G  +L     +TG++  +   I ++ AFL+  +  EARL +Q   + Q   + +++P  V    K++    I  N  F  +Y +  ENVSILFADI GFT++SS  TA  L+  LN+LY RFD+   + +C +I  LGDCYYCVSG P PR DHA SC+EMGL M   I       + N+NMRVG+H G+V + ++G  ++++DV+S DV IAN +ES G  G VHI+++    +   Y  E+G
Sbjct:  254 LVGNLLLFICANITGVFTHYPTEISQRQAFLETRRCIEARLTIQKENQNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQCTAQSLIKTLNELYARFDQLAVENHCLRIKILGDCYYCVSGLPDPRPDHAHSCIEMGLAMIDAISFVRDATQVNLNMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMESGGLPGRVHITKEVLDCLNGDYEVEEG 499          

HSP 2 Score: 163.31 bits (412), Expect = 5.989e-41
Identity = 101/257 (39.30%), Postives = 144/257 (56.03%), Query Frame = 1
Query: 2380 NEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSD-HEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLY-FDFKYRGTISVKGKGEMNTYLVV 3141
            +E+  RL+F    +A     E     +  + LLYNI+P  V +  +G K + + ++   Y  +     V+F+ I NF   Y   D  G G   LRLL+ I+  FD LL +P +  +EKIKTI + YM ASG+  +  E++A+  H+  +  FA  M    R   + N+     F +KIG NFGP+ AG+IG  KP YDIWGDTVNVASRMYST    + IQV + + E L    + F  RG ++VKGKG+M TY ++
Sbjct:  792 HEQISRLDFLWKLQATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHKANKNEDL---YYQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQFQCIEKIKTIGETYMAASGIKPESQEKLATLNHICTMADFAMAMK---RKLEDINLHSFNNFAMKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKD-NHIQVTKAMYEILSTRGYTFDCRGLVAVKGKGKMVTYWLL 1041          

HSP 3 Score: 83.9593 bits (206), Expect = 2.457e-16
Identity = 74/313 (23.64%), Postives = 152/313 (48.56%), Query Frame = 1
Query:  472 MKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL--KRIRNNDMFSLVYCKAFENVSILFADIVGF----TMMSSNKTAAQLVYLLNDLYNRFDE--QGRQTNC-EKIGTLGDCYYCVSGCP------IPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTY-LLVRHAYTFE 1362
            +KF ++ +++++YIL+        ++YV +   N     D        +  F E+  ++   +++F++ +T  +      I R     KL Q  E + +M+   +     +  I+P  V ++FL  K  +N D+    Y ++ + V+++F++I  F    T + +N    + + LLN++   FDE     Q  C EKI T+G+ Y   SG        +  ++H  +  +  + M R +   N     N  M++G++ G V+A +IG H+ ++D++   V +A+ + S+G+   + +++  Y +L    YTF+
Sbjct:  727 LKFSLLTVMAIVYILL--------VQYVAK---NSFLRHDFLQFCGLGSGHFIEWSDLSILIVVIFILALTA-HGYLHEQISRLDFLWKL-QATEEKKEMEQLREYNKKLLYNILPVHVAQHFLGHKANKNEDL----YYQSCDKVAVMFSNICNFSDFYTELDANGEGVECLRLLNEILADFDELLSEPQFQCIEKIKTIGETYMAASGIKPESQEKLATLNHICTMADFAMAMKRKLEDINLHSFNNFAMKIGLNFGPVVAGVIGAHKPQYDIWGDTVNVASRMYSTGKDNHIQVTKAMYEILSTRGYTFD 1022          

HSP 4 Score: 54.299 bits (129), Expect = 3.057e-7
Identity = 54/213 (25.35%), Postives = 89/213 (41.78%), Query Frame = 1
Query: 2395 RLNFYATREAEIRNAEATHANKIAESLLYNIIPKQV---FKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNF--FSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAF-DMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTA 3015
            R  F  TR            N+  E LL +++P+ V    K+ +    S +++    Y     N  ++FA I  F   SS         +  ++ L+ +   FD L  +   L+   IK + DCY   SGL     + A   H  I M  A  D    +R   + N+       +++G + G + +G++G  K  YD+W D V +A+ M S  
Sbjct:  280 RQAFLETRRCIEARLTIQKENQNQERLLLSVLPRYVAMEMKDDIESGISQNSQFHKIYIQRHENVSILFADIEGFTVLSSQCT-----AQSLIKTLNELYARFDQLAVENHCLR---IKILGDCYYCVSGLPDPRPDHA---HSCIEMGLAMIDAISFVRDATQVNL------NMRVGVHMGKVHSGVLGLVKWQYDVWSDDVTIANHMESGG 475          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO42810 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0C5])

HSP 1 Score: 160.614 bits (405), Expect = 6.098e-40
Identity = 121/423 (28.61%), Postives = 210/423 (49.65%), Query Frame = 1
Query:  715 RRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNN-------DMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHK-ENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILS----IMKEQVHGISGMIQKSVP--------LRTYFVIPDKNKNKRKLQSRISLNRNTSNKLA-EKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDD-PERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEP---------IQIYSIKAALFIDSIAS---------MVYTTTILTAAYVMIPQNVG 1863
            +++ + L+  ++ E +L + +  + Q   + +++P  V E   K    +       + F  ++ +  +  SILFADIVGFT +SS  TA QL+  LN+L+  FD+   + +C +I  LGDCYYC+SG      +HA+  V MGL M   I    ++   +++NMRVGIH+G V+A ++G  +++F+ +S DV +AN +ES G  G VHISE T   ++  +  EDG+  S    +  +++   + +I ++ P        L T  + P+ +  KR+  S   +  +  + +  + +R+  S   ++  K        +  + K L +   ERTV   Q   +N +TL FK+  +EYQY     D             +  Y ++ A+   S+ S         +++  T+LT A V  PQ  G
Sbjct:  294 KQRRSVLETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDFEGDGNPALTDNAFKKLFIRTHDTCSILFADIVGFTELSSKCTAEQLIVTLNELFANFDKLAAKNHCLRIKILGDCYYCISGLD-DSCNHALCAVNMGLDMVEHIAHVREEKGVKSLNMRVGIHTGMVLAGVLGQRKWQFEAWSNDVTLANHMESGGIPGRVHISEPTLNSIKDYFEVEDGDGGSRDDYLADKKIK--TYLITQAKPIWDGEKEDLDTLVLPPETSPEKRRSSSPPEVANDKDSIIGRDGNRRRTSSYMEDSEKSDASTTSNEKMLNKLLCEVLDERTVGKIQE-DMNPVTLRFKNYDVEYQYALEKQDMCSEALSCLCIIMLCCYFVELAILPTSLRSHLVFGIGFLLMFVPTVLTFA-VKFPQTCG 711          

HSP 2 Score: 147.517 bits (371), Expect = 6.006e-36
Identity = 83/195 (42.56%), Postives = 115/195 (58.97%), Query Frame = 1
Query: 2557 YAHAFANAGVIFACISNFFSSYYREDY--KGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLY-FDFKYRGTISVKGKGEMNTY 3132
            Y+H++    V+FA I NF S +Y ED    GG   +RLL+ +I  FD +L  P +L +EKIKTI+  YM ASGL  + E+    ++L  ++ FA  +   L   N+++      F L++G   GPI AG+IG  KP YDIWG+TVNVASRM +T      IQ+     E +K   F F YRG + VKGKG++ TY
Sbjct:  890 YSHSYKRVSVMFASIPNF-SEFYSEDNINNGGVECIRLLNEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLRPESEDAEESQNLVDIVDFALTLRDKLDFINQESF---NQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGK-AGCIQITAQTYETIKDKDFVFVYRGAVRVKGKGQLITY 1079          

