G_PROTEIN_RECEP_F3_4 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F3_4 domain-containing protein
Smed IDSMED30015985
Length (bp)454
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM4 (glutamate metabotropic receptor 4 [Source:HGNC Symbol;Acc:HGNC:4596])

HSP 1 Score: 80.1073 bits (196), Expect = 1.108e-17
Identity = 40/108 (37.04%), Postives = 69/108 (63.89%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQ++  STA +L+D ++  F  R+V SD YQA A+ DI+R     +VS V  + +YG S ++ F +K +E    +CIA+ + +
Sbjct:  150 VVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSRE-DGGVCIAQSVKI 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM4 (glutamate metabotropic receptor 4 [Source:HGNC Symbol;Acc:HGNC:4596])

HSP 1 Score: 80.1073 bits (196), Expect = 1.115e-17
Identity = 40/108 (37.04%), Postives = 69/108 (63.89%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQ++  STA +L+D ++  F  R+V SD YQA A+ DI+R     +VS V  + +YG S ++ F +K +E    +CIA+ + +
Sbjct:  150 VVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSRE-DGGVCIAQSVKI 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 80.1073 bits (196), Expect = 1.214e-17
Identity = 40/103 (38.83%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA
Sbjct:  143 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIA 243          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 79.7221 bits (195), Expect = 1.441e-17
Identity = 40/103 (38.83%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA
Sbjct:  143 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIA 243          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Match: GRM5 (glutamate metabotropic receptor 5 [Source:HGNC Symbol;Acc:HGNC:4597])

HSP 1 Score: 79.7221 bits (195), Expect = 1.441e-17
Identity = 40/103 (38.83%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA
Sbjct:  143 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIA 243          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 72.0182 bits (175), Expect = 2.818e-15
Identity = 37/103 (35.92%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            VV +IGP  S  T+ +   LQ + IPQV   +T  +L+DK +  + LR+V SD +QA AI  ++ ++N  +V+V+Y    YG    +  ++ I    S +CIA
Sbjct:  129 VVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIA 231          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 72.0182 bits (175), Expect = 2.858e-15
Identity = 37/103 (35.92%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            VV +IGP  S  T+ +   LQ + IPQV   +T  +L+DK +  + LR+V SD +QA AI  ++ ++N  +V+V+Y    YG    +  ++ I    S +CIA
Sbjct:  129 VVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIA 231          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-2 (Metabotropic GLutamate receptor family [Source:UniProtKB/TrEMBL;Acc:A0A0K3AU50])

HSP 1 Score: 71.633 bits (174), Expect = 4.457e-15
Identity = 37/103 (35.92%), Postives = 59/103 (57.28%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            VV +IGP  S  T+ +   LQ + IPQV   +T  +L+DK +  + LR+V SD +QA AI  ++ ++N  +V+V+Y    YG    +  ++ I    S +CIA
Sbjct:  129 VVAVIGPGKSSSTIAVQNLLQVFRIPQVGYSATTPDLSDKEQFGYFLRVVPSDVFQAQAINRLLHHYNWTYVAVLYSAGNYGEKGFESLEKLIAHRSSSVCIA 231          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 65.855 bits (159), Expect = 3.622e-13
Identity = 38/110 (34.55%), Postives = 63/110 (57.27%), Query Frame = 1
Query:   19 KQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            KQ+   +V  ++G ++S V++ ++  L+ + I QV+  ST  +L+DK +  +  R V SD YQA A+ +I   F   +VS+VY  D YG      FK++ +  +  ICIA
Sbjct:   66 KQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEAR--KKGICIA 173          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Match: mgl-1 (Probable metabotropic glutamate receptor mgl-1 [Source:UniProtKB/Swiss-Prot;Acc:Q09630])

HSP 1 Score: 65.855 bits (159), Expect = 3.622e-13
Identity = 38/110 (34.55%), Postives = 63/110 (57.27%), Query Frame = 1
Query:   19 KQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            KQ+   +V  ++G ++S V++ ++  L+ + I QV+  ST  +L+DK +  +  R V SD YQA A+ +I   F   +VS+VY  D YG      FK++ +  +  ICIA
Sbjct:   66 KQSQKKNVAAVVGGSYSSVSVQLANLLRLFRIAQVSPASTNADLSDKNRFEYFARTVPSDDYQAMAMVEIAVKFKWSYVSLVYSADEYGELGADAFKKEAR--KKGICIA 173          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0089184)

HSP 1 Score: 73.1738 bits (178), Expect = 1.573e-15
Identity = 44/127 (34.65%), Postives = 75/127 (59.06%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGT-SLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLK 408
            V G+IG ++S V+L ++  L+ ++IPQV+  STA  L+DKT+     R V  D +Q+ A+ DI++ FN  +VS ++ + +YG   +  L KE    T+ ++CIA   K+ +  + +  D+ I  L K
Sbjct:  149 VFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEA---TERNVCIAVAEKVPSAADDKVFDSIISKLQK 272          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0332858)

HSP 1 Score: 73.1738 bits (178), Expect = 1.573e-15
Identity = 44/127 (34.65%), Postives = 75/127 (59.06%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGT-SLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLK 408
            V G+IG ++S V+L ++  L+ ++IPQV+  STA  L+DKT+     R V  D +Q+ A+ DI++ FN  +VS ++ + +YG   +  L KE    T+ ++CIA   K+ +  + +  D+ I  L K
Sbjct:  149 VFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEA---TERNVCIAVAEKVPSAADDKVFDSIISKLQK 272          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0332859)

HSP 1 Score: 72.4034 bits (176), Expect = 2.471e-15
Identity = 44/127 (34.65%), Postives = 75/127 (59.06%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGT-SLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLK 408
            V G+IG ++S V+L ++  L+ ++IPQV+  STA  L+DKT+     R V  D +Q+ A+ DI++ FN  +VS ++ + +YG   +  L KE    T+ ++CIA   K+ +  + +  D+ I  L K
Sbjct:  149 VFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYGEYGIEALHKEA---TERNVCIAVAEKVPSAADDKVFDSIISKLQK 272          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: mGluR (gene:FBgn0019985 transcript:FBtr0344897)