HSP 3 Score: 67.781 bits (164), Expect = 2.167e-11
Identity = 46/169 (27.22%), Postives = 83/169 (49.11%), Query Frame = 1
Query:  877 VYCKAFENVSILFADIVGFTMMSS----NKTAAQLVYLLNDLYNRFDE---QGRQTNCEKIGTLGDCYYCVSGCPIPRIDHA------ISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVR 1344
            +Y  +++ VS++FA I  F+   S    N    + + LLN++   FDE     R    EKI T+   Y   SG   P  + A      +  V+  L +   +   N++      +RVGI  G ++A +IG  +  +D++   V +A+ +E++G+AG + I+  TY  ++
Sbjct:  889 LYSHSYKRVSVMFASIPNFSEFYSEDNINNGGVECIRLLNEVITDFDEVLADPRFLGVEKIKTISSTYMAASGLR-PESEDAEESQNLVDIVDFALTLRDKLDFINQESFNQFVLRVGICQGPIVAGVIGAKKPHYDIWGNTVNVASRMETTGKAGCIQITAQTYETIK 1056          

HSP 4 Score: 57.3806 bits (137), Expect = 3.402e-8
Identity = 56/247 (22.67%), Postives = 101/247 (40.89%), Query Frame = 1
Query: 2362 YYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIV------GKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFK 3084
            Y++A   ++  R +   TRE+          N+    LL +++PK V +E+       G    + N     +        ++FA I  F     +      E  +  L+ +   FD L  K   L+   IK + DCY   SGL+       S  H    +    DM  H+    E+   G  +  +++G + G + AG++G  K  ++ W + V +A+ M S       + + E  +  +K YF+ +
Sbjct:  288 YHIA---DRKQRRSVLETRESLEVKLTLDAQNQQQRRLLLSVLPKHVAEEMTKDFEGDGNPALTDNAFKKLFIRTHDTCSILFADIVGFTELSSK---CTAEQLIVTLNELFANFDKLAAKNHCLR---IKILGDCYYCISGLDD------SCNHALCAVNMGLDMVEHIAHVREEK--GVKSLNMRVGIHTGMVLAGVLGQRKWQFEAWSNDVTLANHMESGG-IPGRVHISEPTLNSIKDYFEVE 516          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO34267 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPS8])

HSP 1 Score: 116.701 bits (291), Expect = 1.906e-28
Identity = 78/212 (36.79%), Postives = 119/212 (56.13%), Query Frame = 1
Query:  802 IEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRID-HAISCVEMGLGM-----CRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTF---EDGEI-LSIMKEQVHGI 1407
            +E ++P  V +  LKR ++      V  ++F  VSI F+DIVGFT +S+  +  Q+V LLNDLY  FD+  R+ +  K+ T+GD Y  VSG PI   + HA    +M L +        IV++   +K  + +RVGIHSG V+A ++GN   R+ +F   V  A+ +ES+G A  +HISEDT  ++     F     GE+ L + + Q  G+
Sbjct:  116 LERMLPKPVTDQ-LKRGKS------VEAESFHEVSIYFSDIVGFTELSAESSPLQVVSLLNDLYTLFDDIIREYDVYKVETIGDAYMVVSGLPIRNGNRHAGEIAKMALHLIEAVQTEFIVRYKPTYK--LKLRVGIHSGPVVAGVVGNTMPRYCLFGDTVNTASRMESNGEALRIHISEDTKRILDQLGGFVVEGRGEVYLKVRRRQRDGV 318          

HSP 2 Score: 70.0922 bits (170), Expect = 8.437e-13
Identity = 64/245 (26.12%), Postives = 115/245 (46.94%), Query Frame = 1
Query: 2431 RNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKK-PIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTF--AFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEK 3156
            +  +     K  ++LL  ++PK V  ++  K+  S    +F     + +  V F  +S   S             + LL+ +   FD+++++  +Y    K++TI D YM+ SGL   +    + E  K+ +    A    + +R         TY   L++G + GP+ AG++G + P Y ++GDTVN ASRM S      ++++  ++ E  K   D    G   V+G+GE+  YL VR  ++
Sbjct:  101 KTGQLIEEKKKTDALLERMLPKPVTDQL--KRGKSVEAESFHEVSIYFSDIVGFTELSAESSPLQ---------VVSLLNDLYTLFDDIIREYDVY----KVETIGDAYMVVSGLPIRNGNRHAGEIAKMALHLIEAVQTEFIVRYKP------TYKLKLRVGIHSGPVVAGVVGNTMPRYCLFGDTVNTASRMESNG---EALRI--HISEDTKRILD--QLGGFVVEGRGEV--YLKVRRRQR 315          
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Match: EDO34275 (Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7SPS9])

HSP 1 Score: 112.079 bits (279), Expect = 1.054e-25
Identity = 66/154 (42.86%), Postives = 87/154 (56.49%), Query Frame = 1
Query:  877 VYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRI-DHAISCVEMGLGMCRLIVKFNKDHKEN--VNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDT 1329
            V  + F+ VSI F+DIVGFT +SS  T  Q+V LLNDLY  FDE     +  K+ T+GD Y  VSG PI     HA     M L M R I  F   H+ N  + +R+GIHSG  +A ++G    R+ +F   V  A+ +ES+G A  +HIS  T
Sbjct:  330 VTAENFDEVSIFFSDIVGFTSLSSESTPLQVVDLLNDLYTLFDEIINNYDVYKVETIGDAYMVVSGLPIRNGHQHAGEIATMALHMLREIDSFKIRHRPNDKLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPST 483          

HSP 2 Score: 70.4774 bits (171), Expect = 2.102e-12
Identity = 69/245 (28.16%), Postives = 113/245 (46.12%), Query Frame = 1
Query: 2425 EIRNAEATHANKIAESLLYNIIPKQVFKEIV-GKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKK-PIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVP--EYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 3147
            E R ++     +  E+LL  ++P  V K++V GK+ ++ N   F     F +  V F  +S+  +     D         LL+ +   FD ++    +Y    K++TI D YM+ SGL   +      +H   + T A  M   +  F  ++        L+IG + G   AG++G   P Y ++GDTVN ASRM S          P  + ++++L  Y   + RG + +KGKG   TY +V S
Sbjct:  295 EERTSQLADEKRKTENLLNRMLPPSVAKDLVHGKQVTAEN---FDEVSIFFSDIVGFTSLSSESTPLQVVD---------LLNDLYTLFDEIINNYDVY----KVETIGDAYMVVSGLPIRN----GHQHAGEIATMALHMLREIDSFKIRHRPND-KLKLRIGIHSGSCVAGVVGKKMPRYCLFGDTVNTASRMESNGEALKIHISPSTKRILDELGGYH-IQKRGKVFLKGKGTWITYWLVGS 517          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 226.868 bits (577), Expect = 2.302e-60
Identity = 143/408 (35.05%), Postives = 215/408 (52.70%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP--------------------------------SSVKENFLKRI---RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSN 1521
            +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP                                SS K N  K+    R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +   Y  EDG+++     S++ +Q+ G           RTY +    +  + +L S  S +R  S+
Sbjct:  222 FSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATLT----------WLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKG----------QRTYLI----SGRRDELHSHCSCSRMESS 598          

HSP 2 Score: 190.66 bits (483), Expect = 7.217e-49
Identity = 114/262 (43.51%), Postives = 162/262 (61.83%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 3147
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E  Y V    + ++F YRGT++VKGKG+M T+L  +S
Sbjct:  951 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLS-GMDYEFDYRGTVNVKGKGQMKTFLYPKS 1198          

HSP 3 Score: 72.7886 bits (177), Expect = 2.024e-12
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHA--ISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E  LK  ++       Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V +SE++Y ++
Sbjct:  964 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQ-LKVTQS-------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 1169          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 226.868 bits (577), Expect = 2.929e-60
Identity = 143/408 (35.05%), Postives = 215/408 (52.70%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP--------------------------------SSVKENFLKRI---RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSN 1521
            +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP                                SS K N  K+    R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +   Y  EDG+++     S++ +Q+ G           RTY +    +  + +L S  S +R  S+
Sbjct:  242 FSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATL----------TWLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKG----------QRTYLI----SGRRDELHSHCSCSRMESS 618          

HSP 2 Score: 190.274 bits (482), Expect = 9.468e-49
Identity = 114/262 (43.51%), Postives = 162/262 (61.83%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 3147
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E  Y V    + ++F YRGT++VKGKG+M T+L  +S
Sbjct: 1032 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLS-GMDYEFDYRGTVNVKGKGQMKTFLYPKS 1279          

HSP 3 Score: 72.0182 bits (175), Expect = 3.257e-12
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHA--ISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E  LK  ++       Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V +SE++Y ++
Sbjct: 1045 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQ-LKVTQS-------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 1250          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: crebbpb (adenylate cyclase 9 [Source:NCBI gene;Acc:101155516])

HSP 1 Score: 226.868 bits (577), Expect = 2.961e-60
Identity = 143/408 (35.05%), Postives = 215/408 (52.70%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMP--------------------------------SSVKENFLKRI---RNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEIL-----SIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSN 1521
            +SL + ++LL+Y++  ++    +LL LLY ++F S+G   +  V+  +      S+  ++           +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP                                SS K N  K+    R   +F     K  E VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++ +E VNMRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+S+ T   +   Y  EDG+++     S++ +Q+ G           RTY +    +  + +L S  S +R  S+
Sbjct:  242 FSLCIEVLLLLYSVLHVRLYASVLLGLLYSVVFESLGWMHLSQVDGDQ-----SSEWATL----------TWLGPAKALLHLCAHAIGMHLFIMSEVRSRSTFLKVGQAIMHGKDLEVEKALKERM--IHSVMPRLVADELMKQSDEDIGDNSAKRYSTSGAAAVISSPKSNKRKKTSIPRGQIIFRPFNMKRMEPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITGCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQEKREMVNMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSQATAKFLDDRYRREDGQVVERIGPSVVADQLKG----------QRTYLI----SGRRDELHSHCSCSRMESS 618          

HSP 2 Score: 190.274 bits (482), Expect = 9.414e-49
Identity = 114/262 (43.51%), Postives = 162/262 (61.83%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEH--LKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE--YVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 3147
            RE E + RL+++   EA+    +  +    A+ LL NIIP  V +++         ++  SY+    N GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN+     A+  H  L+ L  FA +M   +  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM +T   C  +QV E  Y V    + ++F YRGT++VKGKG+M T+L  +S
Sbjct:  997 REFEVSYRLHYHGNVEADQHRIKIQNMRDQADWLLRNIIPIHVAEQL---------KVTQSYSKNHDNVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVEC-RVQVSEESYCVLS-GMDYEFDYRGTVNVKGKGQMKTFLYPKS 1244          

HSP 3 Score: 72.4034 bits (176), Expect = 2.708e-12
Identity = 65/215 (30.23%), Postives = 107/215 (49.77%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWI-EAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSG-----CPIPRIDHA--ISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R+K+Q+ ++ Q  W+   I+P  V E  LK  ++       Y K  +NV ++FA IV F+     S +   +   +LN+L   FDE  R+    N EKI T+G  Y   SG     C      HA   +  E  L M R++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++++G    V +SE++Y ++
Sbjct: 1010 NVEADQHRIKIQN-MRDQADWLLRNIIPIHVAEQ-LKVTQS-------YSKNHDNVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPAFANIEKIKTIGATYMAASGLNAQQCADAAHPHAHLRALFEFALEMMRVVDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDTTGVECRVQVSEESYCVL 1215          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: adcy9 (adenylate cyclase type 9 [Source:NCBI gene;Acc:101163149])

HSP 1 Score: 209.149 bits (531), Expect = 1.200e-54
Identity = 140/411 (34.06%), Postives = 204/411 (49.64%), Query Frame = 1
Query:  424 YSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESI-RRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQN--AEARLKMQSAIKIQIYWIEAIMPSSVK-------------ENFLKR-----------------------------IRNND----------------MFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKN 1473
            +SL + ++LL+Y++  ++    +LL LLY ++F ++G   +      +    T   LES+   +        +    + +L    +  G++L   + +R +S FLK+ Q       L+++ A+K ++  I ++MP  V              EN  KR                              RNN                 +F     K  + VSILFADIVGFT MS+NK+A  LV LLNDL+ RFD     T CEKI TLGDCYYCV+GCP PR DHA  CVEMGLGM + I +F ++  E V+MRVG+H+G V+  I+G  RF+FDV+S DV +AN +E  G AG VH+SE T   +   Y  EDG +     + V      ++K   ++TY +   K  N
Sbjct:  231 FSLCMEVLLLLYSVLHVRLYASVLLGLLYSILFEALGWLPLLQSGSGD----TGQGLESVASDWENDTLR--WLGPAKGLLHLCAHAIGIHLFIMSEVRSRSTFLKVGQAIMHGKELEVEKALKERM--IHSVMPRRVADELMKQGDDEGGGENSGKRYSSGACSASAVAVAGAGGGGASQAQSGVSSRNNPHNNHKQKKTSIPRAQIIFRPFNMKCMKPVSILFADIVGFTKMSANKSAHALVGLLNDLFGRFDRLCEITCCEKISTLGDCYYCVAGCPEPRPDHAYCCVEMGLGMIQAIEQFCQETCETVDMRVGVHTGTVLCGILGMKRFKFDVWSNDVNLANLMEQLGVAGKVHLSEATSHFLDDRYLMEDGRVAERAGQSV------MEKLKGVKTYLISGRKLGN 627          

HSP 2 Score: 196.438 bits (498), Expect = 1.253e-50
Identity = 118/268 (44.03%), Postives = 163/268 (60.82%), Query Frame = 1
Query: 2374 RENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLN----SDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL-KLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPF 3162
            RE E + RL+++   EA+   A+       AE LL NIIP  V  ++         ++  SY+    + GVIFA I NF S +Y E Y+GG+   R+L+ +I  FD LL+KP +  +EKIKTI   YM ASGLN    ++ E+     HL+ L  FA +M   L  FN +N++G + F L+IG+N GP+TAG+IGT+K LYDIWGDTVN+ASRM ST   C  +QV E     L  +  DF+YRGT++VKGKG+M T+L  +S +  F
Sbjct: 1064 REFEVSYRLHYHGNVEADKHRAKIQTMRDQAEWLLGNIIPIHVADQL---------KVTQSYSKNHDSVGVIFASIVNF-SEFYEESYEGGKECYRVLNELIGDFDELLRKPEFKSVEKIKTIGSTYMAASGLNVQQLAETEDDCPHAHLRALFNFALEMMGVLDDFN-KNMLG-FGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVEC-RVQVSEESHTVLSDMGLDFEYRGTVNVKGKGQMRTFLYPKSGDSAF 1318          

HSP 3 Score: 59.6918 bits (143), Expect = 1.862e-8
Identity = 58/217 (26.73%), Postives = 105/217 (48.39%), Query Frame = 1
Query:  748 NAEA---RLKMQSAIKIQIYWIEA-IMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMM--SSNKTAAQLVYLLNDLYNRFDEQGRQT---NCEKIGTLGDCYYCVSGCPIPRID---------HAISCVEMGLGMCRLIVKFNKDHKE-NVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLV 1341
            N EA   R K+Q+ ++ Q  W+   I+P  V +  LK  ++       Y K  ++V ++FA IV F+     S +   +   +LN+L   FDE  R+    + EKI T+G  Y   SG  + ++          H  +     L M  ++  FNK+       +R+G + G + A +IG  +  +D++   V IA+ ++S+G    V +SE+++ ++
Sbjct: 1077 NVEADKHRAKIQT-MRDQAEWLLGNIIPIHVADQ-LKVTQS-------YSKNHDSVGVIFASIVNFSEFYEESYEGGKECYRVLNELIGDFDELLRKPEFKSVEKIKTIGSTYMAASGLNVQQLAETEDDCPHAHLRALFNFALEMMGVLDDFNKNMLGFGFKLRIGFNHGPLTAGVIGTTKLLYDIWGDTVNIASRMDSTGVECRVQVSEESHTVL 1284          
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Match: adcy1b (adenylate cyclase type 1 [Source:NCBI gene;Acc:101166500])