HSP 1 Score: 65.4698 bits (158), Expect = 4.411e-13
Identity = 33/90 (36.67%), Postives = 56/90 (62.22%), Query Frame = 1
Query:   19 KQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGT 288
            K  +   V G+IG ++S V+L ++  L+ ++IPQV+  STA  L+DKT+     R V  D +Q+ A+ DI++ FN  +VS ++ + +Y T
Sbjct:  142 KNASSGPVFGVIGGSYSSVSLQVANLLRLFHIPQVSPASTAKTLSDKTRFDLFARTVPPDTFQSVALVDILKNFNWSYVSTIHSEGSYDT 231          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Match: mtt (gene:FBgn0050361 transcript:FBtr0273327)

HSP 1 Score: 65.4698 bits (158), Expect = 6.416e-13
Identity = 31/103 (30.10%), Postives = 61/103 (59.22%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G++G A S  ++ ++  L+ + IPQV+  ST+ EL++K +  +  R + SD YQ  A+ +I++     +VS++Y++  YG    +  +E +   + +ICIA
Sbjct:  323 ISGVVGAASSVTSIQVANLLRLFRIPQVSYFSTSPELSNKQRFEYFSRTIPSDHYQVKAMVEIVKRMGWSYVSIIYEESNYGIKAFEELEELL--ARHNICIA 423          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm5b (glutamate receptor, metabotropic 5b [Source:ZFIN;Acc:ZDB-GENE-090821-6])

HSP 1 Score: 82.4185 bits (202), Expect = 1.341e-18
Identity = 45/128 (35.16%), Postives = 74/128 (57.81%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYL 423
            +VGLIGP  S V + +   LQ +NIPQ+   +T+ +L+DK+   + +R+V SD  QA A+ DI++ +N  +VS ++ +  YG S ++ FKE     +  ICIA    + +     N    L+K++ YL
Sbjct:  147 IVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKE--MAGKEGICIAHSDKIWSNAGEQNFDRLLVKLRKYL 272          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 82.0333 bits (201), Expect = 1.655e-18
Identity = 41/103 (39.81%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FKE    +Q  +CIA
Sbjct:  156 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE--LASQEGLCIA 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 82.0333 bits (201), Expect = 1.655e-18
Identity = 41/103 (39.81%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FKE    +Q  +CIA
Sbjct:  156 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE--LASQEGLCIA 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 82.0333 bits (201), Expect = 1.702e-18
Identity = 41/103 (39.81%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++++N  +VS V+ +  YG S ++ FKE   E    +CIA
Sbjct:  160 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLFKYFLRVVPSDTLQARAMLDIVKHYNWTYVSAVHTEGNYGESGMEAFKELAAE--EGLCIA 260          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Match: grm1a (glutamate receptor, metabotropic 1a [Source:ZFIN;Acc:ZDB-GENE-030131-7893])

HSP 1 Score: 82.0333 bits (201), Expect = 1.703e-18
Identity = 41/103 (39.81%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++++N  +VS V+ +  YG S ++ FKE   E    +CIA
Sbjct:  168 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLFKYFLRVVPSDTLQARAMLDIVKHYNWTYVSAVHTEGNYGESGMEAFKELAAE--EGLCIA 268          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000053241.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:79464981:79849474:-1 gene:ENSXETG00000017572.1 transcript:ENSXETT00000053241.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.307e-17
Identity = 45/139 (32.37%), Postives = 81/139 (58.27%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV---LNLETLDNDIEDLLKIKSYLTYIVYFAE 447
            V+G+IG + S V+++++  L+ + IPQV+  STA EL+D ++  F  R+V SD YQA A+ DI++     +VS +  + +YG S ++ F +K +E  S +C+A+ + +         D  I  LL+  +    I++ +E
Sbjct:  140 VIGVIGASSSSVSIMVANILRLFKIPQVSYASTAPELSDNSRYDFFSRVVPSDTYQAQAMVDIVKALKWSYVSTLASEGSYGESGVEAFIQKSREDGS-LCVAQSVKIPRDAKPGDFDKIIRRLLETSNARAVIIFASE 277          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000053239.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:2:79387181:79787707:-1 gene:ENSXETG00000017572.1 transcript:ENSXETT00000053239.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 1.321e-17
Identity = 45/139 (32.37%), Postives = 81/139 (58.27%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV---LNLETLDNDIEDLLKIKSYLTYIVYFAE 447
            V+G+IG + S V+++++  L+ + IPQV+  STA EL+D ++  F  R+V SD YQA A+ DI++     +VS +  + +YG S ++ F +K +E  S +C+A+ + +         D  I  LL+  +    I++ +E
Sbjct:  133 VIGVIGASSSSVSIMVANILRLFKIPQVSYASTAPELSDNSRYDFFSRVVPSDTYQAQAMVDIVKALKWSYVSTLASEGSYGESGVEAFIQKSREDGS-LCVAQSVKIPRDAKPGDFDKIIRRLLETSNARAVIIFASE 270          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM1 (glutamate receptor, metabotropic 1 [Source:NCBI gene;Acc:100495945])

HSP 1 Score: 78.9518 bits (193), Expect = 2.718e-17
Identity = 40/103 (38.83%), Postives = 63/103 (61.17%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ ++IPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FKE     Q  +CIA
Sbjct:  154 IAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDILQARAMLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE--MAAQEGLCIA 254          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 77.7962 bits (190), Expect = 6.548e-17
Identity = 39/103 (37.86%), Postives = 63/103 (61.17%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG   ++ FK+     +  ICIA
Sbjct:  149 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD--MSAKDGICIA 249          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Match: GRM5 (glutamate receptor, metabotropic 5 [Source:NCBI gene;Acc:100485273])