HSP 1 Score: 199.134 bits (505), Expect = 1.164e-51
Identity = 122/379 (32.19%), Postives = 205/379 (54.09%), Query Frame = 1
Query:  364 ICMTYTV-LLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSV----KENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKL 1485
            +C  +++  +G +     E     ++L+  + Y L  ++ ++ +LL L+     VSI +  +          +T   +++ + +RT        +    +L   + ++GL++R      ++ AFL+     E RL+M+   + Q   + +++P +V    KE+FLK      +F  +Y +  +NVSILFADIVGFT ++S  TA +LV LLN+L+ +FDE   + +C +I  LGDCYYCVSG   P+ DHA  CVEMGL M   I    +  + N+NMRVG+H+GRV+  ++G  ++++DV+S DV +AN +E+ G  G VHI+  T   +   Y  E G          H  S  +QK   + T+F++P    ++RK+
Sbjct:  132 LCCPFSLGAMGMEPPTSPEQGVWQLILVTFVAYALLPVRTLLAVLLGLM-----VSISHLIV---------TATSVTVKTQKLWRT--------LVANTVLFTSVNLSGLFVRILTERAQRKAFLQARNCIEERLRMEDENEKQERLLMSLLPRNVAMEMKEDFLKPPER--IFHKIYIQRHDNVSILFADIVGFTSLASQCTAQELVKLLNELFGKFDELATENHCRRIKILGDCYYCVSGLTQPKTDHAHCCVEMGLDMIDTITSVAEATEVNLNMRVGLHTGRVLCGVLGLRKWQYDVWSNDVTLANVMEAGGLPGKVHITRSTLECLNGDYEVEPG--------NGHERSAFLQKH-EIETFFIVP---SHRRKI 474          

HSP 2 Score: 146.362 bits (368), Expect = 3.540e-35
Identity = 99/269 (36.80%), Postives = 133/269 (49.44%), Query Frame = 1
Query: 2371 ARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK----WSSSNEMAFS-------YAHAFANAGVIFACISNFFSSYYREDYKG-GEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLN---SDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTY 3132
            +R+ +  +RL+F    +AE               +L+N++P  V +  +        S +N  A         Y  ++A  GV+FA I NF   Y   D    G   LRLL+ II  FD L+ K  Y  +EKIKTI   YM A GL        + +  +HL  +  +A +M     + +E N      F L++G N GP+ AG+IG  +P YDIWG+TVNVASRM ST      IQV E V   L   +D   RG ISVKGKGEM TY
Sbjct:  796 SRQLDLKLRLDFLWAVQAEEERDGMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMVSQANRQAGMQTDKQDLYYQSYAQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMAAVGLVPTIGTKAKKSVHDHLSTIADYAIEM---FDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTG-VPGKIQVTEDVYRLLNSNYDLVCRGKISVKGKGEMLTY 1060          

HSP 3 Score: 77.411 bits (189), Expect = 6.390e-14
Identity = 80/319 (25.08%), Postives = 142/319 (44.51%), Query Frame = 1
Query:  610 FRTKIFEEYYYITG-QCILLFLMYMTGLYLRFFN-SIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL-KRIRN------------NDMFSLVYCKAFENVSILFADIVGFT----MMSSNKTAAQLVYLLNDLYNRFDEQGRQ---TNCEKIGTLGDCYYCVSGCPIPRI---------DHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTF---------EDGEILS-IMKEQVHGISGMIQKSVPLRT 1443
            FR       ++I G + IL  L++++ L L      ++ +  FL   Q  E R  M+         +  ++P+ V ++FL    RN             D   L Y +++  V +LFA I  F      +  N    + + LLN++   FDE   +    + EKI T+G  Y    G  +P I         DH  +  +  + M  ++ + N        +RVGI+ G V+A +IG  R ++D++   V +A+ ++S+G  G + ++ED Y L+   Y             GE+L+  ++ +V GI G +  S+ +R+
Sbjct:  765 FRRTAGGGSFHIRGFEPILSLLLFVSALALHSRQLDLKLRLDFLWAVQAEEERDGMEKVKLDNRRILFNLLPAHVAQHFLMSNPRNMVSQANRQAGMQTDKQDLYY-QSYAQVGVLFASIPNFNDFYIELDGNNMGVECLRLLNEIIADFDELMDKECYKDIEKIKTIGSTYMAAVGL-VPTIGTKAKKSVHDHLSTIADYAIEMFDVLDEINYQSYNEFVLRVGINVGPVVAGVIGARRPQYDIWGNTVNVASRMDSTGVPGKIQVTEDVYRLLNSNYDLVCRGKISVKGKGEMLTYFLEGKVQGI-GTVTTSLVMRS 1080          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009035.1 (SMESG000009035.1)

HSP 1 Score: 1931.38 bits (5002), Expect = 0.000e+0
Identity = 984/1037 (94.89%), Postives = 1014/1037 (97.78%), Query Frame = 1
Query:   64 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLYLK 3174
            M+RLKLEEVSKVMSLRSSILS+YF+TLMTNHNIKSIRNGMKVLILYCYCE+VSSHISERG+++RPILAL  FCI+F IFA+TV VK++ T++RFAS MVIICM +TV LGTD  ELMELNYSL++LIIL+MYTLFRMKFM+VMLLS +YILIFVSIGNFRIKY++  +LN+S    L++IR  R+ I ++YY++ GQCILL LMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKLAEKSRKIFSDKAKNLFKKKDEKFKGDLKIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPIIYVTGYIYIVIIAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLYLK
Sbjct:    1 MLRLKLEEVSKVMSLRSSILSEYFHTLMTNHNIKSIRNGMKVLILYCYCEVVSSHISERGVLYRPILALFAFCIYFFIFASTVKVKKSVTMIRFASIMVIICMIHTVALGTDPMELMELNYSLIILIILMMYTLFRMKFMIVMLLSSMYILIFVSIGNFRIKYIDTADLNISAAPILQTIRGRRSGIVDKYYFVCGQCILLLLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKLAEKSRKIFSDKAKNLFKKKDEKFKGDLKIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPIIYVTGYIYIVIIAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLYLK 1037          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009033.1 (SMESG000009033.1)

HSP 1 Score: 1598.56 bits (4138), Expect = 0.000e+0
Identity = 819/995 (82.31%), Postives = 877/995 (88.14%), Query Frame = 1
Query:  181 MKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXX------IVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRS 3147
            MKVLILYCYCEIVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFL RIRN+D FSLVYC+ FENVSILFADIVGFTMMSSNKTAA+LVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPR DHAISCVEMGLGMCRLIVKFNKDHKE+VNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSG+AGFVH+SEDT+LLVRH Y FE G+IL IMKEQVHGISGMI+ SVP+ TYFVIP +   K+K + +     N +NKL      +          +K    + D K      IVKCLQ+DPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIK ALF+DS+AS+ Y + IL AAYVM+P++ GF+FYSPIIY +GY +I+IIAFISL+YKSEI N+ LRK Y F+SHPL+RL L VY+SSLPSI V SL+    +  +YHY +A+ S+ LFALI NVISTS  SL+KHITT  +T   I L        E      + C   L   +N+  +RI+C FSFQL QICLL+YYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK   SNE+ FSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMH+HLRLFNEQNI+G +TFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPE+V  KLKLYFDFKYRGT++VKGKG+M T+L VRS
Sbjct:    1 MKVLILYCYCEIVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLNRIRNSDSFSLVYCQHFENVSILFADIVGFTMMSSNKTAAKLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRTDHAISCVEMGLGMCRLIVKFNKDHKEDVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGKAGFVHVSEDTFLLVRHRYNFEKGDILEIMKEQVHGISGMIKTSVPMNTYFVIP-RQIKKKKHKHKHKKQLNMANKLYSVPHSVQQILLNQDDNEKHNFKRRDRKYKGDLKIVKCLQEDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKLALFLDSLASLFYASVILLAAYVMLPKSFGFRFYSPIIYGSGYFFIIIIAFISLIYKSEIPNRKLRKFYCFWSHPLSRLLLGVYMSSLPSILVISLYNKNILATSYHYASAFFSIALFALISNVISTSLSSLVKHITTGSYTAIAICLCFYAPTKRELNLYSFDNCSIYLTEPKNMFILRIQCIFSFQLLQICLLIYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKK--QSNEIIFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHHHLRLFNEQNIIGNFTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEHVANKLKLYFDFKYRGTVAVKGKGDMTTFLAVRS 992          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000009036.1 (SMESG000009036.1)