HSP 1 Score: 77.411 bits (189), Expect = 9.275e-17
Identity = 39/103 (37.86%), Postives = 63/103 (61.17%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG   ++ FK+     +  ICIA
Sbjct:  149 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGERGMEAFKD--MSAKDGICIA 249          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 80.1073 bits (196), Expect = 8.071e-18
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA   KI +    ++ D   + L K++S+L
Sbjct:  142 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIAHSYKIYSNAGEQSFD---KLLKKLRSHL 267          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 80.1073 bits (196), Expect = 8.071e-18
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA   KI +    ++ D   + L K++S+L
Sbjct:  142 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIAHSYKIYSNAGEQSFD---KLLKKLRSHL 267          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm5 (glutamate receptor, metabotropic 5 [Source:MGI Symbol;Acc:MGI:1351342])

HSP 1 Score: 80.1073 bits (196), Expect = 8.089e-18
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA   KI +    ++ D   + L K++S+L
Sbjct:  142 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIAHSYKIYSNAGEQSFD---KLLKKLRSHL 267          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 78.9518 bits (193), Expect = 1.773e-17
Identity = 40/103 (38.83%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ ++IPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S +  FKE     Q  +CIA
Sbjct:  156 IAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE--LAAQEGLCIA 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Match: Grm1 (glutamate receptor, metabotropic 1 [Source:MGI Symbol;Acc:MGI:1351338])

HSP 1 Score: 78.9518 bits (193), Expect = 1.773e-17
Identity = 40/103 (38.83%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ ++IPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S +  FKE     Q  +CIA
Sbjct:  156 IAGVIGPGSSSVAIQVQNLLQLFDIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMDAFKE--LAAQEGLCIA 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q1ZZH0|GRM4_MACFA (Metabotropic glutamate receptor 4 OS=Macaca fascicularis OX=9541 GN=GRM4 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.354e-17
Identity = 40/108 (37.04%), Postives = 69/108 (63.89%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQ++  STA +L+D ++  F  R+V SD YQA A+ DI+R     +VS V  + +YG S ++ F +K +E    +CIA+ + +
Sbjct:  150 VVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSRE-DGGVCIAQSVKI 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14833|GRM4_HUMAN (Metabotropic glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRM4 PE=2 SV=1)

HSP 1 Score: 80.1073 bits (196), Expect = 5.354e-17
Identity = 40/108 (37.04%), Postives = 69/108 (63.89%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQ++  STA +L+D ++  F  R+V SD YQA A+ DI+R     +VS V  + +YG S ++ F +K +E    +CIA+ + +
Sbjct:  150 VVGVIGASGSSVSIMVANILRLFKIPQISYASTAPDLSDNSRYDFFSRVVPSDTYQAQAMVDIVRALKWNYVSTVASEGSYGESGVEAFIQKSRE-DGGVCIAQSVKI 256          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P31424|GRM5_RAT (Metabotropic glutamate receptor 5 OS=Rattus norvegicus OX=10116 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 5.658e-17
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA   KI +    ++ D   + L K++S+L
Sbjct:  142 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIAHSYKIYSNAGEQSFD---KLLKKLRSHL 267          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3UVX5|GRM5_MOUSE (Metabotropic glutamate receptor 5 OS=Mus musculus OX=10090 GN=Grm5 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 5.658e-17
Identity = 47/131 (35.88%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA   KI +    ++ D   + L K++S+L
Sbjct:  142 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIAHSYKIYSNAGEQSFD---KLLKKLRSHL 267          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Match: sp|P41594|GRM5_HUMAN (Metabotropic glutamate receptor 5 OS=Homo sapiens OX=9606 GN=GRM5 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 5.828e-17
Identity = 40/103 (38.83%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + +R+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FK+     +  ICIA
Sbjct:  143 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKTLFKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAVHTEGNYGESGMEAFKD--MSAKEGICIA 243          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: C3ZM83 (G_PROTEIN_RECEP_F3_4 domain-containing protein (Fragment) OS=Branchiostoma floridae OX=7739 GN=BRAFLDRAFT_216282 PE=3 SV=1)

HSP 1 Score: 92.8189 bits (229), Expect = 5.644e-19
Identity = 51/140 (36.43%), Postives = 86/140 (61.43%), Query Frame = 1
Query:    4 KFSELKQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLL-KIKSY 420
            K S  +Q  + ++VG++G +FS  ++++S  L    IP ++  ST+  L+DKT+ PF LR    D  QA AI D+++YFN  +VS+VY D  YG   ++  +E++   Q+DICIA I  +    T + + E+++ K++SY
Sbjct:   84 KVSCQRQEQYSNLVGVVGASFSTSSMLVSHVLALQQIPMISYISTSHLLSDKTQYPFFLRTATPDNLQAEAIVDLLQYFNWTYVSLVYSDGGYGFEGMRSLQEEVG--QTDICIATIQQICRSST-EGEAENVIRKLQSY 220          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A085MN27 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Trichuris suis OX=68888 GN=M513_00316 PE=3 SV=1)