HSP 1 Score: 1363.21 bits (3527), Expect = 0.000e+0
Identity = 705/1039 (67.85%), Postives = 846/1039 (81.42%), Query Frame = 1
Query:   64 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSN---KLAEKSRKIXXXXXXXXX-XXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRT--EAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPF 3162
            M+R K+  + K+ SLRS+ILS YFYTLMTNHNIKSIRNGMKVLI+Y Y E+VSSHISERG+IFRPILAL+ FCIFF+I+  T+ V++T T+ R AS MVI+CMTYTV+LGTD  E+ME++YSL +LIIL+MYTLFR KF++ +LLS++YILIFVSIGN+R+K+VE   ++V   + LE  R  + +I   + +I  QC L FL Y+TGLYLR FNSIRRKSAFLKLAQNA+AR+KMQSAI++QIYWIEAIMPSSVKE FLKRIR+NDMFSLVYC+ F+NVSILFADIVGFT MS+NKTAA+LVYLLNDLYNRFD QGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAI+CVEMGLGMCR+I+KFNKDHKE VNMRVGIHSGRVIAAIIGNHRFRFDVFS DV+IANSLESSG+ G VHISEDTY+LVRHAY   +GE L I KE+VHGISGM+QK VP+ TYFVIPD    K K++ R   + N SN   K+++ ++K+    AK    K+KD K K DLKIV+ LQ+DPER++EFF+NPPI+  +  FKD +IEYQYL+HTTDQIEP++I +IK A FIDS+AS+VY T IL  + +MIP NV FK YSP+IY +G+++  I A+IS  YKS+I N   R +Y+F+SHPL+RL+LSVYISSLPS+ V S F  E +  +Y ++ AYLSLT+FALIGN I T+S SLIKHITT  F + PI L+V    E     E + L  C +++++  +   VR++C F+FQL  +CL++YYL RENEK  R+NFYATREA+IRNAEA  A +IAESLLYNIIPK VF +I  +K +   EM+F+YAHAFANAGV+FACISNFFSSYYREDYKGGEVAL+LLHTIICTFDNLL KP Y  LEKIKTINDCYM+ASG+N D   +  DEHL  LMTFA DMHYHL+LFNEQNIVG  TFYLKIG+NFGP+TAGIIGT+KPLYDIWGDTVNVASRMYST+P  S+IQVP+YV  +LK  F FKYRG +SVKGKGEM TYLV+RS +K F
Sbjct:    1 MLRAKIANLRKITSLRSAILSAYFYTLMTNHNIKSIRNGMKVLIIYWYFEVVSSHISERGVIFRPILALIAFCIFFLIYVLTIRVQKTNTMTRMASLMVILCMTYTVILGTDILEIMEIHYSLSLLIILMMYTLFRFKFLITVLLSIVYILIFVSIGNYRLKFVENINMSVFYTTPLEISRAMKIEIKNHHSFIVAQCGLFFLAYITGLYLRCFNSIRRKSAFLKLAQNAQARMKMQSAIQVQIYWIEAIMPSSVKEQFLKRIRDNDMFSLVYCQNFDNVSILFADIVGFTKMSANKTAAKLVYLLNDLYNRFDVQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAINCVEMGLGMCRIIMKFNKDHKEKVNMRVGIHSGRVIAAIIGNHRFRFDVFSNDVVIANSLESSGKPGLVHISEDTYVLVRHAYAVNEGEALEIKKEEVHGISGMMQKIVPMSTYFVIPDSVPYKLKIKDRAVHDFNVSNTTIKISKDTKKLLIKDAKAESYKRKDAKLKEDLKIVQMLQEDPERSIEFFKNPPIHNFSQTFKDREIEYQYLYHTTDQIEPLKIDTIKVATFIDSVASLVYATIILLISLLMIPNNVRFKLYSPLIYASGFVFTFIAAYISFFYKSQIRNPVARLIYAFWSHPLSRLFLSVYISSLPSLLVLSFFDKEVLHGHYQFMIAYLSLTIFALIGNTICTASVSLIKHITTLSFAMVPIILVVFQPFEIDSSKEEMSL-NCSDLIKNKVDFSKVRMQCNFTFQLLSVCLVIYYLTRENEKTTRINFYATREADIRNAEAIRAKRIAESLLYNIIPKHVFADISARK-TQEKEMSFTYAHAFANAGVVFACISNFFSSYYREDYKGGEVALKLLHTIICTFDNLLHKPAYSLLEKIKTINDCYMIASGINVDSSLLKEDEHLIALMTFALDMHYHLKLFNEQNIVGKNTFYLKIGFNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTSPSGSTIQVPDYVCVRLKDSFQFKYRGVVSVKGKGEMITYLVIRSYDKAF 1037          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000050966.1 (SMESG000050966.1)

HSP 1 Score: 1105.51 bits (2858), Expect = 0.000e+0
Identity = 577/1041 (55.43%), Postives = 756/1041 (72.62%), Query Frame = 1
Query:   64 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNVST-VSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIP-----DKNKNKRKLQSRISLNRNTSNKLAEKSRKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLY 3168
            M++ K+E+V +V+SL S+  S+YF+ LMT HNIKSIRNG KVLI Y  CEI+SSH+++R +I++PI+AL+ F +F   F  TVNV++T+T++  AS MV++CM+Y+V++GTD+ E+ME  +SL+V +IL+MYTLF ++F++ MLLS++YILIF+S  N+R+   E +E N++   S L  +R     I  +YY + GQ IL F++Y+TGLYLR FNSIRRKSAFLKLAQNA+A++KM SAIK+QIYWIEAIMP++V+  FL+ IR+ D+F+L YCK F+NVSILFADIVGFT MSSNKTA QLVYLLNDLYNRFD+ G+  NCEKI TLGDCYYCVSGCP+PR DHA+ CVEMGLGMC++I+ FN+ HKE VNMRVG+HSGRVIAAIIGN RFRFDV+S DV IAN+LESSG+ G VHIS+ T+ LV HAYTF +GE L + KE+  G+ G     VP+ TYFV       D+  N++ +    S  RN       K  +I  DK+   FK +DEK K DL++++ LQ DPERTV+ FQNPP+N +TL FKD +IE  + FH  DQI  I I S+K ALF D+IA  V +T ++ +A+ +I ++ G    + ++Y++G   I+I  +I L+YKSEI ++  RK++  FSHPL+RL + +YIS LP++ V +L+  E++ +NY Y   Y +LT FALI N I T S+S++K ++TA  T   +YL++  +   E +      C + L  +  +   ++K FFSFQLFQICLL+Y+L RENEKNIR+ FYA+REAEIRN EA    K+AE  LYNIIPK VF +I G          FSYA    NAGV+FA I NFFS YYREDYK GE AL++LH IIC FDNLL+ P+Y  LEKIKT+NDCYM+ASGLN+  +    D HL  LM F+FD+   L  +NE+NIVG   FYLKIGYNFGP+TAGIIGTSKPLYDIWGDTVNVASRMYSTAP    IQV +YV + L  +F F+YRG + +KGKG++ TYL +R  E   +Y
Sbjct:    1 MLKQKVEKVLRVLSLNSTAFSEYFHMLMTVHNIKSIRNGTKVLIFYFCCEIISSHMADRTVIYKPIVALIAFIVFVCFFGLTVNVEKTSTMISLASIMVVLCMSYSVIIGTDADEMMEARFSLMVAVILMMYTLFHLRFLITMLLSIVYILIFLSAVNYRLGLNESEEHNITKFTSALRKVRHSEHDIPNKYYMLIGQIILFFMVYLTGLYLRIFNSIRRKSAFLKLAQNAQAKMKMDSAIKVQIYWIEAIMPAAVRGEFLESIRSKDLFNLGYCKQFKNVSILFADIVGFTAMSSNKTAKQLVYLLNDLYNRFDDFGKIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMILAFNRLHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISKKTFKLVCHAYTFIEGEKLMVTKERQFGLEGFAPTLVPMPTYFVESYSTEFDEYFNRKVIDESKSYERNEEKSNESKPSQIGIDKSALEFKIRDEKMKNDLELIRHLQSDPERTVQCFQNPPLNPLTLTFKDTEIESHFQFHVVDQIREININSVKVALFFDAIACQVCSTFVIISAFFLIIESGGISKTTTLVYMSGIPLIMIAGWICLVYKSEIPSEIFRKIFVIFSHPLSRLSIGIYISVLPTLLVHTLYDAEKLYNNYEYTVGYFTLTFFALISNCIFTISYSVLKQMSTAACTAGSLYLLL--QPTKEMDIYEYSSCVDFLVDYVEIQTQKLKYFFSFQLFQICLLLYFLTRENEKNIRIFFYASREAEIRNDEARRERKVAEKFLYNIIPKYVFFQITGSA-DDKKSTKFSYAKTIVNAGVVFASIGNFFSGYYREDYKRGESALKVLHNIICGFDNLLRLPLYKGLEKIKTVNDCYMMASGLNASSKAYRED-HLYKLMLFSFDLLNQLAYYNEENIVGNKHFYLKIGYNFGPVTAGIIGTSKPLYDIWGDTVNVASRMYSTAP-AGKIQVSDYVHKYLATHFLFEYRGKVFMKGKGDVETYLALRPYETYMIY 1036          
BLAST of Adenylate cyclase type vs. Planmine SMEST
Match: SMESG000050971.1 (SMESG000050971.1)

HSP 1 Score: 1055.05 bits (2727), Expect = 0.000e+0
Identity = 560/1046 (53.54%), Postives = 749/1046 (71.61%), Query Frame = 1
Query:   64 MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCEIVSSHISERGIIFRPXXXXXXXXXXXXXXXXTVNVKETTTIMRFASAMVIICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYILIFVSIGNFRIKYVEQKELNV----STVSDLESIRRFRTKIFEEYYYITGQCILLFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAIMPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAAQLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCVEMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYDVIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISGMIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNT-----SNKLAEKS-RKIXXXXXXXXXXXXXXXXXXXXXIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIEYQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVGFKFYSPXXXXXXXXXXXXXAFISLMYKSEITNKTLRKVYSFFSHPLTRLYLSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSFSLIKHITTAIFTICPIYLIVRTE-APHEHEFVGLEGCYEILEHFRNLLNVRIKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKIAESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFFSSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLASGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGYNFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKLKLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLY 3168
            M   K++++ KVMSL S+  S+YF+ LMT HN+KSIRNG KV+I+Y   EI+ SH+ ER IIF PI+AL+ FCIF +I+  T NV  + T++  AS MV+ CMTY+V+L +D+ E++E   SL+V  IL+M+TLF ++F++ ++LS++YILIF+S  N+R+K      L      ++++ L  +R+    I  +Y  +  +C+L F +Y+ GLYLRFFNSIRRKSAFLKLAQNA+A++KM+SAI++QIYWIEAIMPS+VK  FL+ +R+ D F+LVYC+ F++VSILFADIVGFT MSSNKTA QLVYLLNDLYNRFD+ G   NCEKI TLGDCYYCVSGCP+PR DHA+ CVEMGLGMC++I+ FNK HKE VNMRVG+HSGRVIAAIIGN RFRFDV+S DV IAN+LESSG+ G VHISE T+ LV HAYTF +GE L I KE+  G+ G  Q  VP+ TYFV   + +      +RI++N +      S KL E    +   DK+   FK +DEK K DL +++ LQ DPE+TV+FF +PPIN  TL F D +IE  + FH+ D +  I I S+K AL  D+IA  VY+T IL ++YV++ ++ G    + ++Y++G I  +I ++I L+YKSEI +  +R ++  F+HP++RL++ +Y+SS P+  V++L+   +M D Y Y   Y +L  F+LI N I T S+S+IK ++TA+ T   +Y++++ +  P ++E   +  C E L +       +++ F+ FQL Q+CLL+YYL +ENEKNIR+ FYA+REAEIRN EA    K+AE  LYNIIPK VF +I G          FSYAH   NAGV+FACISNFFS YYRED+K G  AL++LH IIC FDNLL+ P+Y  LEKIKT+NDCYM+ASGLN+  +    D HL  LM F+FD+   L  +NE+NIVG   FYLKIGYNFGP+TAGIIGT+KPLYDIWGDTVNVASRMYSTAP    IQV +YV + L  +F F+YRG++ +KGKG++ TYL V+  EK  +Y
Sbjct:    1 MFDHKIQKILKVMSLHSTAFSEYFHMLMTVHNVKSIRNGTKVIIIYFCSEIIVSHMGERSIIFGPIVALIAFCIFALIYILTANVDNSDTMISMASVMVVFCMTYSVILASDNEEMIEGRLSLMVANILMMFTLFHLRFLITLVLSIVYILIFMSAVNYRLKTDIPHNLTRGHLRNSLNTLAVVRQEDHHIAHKYNLLVAECLLFFAVYLVGLYLRFFNSIRRKSAFLKLAQNAQAKMKMESAIEVQIYWIEAIMPSAVKTEFLQNVRHKDFFNLVYCRQFKDVSILFADIVGFTAMSSNKTAKQLVYLLNDLYNRFDDFGNIMNCEKIATLGDCYYCVSGCPVPRSDHALCCVEMGLGMCKMIMTFNKVHKEEVNMRVGVHSGRVIAAIIGNLRFRFDVYSNDVSIANALESSGKPGKVHISEKTFKLVCHAYTFVEGEKLMIKKERKFGLEGFAQTLVPIPTYFVESVETEYDEYF-NRINVNESKIYERYSEKLVESPVPETVIDKSSLAFKMRDEKMKNDLDLIRHLQSDPEKTVQFFHSPPINTFTLTFTDTEIESHFQFHSNDHLREINIDSVKIALLFDAIACQVYSTFILISSYVLVIKSSGISKSTSLMYLSGLIMTLISSWICLVYKSEIPSDIIRGIFIIFNHPVSRLFIGIYVSSFPTFLVYTLYNQTKMYDEYEYTVEYFTLIFFSLISNCIFTGSYSVIKQMSTAVCTATSLYILLKPKLDPIDYE---ISSCQEFLINILQYKIQKLQYFYGFQLLQVCLLIYYLTQENEKNIRIFFYASREAEIRNDEARRERKVAERFLYNIIPKYVFFQITGST-DEKKTNKFSYAHTIPNAGVVFACISNFFSGYYREDFKRGLNALKVLHNIICGFDNLLRLPLYKGLEKIKTVNDCYMMASGLNASSKAYRED-HLYKLMLFSFDLLNQLAHYNEENIVGNKHFYLKIGYNFGPVTAGIIGTTKPLYDIWGDTVNVASRMYSTAP-AGKIQVSDYVHKYLATHFQFEYRGSVFMKGKGDVETYLAVKPYEKYMIY 1039          
The following BLAST results are available for this feature:
BLAST of Adenylate cyclase type vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY96.111e-5934.11adenylate cyclase 9 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY13.654e-5238.01adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY13.654e-5238.01adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY86.565e-5039.11adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ADCY86.943e-5039.11adenylate cyclase 8 [Source:HGNC Symbol;Acc:HGNC:2... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acy-15.246e-5835.33Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:Q19... [more]
acy-23.920e-4037.20Adenylyl CYclase [Source:UniProtKB/TrEMBL;Acc:O16... [more]
acy-42.209e-3934.29Adenylate cyclase [Source:UniProtKB/TrEMBL;Acc:Q9... [more]
gcy-133.728e-2535.71Receptor-type guanylate cyclase gcy-13 [Source:Un... [more]
gcy-284.685e-2436.59Receptor-type guanylate cyclase gcy-28 [Source:Un... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ac13E4.114e-5943.75gene:FBgn0022710 transcript:FBtr0074073[more]
Ac13E4.114e-5943.75gene:FBgn0022710 transcript:FBtr0100142[more]
Ac13E4.184e-5943.75gene:FBgn0022710 transcript:FBtr0332497[more]
CG433731.361e-4838.83gene:FBgn0263131 transcript:FBtr0307367[more]
CG433732.107e-4838.83gene:FBgn0263131 transcript:FBtr0307368[more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy91.008e-5535.51adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
CR339059.21.686e-5142.70pep chromosome:GRCz11:CHR_ALT_CTG3_1_31:9711779:97... [more]
CR339059.11.686e-5142.70pep chromosome:GRCz11:3:9737490:9738985:-1 gene:EN... [more]
adcy91.823e-4844.40adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
adcy1a1.414e-4738.62adenylate cyclase 1a [Source:ZFIN;Acc:ZDB-GENE-070... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ADCY94.171e-5735.16adenylate cyclase 9 [Source:NCBI gene;Acc:10012644... [more]
ADCY11.015e-4837.41adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY11.267e-4837.41adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
ADCY11.342e-4837.41adenylate cyclase 1 (brain) [Source:NCBI gene;Acc:... [more]
crabp21.636e-4639.65cellular retinoic acid binding protein 2 [Source:X... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Adcy99.828e-6035.26adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy99.828e-6035.26adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy91.049e-5740.21adenylate cyclase 9 [Source:MGI Symbol;Acc:MGI:108... [more]
Adcy81.122e-4939.11adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:134... [more]
Adcy81.163e-4939.11adenylate cyclase 8 [Source:MGI Symbol;Acc:MGI:134... [more]
back to top
BLAST of Adenylate cyclase type vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P51830|ADCY9_MOUSE6.874e-5935.26Adenylate cyclase type 9 OS=Mus musculus OX=10090 ... [more]
sp|Q9DGG6|ADCY9_CHICK1.287e-5836.24Adenylate cyclase type 9 OS=Gallus gallus OX=9031 ... [more]