HSP 1 Score: 92.0485 bits (227), Expect = 1.248e-18
Identity = 52/152 (34.21%), Postives = 87/152 (57.24%), Query Frame = 1
Query:   10 SELKQTNF---YSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYLTYIVYFAE 447
            S+ +QTN     ++V +IGP  S V++ +   LQ ++IPQV   +T   L+DKT+  + +R+V SD +QA A+ DI+RYFN  +V+V+Y D  YG    +  +   +E ++ +CI    KI ++   E  D  I+ L+  +  +T  + F E
Sbjct:  151 SDQEQTNLPEMSNIVAVIGPGSSDVSIAVQNLLQVFHIPQVGYSATTKTLSDKTEFKYYMRVVPSDSWQAKAMVDIVRYFNWSYVAVIYTDGNYGEKGFEELQRNFEEEEA-LCIGVSEKIKSLAPPEEYDRLIDSLMSYRPKITVAICFCE 301          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: U4ULP4 (G_PROTEIN_RECEP_F3_4 domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=D910_08448 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 1.844e-18
Identity = 46/110 (41.82%), Postives = 71/110 (64.55%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLN 369
            +VG+IGP  S V L +   LQ ++IPQ+   +T+ +L+DK +  + LR+V SD YQA  I DI+R+F   +VS V  D+ YG S ++ F+E   E  +D+CIA+  +VL+
Sbjct:  176 LVGIIGPGSSSVALQVQNLLQLFHIPQIGYSTTSRDLSDKNRFNYFLRVVPSDYYQAQVILDIVRFFGWSYVSAVNTDENYGQSGIQAFRELADE--ADVCIAREDSVLS 283          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: A0A085NGJ1 (G_PROTEIN_RECEP_F3_4 domain-containing protein OS=Trichuris suis OX=68888 GN=M514_00316 PE=3 SV=1)

HSP 1 Score: 91.2781 bits (225), Expect = 2.444e-18
Identity = 52/152 (34.21%), Postives = 87/152 (57.24%), Query Frame = 1
Query:   10 SELKQTNF---YSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYLTYIVYFAE 447
            S+ +QTN     ++V +IGP  S V++ +   LQ ++IPQV   +T   L+DKT+  + +R+V SD +QA A+ DI+RYFN  +V+V+Y D  YG    +  +   +E ++ +CI    KI ++   E  D  I+ L+  +  +T  + F E
Sbjct:  559 SDQEQTNLPEMSNIVAVIGPGSSDVSIAVQNLLQVFHIPQVGYSATTKTLSDKTEFKYYMRVVPSDSWQAKAMVDIVRYFNWSYVAVIYTDGNYGEKGFEELQRNFEEEEA-LCIGVSEKIKSLAPPEEYDRLIDSLMSYRPKITVAICFCE 709          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Match: N6T3I2 (G_PROTEIN_RECEP_F3_4 domain-containing protein (Fragment) OS=Dendroctonus ponderosae OX=77166 GN=YQE_11191 PE=3 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 2.875e-18
Identity = 46/110 (41.82%), Postives = 71/110 (64.55%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLN 369
            +VG+IGP  S V L +   LQ ++IPQ+   +T+ +L+DK +  + LR+V SD YQA  I DI+R+F   +VS V  D+ YG S ++ F+E   E  +D+CIA+  +VL+
Sbjct:   98 LVGIIGPGSSSVALQVQNLLQLFHIPQIGYSTTSRDLSDKNRFNYFLRVVPSDYYQAQVILDIVRFFGWSYVSAVNTDENYGQSGIQAFRELADE--ADVCIAREDSVLS 205          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm2a (metabotropic glutamate receptor 2 [Source:NCBI gene;Acc:103035135])

HSP 1 Score: 82.4185 bits (202), Expect = 1.012e-18
Identity = 47/138 (34.06%), Postives = 83/138 (60.14%), Query Frame = 1
Query:   37 SVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICI---AKIINVLNLETLDNDIEDLLKIKSYLTYIVYF 441
            ++ G+IG ++S V++ ++  L+ + IPQ++  ST+ +L+DK++  +  R V  D YQA AI +I+RYFN  +VS V  +  YG + +  F+++ +  Q  ICI   AK+   ++L + D  I  LL+ KS    ++ F
Sbjct:  155 AISGVIGGSYSDVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAIAEILRYFNWTYVSTVASEGDYGETGIDAFQQEARALQ--ICIATSAKVSRSMDLHSYDQVIRSLLQ-KSNAKVVILF 289          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm5b (metabotropic glutamate receptor 5 [Source:NCBI gene;Acc:103045948])

HSP 1 Score: 81.6481 bits (200), Expect = 1.659e-18
Identity = 45/128 (35.16%), Postives = 74/128 (57.81%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYL 423
            +VGLIGP  S V + +   LQ +NIPQ+   +T+ +L+DK+   + +R+V SD  QA A+ DI++ +N  +VS ++ +  YG S +  FKE     +  ICIA    + +     N    L+K++S+L
Sbjct:  147 IVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMAAFKE--MAGKEGICIAHSDKIWSNAGEQNFDRLLMKLRSHL 272          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm1b (glutamate receptor, metabotropic 1b [Source:ZFIN;Acc:ZDB-GENE-090821-3])

HSP 1 Score: 81.2629 bits (199), Expect = 2.274e-18
Identity = 41/103 (39.81%), Postives = 63/103 (61.17%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FKE     Q  +CIA
Sbjct:  159 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARALLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE--LAAQEGLCIA 259          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 81.2629 bits (199), Expect = 2.602e-18
Identity = 46/131 (35.11%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VGLIGP  S V + +   LQ +NIPQ+   +T+ +L+DK+   + +R+V SD  QA A+ DI++ +N  +VS ++ +  YG S ++ FK+     +  ICIA   KI +    ++ D  +E   K++S+L
Sbjct:  137 IVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD--MAAKEGICIAHSDKIYSNAGEQSFDRLLE---KLRSHL 262          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Match: grm5a (metabotropic glutamate receptor 5-like [Source:NCBI gene;Acc:103040533])

HSP 1 Score: 81.2629 bits (199), Expect = 2.608e-18
Identity = 46/131 (35.11%), Postives = 78/131 (59.54%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLKIKSYL 423
            +VGLIGP  S V + +   LQ +NIPQ+   +T+ +L+DK+   + +R+V SD  QA A+ DI++ +N  +VS ++ +  YG S ++ FK+     +  ICIA   KI +    ++ D  +E   K++S+L
Sbjct:  152 IVGLIGPGSSSVAIQVQNLLQLFNIPQIAYSATSMDLSDKSLYKYFMRVVPSDAQQARAMVDIVKRYNWTYVSAIHTEGNYGESGMEAFKD--MAAKEGICIAHSDKIYSNAGEQSFDRLLE---KLRSHL 277          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: grm3 (glutamate receptor, metabotropic 3 [Source:ZFIN;Acc:ZDB-GENE-061009-13])

HSP 1 Score: 81.2629 bits (199), Expect = 4.400e-19
Identity = 43/127 (33.86%), Postives = 79/127 (62.20%), Query Frame = 1
Query:   37 SVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA---KIINVLNLETLDNDIEDLLK 408
            ++ G+IG ++S V++ ++  L+ + IPQ++  ST+ +L+DK++  F  R V  D YQA A+ +I+R+F   +VS V  DD YG + ++ F+ +++    +ICIA   K+    N +T D  I+ L++
Sbjct:  138 AIAGVIGGSYSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDFFARTVPPDFYQAKAMAEILRFFKWTYVSTVASDDDYGEAGMEAFEHEVR--SRNICIAVSEKVGRSANKKTYDGVIKALMQ 262          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007590.1 (pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 gene:ENSPMAG00000006812.1 transcript:ENSPMAT00000007590.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 75.485 bits (184), Expect = 4.961e-17
Identity = 48/142 (33.80%), Postives = 76/142 (53.52%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKET---QSDICIA---KIINVLNLETLDNDIEDLLKIKSYLTYIVYFAE 447
            VVG+IG A S V+++++  L+ + IPQ++  STA EL+D T+  +  R+V  D YQA A+ +I+      +VS V  +D YG S ++ F    ++T      +CIA   KI +       D  I  LL+  S    I++  E
Sbjct:  146 VVGVIGAAGSSVSIMVANILRLFKIPQISYASTAPELSDNTRYDYFSRVVPPDSYQAQAMVEIVSALGWNYVSTVAANDNYGESGIEYFSRFARDTGKPPGGVCIAQSLKIPHEPKPSDFDKIIHRLLETPSARAIILFANE 287          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005888.1 (pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gene:ENSPMAG00000005329.1 transcript:ENSPMAT00000005888.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.7886 bits (177), Expect = 4.306e-16
Identity = 40/120 (33.33%), Postives = 70/120 (58.33%), Query Frame = 1
Query:   28 NFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDN 387
            N   + G+IG + S V++ ++  L+ + IPQ++  ST+ +L+DK++  +  R V  D YQA A+ DI+R+FN  +VS V  +  YG + ++ F+ + +    +ICIA    V  L   D+
Sbjct:  109 NAQPIAGVIGGSDSSVSIQVANLLRLFQIPQISYASTSAKLSDKSRYDYFARTVPPDFYQAKAMADILRFFNWTYVSTVASEGDYGETGIEAFENEAR--SRNICIATSEKVGRLTGPDS 226          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008333.1 (pep scaffold:Pmarinus_7.0:GL477638:94752:105207:1 gene:ENSPMAG00000007531.1 transcript:ENSPMAT00000008333.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.151 bits (139), Expect = 5.455e-11
Identity = 33/121 (27.27%), Postives = 66/121 (54.55%), Query Frame = 1
Query:   49 LIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKE----TQSDICIAKIINVLNLETLDNDIED 399
            +IG A+S +T+  +  L   +IP ++  ++A  L+DKT+ P  +R + SD +Q+ A+ +++ +F    + ++  DD YG   L  F+    E    T   I + K I + ++ ++ N I++
Sbjct:  131 VIGDAYSFLTIPAAYTLGLKHIPMISYSASAPSLSDKTRFPTFMRTIPSDTFQSKALAELVGHFGWTWIGILGSDDDYGRQGLGKFQSDAHEYGVCTDFQIWVPKKIAIKDINSIVNVIQN 251          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Match: casr (calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE-050119-8])

HSP 1 Score: 50.447 bits (119), Expect = 2.450e-8
Identity = 25/83 (30.12%), Postives = 48/83 (57.83%), Query Frame = 1
Query:   37 SVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYG 285
            + V ++G   S V+  ++  L  + IPQV+  S++  L++K +    +R + SD+ QA+A+ +++R F    V ++  DD YG
Sbjct:  113 NTVSVVGATSSGVSTAVANLLSLFRIPQVSYASSSRVLSNKQQYRSFMRTILSDEQQATALAELVREFGWTWVGLIASDDDYG 195          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO41315 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4N3])

HSP 1 Score: 85.5001 bits (210), Expect = 2.712e-20
Identity = 46/115 (40.00%), Postives = 76/115 (66.09%), Query Frame = 1
Query:    7 FSELKQTNFYS-VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +S+LK  +  S VVG+IG A+S V++ +++  + + IPQ++  ST+ EL+DK +  F  R V  D +QA A+ D+++YFN  +VSVVY DD+YG  +L +   +   T++ IC+A
Sbjct:   80 YSQLKSESTSSRVVGIIGAAYSSVSIQIARLSRLFEIPQISYDSTSFELSDKKRFGFFSRTVPHDNFQAKALVDVLKYFNWTYVSVVYSDDSYG--ILGVDALRSAATRAGICMA 192          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO42746 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0J8])

HSP 1 Score: 71.633 bits (174), Expect = 1.995e-15
Identity = 41/103 (39.81%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            V  +IG A S ++L ++  L   +IPQ++  ST+  L++K   P  LR + SD YQA AI D++  F   +VSVV  DD YG + +   KE++K  + DIC+A
Sbjct:  102 VGAVIGGAASPISLNIANVLSVNDIPQISYSSTSVLLSNKDVYPSFLRTIPSDTYQAKAIADLLAAFQWAYVSVVASDDAYGRAGMDALKEELK--KRDICLA 202          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO42855 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D2])