sp|O60503|ADCY9_HUMAN2.935e-5834.11Adenylate cyclase type 9 OS=Homo sapiens OX=9606 G... [more]
sp|P98999|ADCY9_XENLA4.467e-5635.26Adenylate cyclase type 9 OS=Xenopus laevis OX=8355... [more]
sp|P40145|ADCY8_HUMAN3.153e-4939.11Adenylate cyclase type 8 OS=Homo sapiens OX=9606 G... [more]
back to top
BLAST of Adenylate cyclase type vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2M9J20.000e+042.50Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A2H1CUG70.000e+039.41Adenylate/guanylate cyclase catalytic domain prote... [more]
A0A183B2960.000e+041.36Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A3R7H2B80.000e+043.16Adenylate cyclase type 3 OS=Clonorchis sinensis OX... [more]
A0A4E0RZP90.000e+040.94Adenylate cyclase type OS=Fasciola hepatica OX=619... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy96.217e-6035.37adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
adcy92.935e-5834.15adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
adcy93.244e-5834.15adenylate cyclase 9 [Source:NCBI gene;Acc:10302243... [more]
ENSAMXT00000038087.12.438e-4940.69pep primary_assembly:Astyanax_mexicanus-2.0:15:306... [more]
adcy81.815e-4737.94adenylate cyclase 8 [Source:NCBI gene;Acc:10302499... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
adcy93.132e-6536.39adenylate cyclase 9 [Source:ZFIN;Acc:ZDB-GENE-0502... [more]
ENSPMAT00000008766.13.338e-4940.34pep scaffold:Pmarinus_7.0:GL476654:390837:418056:1... [more]
ADCY11.763e-4840.17adenylate cyclase 1 [Source:HGNC Symbol;Acc:HGNC:2... [more]
ENSPMAT00000006025.11.381e-4739.83pep scaffold:Pmarinus_7.0:GL480980:9262:24123:1 ge... [more]
adcy2a4.083e-4344.77adenylate cyclase 2a [Source:ZFIN;Acc:ZDB-GENE-061... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Adenylate cyclase type vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO470105.012e-5836.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458688.343e-5040.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428106.098e-4028.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342671.906e-2836.79Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO342751.054e-2542.86Guanylate cyclase [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Adenylate cyclase type vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
crebbpb2.302e-6035.05adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
crebbpb2.929e-6035.05adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
crebbpb2.961e-6035.05adenylate cyclase 9 [Source:NCBI gene;Acc:10115551... [more]
adcy91.200e-5434.06adenylate cyclase type 9 [Source:NCBI gene;Acc:101... [more]
adcy1b1.164e-5132.19adenylate cyclase type 1 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Adenylate cyclase type vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009035.10.000e+094.89SMESG000009035.1[more]
SMESG000009033.10.000e+082.31SMESG000009033.1[more]
SMESG000009036.10.000e+067.85SMESG000009036.1[more]
SMESG000050966.10.000e+055.43SMESG000050966.1[more]
SMESG000050971.10.000e+053.54SMESG000050971.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015994 ID=SMED30015994|Name=Adenylate cyclase type|organism=Schmidtea mediterranea sexual|type=transcript|length=3175bp
TAATTATTTTAAATTGGGCTTCGCAGATTTCTCGATGAAACCATAAAAGC
GAAAAAAGAAATAATGATAAGATTAAAATTAGAGGAAGTTAGCAAAGTGA
TGAGTTTAAGATCCAGTATTTTAAGTGATTACTTTTACACTTTAATGACT
AATCATAATATCAAATCTATCAGAAATGGAATGAAGGTCTTGATTCTCTA
CTGTTATTGTGAAATTGTGAGTTCCCATATTTCCGAAAGAGGAATTATTT
TTCGACCGATTTTAGCACTGGTTGTCTTTTGTATATTTTTCATTATATTT
GCAGCTACTGTTAATGTCAAAGAAACTACTACAATTATGAGATTCGCATC
GGCGATGGTAATAATTTGTATGACATATACCGTTTTGTTAGGCACTGATT
CGAGTGAATTAATGGAACTTAATTATTCCCTTGTTGTTTTGATAATTTTG
CTGATGTACACATTATTTCGGATGAAATTTATGGTTGTGATGTTATTGAG
TTTATTGTATATTTTAATATTTGTGTCAATAGGGAATTTTCGGATAAAAT
ATGTTGAGCAAAAAGAATTGAATGTTTCAACTGTTTCAGATTTAGAGTCT
ATTCGACGTTTTCGGACTAAAATTTTTGAAGAATACTATTATATTACTGG
ACAATGTATTTTGCTTTTTCTAATGTACATGACTGGACTGTATTTACGGT
TTTTTAACTCGATCCGTAGAAAATCGGCTTTCCTAAAGTTGGCTCAAAAT
GCCGAAGCCCGACTGAAGATGCAATCTGCTATTAAAATACAAATTTATTG
GATCGAGGCCATTATGCCAAGCTCCGTGAAAGAGAATTTTCTTAAACGAA
TCCGAAATAATGACATGTTTAGTTTGGTGTATTGTAAGGCTTTTGAAAAC
GTCAGTATCCTGTTTGCGGATATTGTCGGATTTACAATGATGAGTTCAAA
CAAAACTGCTGCGCAACTTGTTTATTTATTGAATGATTTGTATAATAGAT
TTGATGAGCAAGGACGTCAGACGAATTGCGAGAAAATCGGAACTCTTGGA
GATTGTTATTACTGTGTTTCCGGATGTCCAATTCCAAGAATAGATCATGC
GATAAGTTGCGTAGAAATGGGTTTGGGGATGTGTAGATTGATAGTGAAAT
TCAATAAAGACCACAAAGAAAACGTAAATATGCGTGTTGGAATCCACAGT
GGACGAGTAATTGCAGCCATAATAGGAAATCATCGGTTTAGGTTTGATGT
ATTTTCATATGATGTTATTATCGCTAACTCTTTGGAATCAAGCGGCAGAG
CTGGGTTTGTGCACATTTCAGAAGACACTTATTTACTTGTCCGTCATGCC
TACACCTTCGAAGACGGTGAAATTTTAAGTATAATGAAAGAACAAGTCCA
TGGAATTTCCGGAATGATTCAAAAATCAGTTCCACTGAGAACATACTTTG
TCATTCCTGATAAAAATAAAAATAAGCGCAAGCTTCAAAGCAGGATTTCT
CTTAACAGAAACACATCAAACAAACTTGCTGAAAAATCGAGAAAAATCTT
TTCTGATAAAGCTAAGAATTTGTTTAAAAAGAAAGATGAAAAATTCAAAG
GAGATTTGAAGATTGTGAAATGTCTACAAGATGACCCTGAAAGGACTGTT
GAATTCTTTCAAAATCCTCCAATAAATCAAATTACGTTAGCCTTTAAAGA
TCCCCAAATTGAATACCAATATTTATTTCATACAACAGACCAAATTGAAC
CGATACAAATTTATTCTATTAAAGCAGCTTTATTTATAGATTCAATTGCA
AGTATGGTCTACACAACGACTATCCTCACTGCAGCCTATGTTATGATTCC
CCAAAACGTGGGATTCAAGTTTTATTCTCCTATCATTTATGTTACCGGTT
ACATTTACATTGTCATTATCGCTTTCATTTCACTTATGTATAAAAGTGAG
ATTACCAACAAAACTTTGAGAAAGGTTTACAGTTTCTTTAGTCACCCTTT
AACAAGGTTGTATTTGAGTGTTTACATATCATCTCTGCCGAGTATTTTCG
TGTTTTCTTTATTTCAAAATGAGCAAATGCAAGATAATTATCATTATATT
ACCGCATATCTAAGCCTCACTTTGTTTGCCTTAATTGGCAATGTTATTTC
TACATCTTCCTTTAGCTTGATCAAACATATTACAACTGCAATATTTACTA
TTTGTCCTATTTACTTGATAGTTAGAACAGAAGCCCCTCATGAACACGAG
TTTGTCGGCCTTGAAGGCTGTTACGAAATATTGGAACATTTTAGAAATCT
TCTAAATGTTAGAATAAAATGTTTCTTTTCCTTTCAGCTGTTTCAAATTT
GTCTATTAGTTTATTATTTGGCAAGAGAAAATGAAAAGAATATTCGATTG
AATTTCTATGCGACAAGGGAAGCCGAAATCCGAAATGCTGAAGCGACCCA
TGCGAATAAAATCGCTGAAAGTCTTTTATACAATATAATACCGAAACAGG
TTTTCAAAGAAATTGTTGGAAAGAAATGGAGTAGCAGCAATGAGATGGCA
TTTAGCTATGCTCATGCTTTCGCGAATGCCGGAGTAATTTTTGCATGTAT
TAGTAACTTTTTCTCGTCGTATTATAGAGAGGATTATAAAGGTGGCGAAG
TGGCTCTGCGATTACTTCATACTATAATTTGCACATTTGATAATTTGTTA
AAAAAACCAATTTATTTGAAGTTAGAGAAAATTAAAACAATAAACGATTG
TTACATGTTGGCGTCGGGTTTGAACTCAGATCATGAAGAAATGGCAAGTG
ATGAGCATTTGAAAATTCTGATGACATTTGCATTTGATATGCATTATCAT
CTTCGTCTGTTTAATGAACAGAATATCGTTGGAACTTACACTTTTTATTT
GAAAATCGGTTACAATTTTGGACCAATCACAGCCGGAATAATTGGCACTT
CAAAACCACTTTATGATATTTGGGGTGACACAGTAAATGTTGCCAGCCGA
ATGTATAGTACGGCCCCATATTGTAGTTCTATACAAGTGCCTGAATATGT
TGTCGAAAAACTTAAGCTTTACTTTGACTTTAAATATCGTGGAACAATAT
CTGTGAAAGGAAAAGGTGAAATGAACACATATTTAGTAGTTCGGTCTTTA
GAAAAACCATTTTTGTATCTTAAAG
back to top