HSP 1 Score: 69.3218 bits (168), Expect = 1.456e-14
Identity = 37/103 (35.92%), Postives = 62/103 (60.19%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +  +IGPA S +++ ++  L  Y+IPQ++  ST+  L+DKT+    LR V SD+YQA A+ + ++YF   +V ++  DD YG      FK   +  + ++CIA
Sbjct:    5 ISAVIGPAISWISIPIASLLGLYSIPQISYASTSRILSDKTRYRSFLRTVPSDEYQAWAMAEFVQYFEWNYVFLIASDDDYGKMGASAFKSAAR--RFNVCIA 105          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO42815 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0D3])

HSP 1 Score: 66.6254 bits (161), Expect = 1.019e-13
Identity = 36/103 (34.95%), Postives = 60/103 (58.25%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            V  +IG A S ++  ++  L   NIPQ++  ST+  L+DKT  P  LR +  D  QA  + D++ Y+   +VSVV  D+ YG   ++ FK+++K    ++CI+
Sbjct:  142 VSAVIGGAGSTISKAVNNVLSMNNIPQISYSSTSPALSDKTFFPSFLRTIPPDYIQAEVMADLVAYYGWSYVSVVATDEDYGRLGIEAFKQEVK--SRNVCIS 242          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Match: EDO33505 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS07])

HSP 1 Score: 64.6994 bits (156), Expect = 4.381e-13
Identity = 30/106 (28.30%), Postives = 61/106 (57.55%), Query Frame = 1
Query:   31 FYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +  +  ++G   S  +++ S  LQ  NIP ++  +T+DEL+     P  LR V  D++Q+ A+ D+  YFN  +++ + +D+ YG S ++ F++++      IC++
Sbjct:  101 YKPIPAVVGLGNSATSILCSNLLQIENIPLISYAATSDELSKVKAYPTFLRTVPPDRFQSQAMVDLAEYFNWSYIAAIAEDNAYGRSGIEYFRKQLD--NRGICLS 204          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: stxbp5b (syntaxin-binding protein 5 [Source:NCBI gene;Acc:101172714])

HSP 1 Score: 82.0333 bits (201), Expect = 1.142e-18
Identity = 42/103 (40.78%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +VG+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++  N  +VS V+ +  YG S +++FKE     Q  +CIA
Sbjct:  161 IVGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSVDLSDKTLFKYFLRVVPSDTLQARALLDIVKRHNWTYVSAVHTEGNYGESGMEVFKE--LAAQEGLCIA 261          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: grm1a (glutamate metabotropic receptor 1 [Source:NCBI gene;Acc:101165118])

HSP 1 Score: 82.0333 bits (201), Expect = 1.206e-18
Identity = 41/103 (39.81%), Postives = 64/103 (62.14%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            + G+IGP  S V + +   LQ +NIPQ+   +T+ +L+DKT   + LR+V SD  QA A+ DI++ +N  +VS V+ +  YG S ++ FKE    +Q  +CIA
Sbjct:  162 IAGVIGPGSSSVAIQVQNLLQLFNIPQIAYSATSIDLSDKTLYKYFLRVVPSDTLQARAMLDIVKRYNWTYVSAVHTEGNYGESGMEAFKE--LASQEGLCIA 262          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016628.2 (metabotropic glutamate receptor 4 [Source:NCBI gene;Acc:101164479])

HSP 1 Score: 81.2629 bits (199), Expect = 2.553e-18
Identity = 41/108 (37.96%), Postives = 68/108 (62.96%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQV+  STA EL+D T+  F  R+V  D YQA A+ DI++     +VS V  +  YG S +  F +K +E + D+CI++ + +
Sbjct:  155 VVGVIGASASSVSIMVANILRLFKIPQVSYASTAPELSDNTRYDFFSRVVPPDTYQAQAMVDIVKAMGWNYVSTVASEGNYGESGVDAFIQKSRE-EGDLCISQSVKI 261          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000016624.2 (metabotropic glutamate receptor 4 [Source:NCBI gene;Acc:101164479])

HSP 1 Score: 81.2629 bits (199), Expect = 2.554e-18
Identity = 41/108 (37.96%), Postives = 68/108 (62.96%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV 363
            VVG+IG + S V+++++  L+ + IPQV+  STA EL+D T+  F  R+V  D YQA A+ DI++     +VS V  +  YG S +  F +K +E + D+CI++ + +
Sbjct:  155 VVGVIGASASSVSIMVANILRLFKIPQVSYASTAPELSDNTRYDFFSRVVPPDTYQAQAMVDIVKAMGWNYVSTVASEGNYGESGVDAFIQKSRE-EGDLCISQSVKI 261          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000012378.2 (metabotropic glutamate receptor 7 [Source:NCBI gene;Acc:101165481])

HSP 1 Score: 80.4925 bits (197), Expect = 5.309e-18
Identity = 47/139 (33.81%), Postives = 79/139 (56.83%), Query Frame = 1
Query:   40 VVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLN---LETLDNDIEDLLKIKSYLTYIVYFAE 447
            VVG+IG + S V+++++  L+ + IPQ++  STA EL+D  +  F  R+V  D +QA A+ DIIR  +  +VS V  + +YG   ++ F +  KE    ICIA+ + + +   +E  D  I+ LL+       I++  E
Sbjct:  145 VVGVIGASASSVSIMVANILRLFQIPQISYASTAPELSDDRRYDFFSRVVPPDSFQAQAMVDIIRALDWTYVSTVASEGSYGEKGVEAFTQLSKEA-GGICIAQSLKIPHNPKMEDYDKTIQQLLETHHSRAVIIFANE 282          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000064459.1 (SMESG000064459.1)

HSP 1 Score: 307.375 bits (786), Expect = 8.864e-101
Identity = 151/151 (100.00%), Postives = 151/151 (100.00%), Query Frame = 1
Query:    1 PKFSELKQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYLTYIVYFAEWN 453
            PKFSELKQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYLTYIVYFAEWN
Sbjct:  127 PKFSELKQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYLTYIVYFAEWN 277          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000022915.1 (SMESG000022915.1)