protein sequence of SMED30015994-orf-1

>SMED30015994-orf-1 ID=SMED30015994-orf-1|Name=SMED30015994-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1037bp
MIRLKLEEVSKVMSLRSSILSDYFYTLMTNHNIKSIRNGMKVLILYCYCE
IVSSHISERGIIFRPILALVVFCIFFIIFAATVNVKETTTIMRFASAMVI
ICMTYTVLLGTDSSELMELNYSLVVLIILLMYTLFRMKFMVVMLLSLLYI
LIFVSIGNFRIKYVEQKELNVSTVSDLESIRRFRTKIFEEYYYITGQCIL
LFLMYMTGLYLRFFNSIRRKSAFLKLAQNAEARLKMQSAIKIQIYWIEAI
MPSSVKENFLKRIRNNDMFSLVYCKAFENVSILFADIVGFTMMSSNKTAA
QLVYLLNDLYNRFDEQGRQTNCEKIGTLGDCYYCVSGCPIPRIDHAISCV
EMGLGMCRLIVKFNKDHKENVNMRVGIHSGRVIAAIIGNHRFRFDVFSYD
VIIANSLESSGRAGFVHISEDTYLLVRHAYTFEDGEILSIMKEQVHGISG
MIQKSVPLRTYFVIPDKNKNKRKLQSRISLNRNTSNKLAEKSRKIFSDKA
KNLFKKKDEKFKGDLKIVKCLQDDPERTVEFFQNPPINQITLAFKDPQIE
YQYLFHTTDQIEPIQIYSIKAALFIDSIASMVYTTTILTAAYVMIPQNVG
FKFYSPIIYVTGYIYIVIIAFISLMYKSEITNKTLRKVYSFFSHPLTRLY
LSVYISSLPSIFVFSLFQNEQMQDNYHYITAYLSLTLFALIGNVISTSSF
SLIKHITTAIFTICPIYLIVRTEAPHEHEFVGLEGCYEILEHFRNLLNVR
IKCFFSFQLFQICLLVYYLARENEKNIRLNFYATREAEIRNAEATHANKI
AESLLYNIIPKQVFKEIVGKKWSSSNEMAFSYAHAFANAGVIFACISNFF
SSYYREDYKGGEVALRLLHTIICTFDNLLKKPIYLKLEKIKTINDCYMLA
SGLNSDHEEMASDEHLKILMTFAFDMHYHLRLFNEQNIVGTYTFYLKIGY
NFGPITAGIIGTSKPLYDIWGDTVNVASRMYSTAPYCSSIQVPEYVVEKL
KLYFDFKYRGTISVKGKGEMNTYLVVRSLEKPFLYLK
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001054A/G_cyclase
IPR029787Nucleotide_cyclase
Vocabulary: biological process
TermDefinition
GO:0009190cyclic nucleotide biosynthetic process
GO:0035556intracellular signal transduction
Vocabulary: molecular function
TermDefinition
GO:0016849phosphorus-oxygen lyase activity
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclaseSMARTSM00044cyc_6coord: 1..175
e-value: 1.5E-43
score: 160.6
coord: 537..749
e-value: 9.5E-21
score: 84.9
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePFAMPF00211Guanylate_cyccoord: 574..766
e-value: 1.6E-37
score: 128.9
coord: 14..175
e-value: 5.9E-50
score: 169.4
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 581..722
score: 31.338
IPR001054Adenylyl cyclase class-3/4/guanylyl cyclasePROSITEPS50125GUANYLATE_CYCLASE_2coord: 22..149
score: 35.426
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 568..770
e-value: 6.1E-47
score: 161.9
IPR029787Nucleotide cyclaseGENE3DG3DSA:3.30.70.1230coord: 7..214
e-value: 1.7E-59
score: 202.5
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 12..175
IPR029787Nucleotide cyclaseSUPERFAMILYSSF55073Nucleotide cyclasecoord: 578..767
NoneNo IPR availablePANTHERPTHR45627FAMILY NOT NAMEDcoord: 9..223
NoneNo IPR availablePANTHERPTHR45627FAMILY NOT NAMEDcoord: 217..769
NoneNo IPR availablePANTHERPTHR45627:SF8ADENYLATE CYCLASE TYPE 9coord: 217..769
NoneNo IPR availablePANTHERPTHR45627:SF8ADENYLATE CYCLASE TYPE 9coord: 9..223
NoneNo IPR availableCDDcd07302CHDcoord: 579..766
e-value: 1.55005E-34
score: 127.695
NoneNo IPR availableCDDcd07302CHDcoord: 20..204
e-value: 2.24667E-49
score: 169.682
NoneNo IPR availableTMHMMTMhelixcoord: 419..441
NoneNo IPR availableTMHMMTMhelixcoord: 387..409
NoneNo IPR availableTMHMMTMhelixcoord: 569..591
NoneNo IPR availableTMHMMTMhelixcoord: 494..511
NoneNo IPR availableTMHMMTMhelixcoord: 344..366
NoneNo IPR availableTMHMMTMhelixcoord: 312..334
NoneNo IPR availableTMHMMTMhelixcoord: 89..111
NoneNo IPR availableTMHMMTMhelixcoord: 61..83
NoneNo IPR availableTMHMMTMhelixcoord: 118..135
NoneNo IPR availableTMHMMTMhelixcoord: 191..213
NoneNo IPR availableTMHMMTMhelixcoord: 139..161