HSP 1 Score: 77.0258 bits (188), Expect = 5.327e-17
Identity = 36/108 (33.33%), Postives = 66/108 (61.11%), Query Frame = 1
Query:   25 TNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIA 348
            +N  ++ G+IG + S  ++ ++  L+ ++IPQ++  ST+  L++K + PF LR + SD +Q   + +II+    K+VS++Y+D  YG    K  +E  K+ +  ICIA
Sbjct:  141 SNLRTITGVIGASSSVTSIHVASLLKLFDIPQISFFSTSPALSNKNRFPFFLRTIPSDAHQVQVMLEIIKQLQWKYVSIIYEDSNYGREAFKALQEVFKDNR--ICIA 246          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000064053.1 (SMESG000064053.1)

HSP 1 Score: 75.485 bits (184), Expect = 1.506e-16
Identity = 49/142 (34.51%), Postives = 78/142 (54.93%), Query Frame = 1
Query:   37 SVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKETQSDICIAKIINV---LNLETLDNDIEDLLKIKSYLTYIVYFAEWN 453
             +  L+GPA S +T+ +   +Q + IPQV   +T  EL+DK    + LR+V SDK Q  A+ D+IR+F   ++S++   D YG+  +K   ++IK   S ICIA  + V    +++ L N I +LL        I+ F + N
Sbjct:  138 GISALLGPASSDITIDVQNLMQLFKIPQVGYSATTIELSDKEAYKYFLRVVPSDKLQVKALVDLIRHFKWTYISLLNSVDVYGSKGIKELTDQIKSIDS-ICIANQLEVDDKDDIQVLQN-ITNLLLSDPKAKVIICFCQGN 277          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000058947.1 (SMESG000058947.1)

HSP 1 Score: 65.0846 bits (157), Expect = 7.858e-13
Identity = 36/114 (31.58%), Postives = 64/114 (56.14%), Query Frame = 1
Query:   28 NFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKET-QSDICIAKIINVL 366
            NF +V G+ G   S V++ +SKYL+  ++PQ++  ST+  L++++K P   R + SDK    AI  +++ +N  ++ V+  +  Y   L  LF + I E  Q  +C+A    +L
Sbjct:  148 NFQNVFGVFGAGNSDVSIEVSKYLRLVSLPQLSFFSTSTILSEQSKFPTFFRTIPSDKNMIKAIIHLLKRYNWNYLLVINDNSEYSQELTNLFNKNIDEVGQLQLCVAGTFTIL 261          
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Match: SMESG000058947.1 (SMESG000058947.1)

HSP 1 Score: 65.0846 bits (157), Expect = 8.330e-13
Identity = 36/114 (31.58%), Postives = 64/114 (56.14%), Query Frame = 1
Query:   28 NFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADELTDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLKLFKEKIKET-QSDICIAKIINVL 366
            NF +V G+ G   S V++ +SKYL+  ++PQ++  ST+  L++++K P   R + SDK    AI  +++ +N  ++ V+  +  Y   L  LF + I E  Q  +C+A    +L
Sbjct:  154 NFQNVFGVFGAGNSDVSIEVSKYLRLVSLPQLSFFSTSTILSEQSKFPTFFRTIPSDKNMIKAIIHLLKRYNWNYLLVINDNSEYSQELTNLFNKNIDEVGQLQLCVAGTFTIL 267          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRM41.108e-1737.04glutamate metabotropic receptor 4 [Source:HGNC Sym... [more]
GRM41.115e-1737.04glutamate metabotropic receptor 4 [Source:HGNC Sym... [more]
GRM51.214e-1738.83glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM51.441e-1738.83glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
GRM51.441e-1738.83glutamate metabotropic receptor 5 [Source:HGNC Sym... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgl-22.818e-1535.92Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-22.858e-1535.92Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-24.457e-1535.92Metabotropic GLutamate receptor family [Source:Un... [more]
mgl-13.622e-1334.55Probable metabotropic glutamate receptor mgl-1 [S... [more]
mgl-13.622e-1334.55Probable metabotropic glutamate receptor mgl-1 [S... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mGluR1.573e-1534.65gene:FBgn0019985 transcript:FBtr0089184[more]
mGluR1.573e-1534.65gene:FBgn0019985 transcript:FBtr0332858[more]
mGluR2.471e-1534.65gene:FBgn0019985 transcript:FBtr0332859[more]
mGluR4.411e-1336.67gene:FBgn0019985 transcript:FBtr0344897[more]
mtt6.416e-1330.10gene:FBgn0050361 transcript:FBtr0273327[more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm5b1.341e-1835.16glutamate receptor, metabotropic 5b [Source:ZFIN;A... [more]
grm1b1.655e-1839.81glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm1b1.655e-1839.81glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm1a1.702e-1839.81glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
grm1a1.703e-1839.81glutamate receptor, metabotropic 1a [Source:ZFIN;A... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSXETT00000053241.11.307e-1732.37pep primary_assembly:Xenopus_tropicalis_v9.1:2:794... [more]
ENSXETT00000053239.11.321e-1732.37pep primary_assembly:Xenopus_tropicalis_v9.1:2:793... [more]
GRM12.718e-1738.83glutamate receptor, metabotropic 1 [Source:NCBI ge... [more]
GRM56.548e-1737.86glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
GRM59.275e-1737.86glutamate receptor, metabotropic 5 [Source:NCBI ge... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Grm58.071e-1835.88glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm58.071e-1835.88glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm58.089e-1835.88glutamate receptor, metabotropic 5 [Source:MGI Sym... [more]
Grm11.773e-1738.83glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
Grm11.773e-1738.83glutamate receptor, metabotropic 1 [Source:MGI Sym... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1ZZH0|GRM4_MACFA5.354e-1737.04Metabotropic glutamate receptor 4 OS=Macaca fascic... [more]
sp|Q14833|GRM4_HUMAN5.354e-1737.04Metabotropic glutamate receptor 4 OS=Homo sapiens ... [more]
sp|P31424|GRM5_RAT5.658e-1735.88Metabotropic glutamate receptor 5 OS=Rattus norveg... [more]
sp|Q3UVX5|GRM5_MOUSE5.658e-1735.88Metabotropic glutamate receptor 5 OS=Mus musculus ... [more]
sp|P41594|GRM5_HUMAN5.828e-1738.83Metabotropic glutamate receptor 5 OS=Homo sapiens ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
C3ZM835.644e-1936.43G_PROTEIN_RECEP_F3_4 domain-containing protein (Fr... [more]
A0A085MN271.248e-1834.21G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
U4ULP41.844e-1841.82G_PROTEIN_RECEP_F3_4 domain-containing protein (Fr... [more]
A0A085NGJ12.444e-1834.21G_PROTEIN_RECEP_F3_4 domain-containing protein OS=... [more]
N6T3I22.875e-1841.82G_PROTEIN_RECEP_F3_4 domain-containing protein (Fr... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm2a1.012e-1834.06metabotropic glutamate receptor 2 [Source:NCBI gen... [more]
grm5b1.659e-1835.16metabotropic glutamate receptor 5 [Source:NCBI gen... [more]
grm1b2.274e-1839.81glutamate receptor, metabotropic 1b [Source:ZFIN;A... [more]
grm5a2.602e-1835.11metabotropic glutamate receptor 5-like [Source:NCB... [more]
grm5a2.608e-1835.11metabotropic glutamate receptor 5-like [Source:NCB... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
grm34.400e-1933.86glutamate receptor, metabotropic 3 [Source:ZFIN;Ac... [more]
ENSPMAT00000007590.14.961e-1733.80pep scaffold:Pmarinus_7.0:GL478498:6932:63706:-1 g... [more]
ENSPMAT00000005888.14.306e-1633.33pep scaffold:Pmarinus_7.0:GL487952:898:2919:-1 gen... [more]
ENSPMAT00000008333.15.455e-1127.27pep scaffold:Pmarinus_7.0:GL477638:94752:105207:1 ... [more]
casr2.450e-830.12calcium-sensing receptor [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO413152.712e-2040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427461.995e-1539.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428551.456e-1435.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428151.019e-1334.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO335054.381e-1328.30Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
stxbp5b1.142e-1840.78syntaxin-binding protein 5 [Source:NCBI gene;Acc:1... [more]
grm1a1.206e-1839.81glutamate metabotropic receptor 1 [Source:NCBI gen... [more]
ENSORLT00000016628.22.553e-1837.96metabotropic glutamate receptor 4 [Source:NCBI gen... [more]
ENSORLT00000016624.22.554e-1837.96metabotropic glutamate receptor 4 [Source:NCBI gen... [more]
ENSORLT00000012378.25.309e-1833.81metabotropic glutamate receptor 7 [Source:NCBI gen... [more]
back to top
BLAST of G_PROTEIN_RECEP_F3_4 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064459.18.864e-101100.00SMESG000064459.1[more]
SMESG000022915.15.327e-1733.33SMESG000022915.1[more]
SMESG000064053.11.506e-1634.51SMESG000064053.1[more]
SMESG000058947.17.858e-1331.58SMESG000058947.1[more]
SMESG000058947.18.330e-1331.58SMESG000058947.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015985 ID=SMED30015985|Name=G_PROTEIN_RECEP_F3_4 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=454bp
CCAAAGTTCAGTGAGTTGAAACAAACAAACTTCTACTCAGTTGTCGGCTT
AATTGGTCCGGCCTTTAGTCGAGTCACACTTATAATGTCTAAATATCTAC
AAAATTACAACATTCCACAAGTCACCGGCCATTCGACTGCAGATGAATTA
ACCGACAAAACAAAAAATCCATTTTTGCTTCGCTTGGTTGCGTCGGATAA
ATATCAAGCCAGCGCTATTTTCGACATTATCCGATATTTCAACGCAAAAC
ATGTCAGTGTAGTTTATCAAGACGACACGTATGGGACGAGTTTGTTGAAG
TTATTCAAAGAAAAAATCAAAGAAACACAAAGCGATATTTGTATTGCGAA
GATAATCAACGTTCTAAACTTGGAAACCTTAGATAACGACATAGAAGACC
TTTTGAAAATCAAATCTTATTTAACTTACATAGTTTACTTCGCCGAATGG
AACC
back to top

protein sequence of SMED30015985-orf-1

>SMED30015985-orf-1 ID=SMED30015985-orf-1|Name=SMED30015985-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=151bp
PKFSELKQTNFYSVVGLIGPAFSRVTLIMSKYLQNYNIPQVTGHSTADEL
TDKTKNPFLLRLVASDKYQASAIFDIIRYFNAKHVSVVYQDDTYGTSLLK
LFKEKIKETQSDICIAKIINVLNLETLDNDIEDLLKIKSYLTYIVYFAEW
N
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: INTERPRO
TermDefinition
IPR000337GPCR_3
IPR001828ANF_lig-bd_rcpt
IPR028082Peripla_BP_I
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000337GPCR, family 3PRINTSPR00248GPCRMGRcoord: 85..102
score: 34.2
coord: 17..43
score: 30.21
coord: 69..85
score: 39.15
coord: 50..69
score: 41.09
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 12..64
e-value: 6.5E-31
score: 109.3
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 65..148
e-value: 6.5E-31
score: 109.3
NoneNo IPR availablePANTHERPTHR24060METABOTROPIC GLUTAMATE RECEPTORcoord: 8..136
IPR001828Receptor, ligand binding regionPFAMPF01094ANF_receptorcoord: 6..148
e-value: 1.0E-28
score: 100.5
IPR028082Periplasmic binding protein-like ISUPERFAMILYSSF53822Periplasmic binding protein-like Icoord: 13..122