MFS domain-containing protein

Overview
NameMFS domain-containing protein
Smed IDSMED30015978
Length (bp)983
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of MFS domain-containing protein (SMED30015978) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for MFS domain-containing protein (SMED30015978) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015978

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30015978h1SMcG0004957 dd_Smed_v4_14153_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015978h1SMcG0004957 dd_Smed_v4_16395_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Category 4 cellSMED30015978h1SMcG0004957 dd_Smed_v4_14153_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 120.168 bits (300), Expect = 1.936e-30
Identity = 83/303 (27.39%), Postives = 144/303 (47.52%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGS-FVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSML-SLTLTQFFRDSLLNQIKI-PNKSH 901
            +F    +   VP+ F+++ + + V Q +G+I +  P                                      H+    + G   + +       V   L+     +LFL+   N +++ + S  YK +GQ FI +D F S++G++++IFN+  R+ WG IAD+ SY+  M+   VC   S+G+   F   +     ++ ++   VC +F C+ G F IFP IT KCF   N +++YGF+    SV+G++  +IST  L +I +  +F++  GC ML SL LT     + L Q+ +   + H
Sbjct:  185 FFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPE----------------------------------GDIHVETENLIGT--NSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMS--IVC---SLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVC-GCFMLTSLFLTFIVHKTDLAQLLVSAEREH 445          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693542:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 120.168 bits (300), Expect = 1.936e-30
Identity = 83/303 (27.39%), Postives = 144/303 (47.52%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGS-FVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSML-SLTLTQFFRDSLLNQIKI-PNKSH 901
            +F    +   VP+ F+++ + + V Q +G+I +  P                                      H+    + G   + +       V   L+     +LFL+   N +++ + S  YK +GQ FI +D F S++G++++IFN+  R+ WG IAD+ SY+  M+   VC   S+G+   F   +     ++ ++   VC +F C+ G F IFP IT KCF   N +++YGF+    SV+G++  +IST  L +I +  +F++  GC ML SL LT     + L Q+ +   + H
Sbjct:  185 FFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPE----------------------------------GDIHVETENLIGT--NSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMS--IVC---SLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVC-GCFMLTSLFLTFIVHKTDLAQLLVSAEREH 445          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: F10G7.5 (pep chromosome:WBcel235:II:4693414:4696408:1 gene:WBGene00017369.1 transcript:F10G7.5b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F10G7.5)

HSP 1 Score: 120.168 bits (300), Expect = 2.221e-30
Identity = 83/303 (27.39%), Postives = 144/303 (47.52%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGS-FVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSML-SLTLTQFFRDSLLNQIKI-PNKSH 901
            +F    +   VP+ F+++ + + V Q +G+I +  P                                      H+    + G   + +       V   L+     +LFL+   N +++ + S  YK +GQ FI +D F S++G++++IFN+  R+ WG IAD+ SY+  M+   VC   S+G+   F   +     ++ ++   VC +F C+ G F IFP IT KCF   N +++YGF+    SV+G++  +IST  L +I +  +F++  GC ML SL LT     + L Q+ +   + H
Sbjct:  199 FFTQEDLLERVPYVFIVMSIFFTVFQSIGLIFIGQPE----------------------------------GDIHVETENLIGT--NSEIRVEQARVWPQLRTTTFLVLFLSLTCNAVWVQLTSGLYKAYGQQFIDSDFFLSLIGSISSIFNAGSRVFWGAIADTTSYQFSMS--IVC---SLGAVLAFSMPLVKMVSNDVLFLATVCLMFSCIGGTFSIFPYITHKCFSKANFSVMYGFLQCAVSVAGLIAGLISTHALSEIGFEYLFIVC-GCFMLTSLFLTFIVHKTDLAQLLVSAEREH 459          
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Match: Y59A8B.21 (pep chromosome:WBcel235:V:17986260:17994546:1 gene:WBGene00013353.1 transcript:Y59A8B.21.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y59A8B.21)

HSP 1 Score: 97.4413 bits (241), Expect = 2.448e-22
Identity = 68/272 (25.00%), Postives = 128/272 (47.06%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIAT 817
            YFL   + + VP  F  + V+Y ++Q + +I++ DP  RK  +                S + +          + R +  + E  +    +++      LK+   + LF + F    +  +  + YK +G++FI++D F ++  ++A++ N+  RI WG + D  S++  +++ T   S+    F+    +T + G  A  F W+   F C+     +F   T KCFGN++ A  YG++    + SGI+ A IS   L  I Y  +F+I +
Sbjct:  192 YFLQPELLHRVPALFTKLAVIYGIMQAMALIVVCDPPFRKSRS--------------TESILEEDDEDM--DEDYERPVFDNDEDTTIQMTSSEM-----LKSPTFYCLFASLFCCSFYANMFYNLYKTYGESFIEDDMFMAMAFSIASVANAIARIGWGYLTDRTSFQIALSTATCLASV----FLLTMPMTRELGKMAFLF-WLVGTFICMGATHALFITATVKCFGNRHKANNYGYLILSTTTSGILLAAISQFYLKAIGYTYLFIITS 437          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|P37662|YHJX_ECOLI (Uncharacterized MFS-type transporter YhjX OS=Escherichia coli (strain K12) OX=83333 GN=yhjX PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 4.449e-9
Identity = 44/170 (25.88%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  278 NDFSVRNALKNCQLWIL---FLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVA--AIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTM 772
             D+++  +++  Q W+L   FLT   +G++++ V+   K+  Q+    D   S   AV   +I N +GR+  G ++D ++  +V+T   V   + + + +F         +   +F  +  + F   G   +FP++ S+ FG  NLA  YG I+ G+ +  I G+II+++
Sbjct:  203 KDYTLAESMRKPQYWMLAVMFLTACMSGLYVIGVA---KDIAQSLAHLD-VVSAANAVTVISIANLSGRLVLGILSDKIARIRVITIGQVISLVGMAALLFAPL------NAVTFFAAIACVAFNFGGTITVFPSLVSEFFGLNNLAKNYGVIYLGFGIGSICGSIIASL 362          
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Match: sp|Q51330|OXLT_OXAFO (Oxalate:formate antiporter OS=Oxalobacter formigenes OX=847 GN=oxlT PE=1 SV=3)

HSP 1 Score: 56.9954 bits (136), Expect = 8.696e-8
Identity = 50/223 (22.42%), Postives = 90/223 (40.36%), Query Frame = 2
Query:  233 IILISGEQRSGDH---ETNDFSVRNALKNCQLWILFLTFF---FNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIK 883
            +I   G+Q +         DF+    L+  Q W+L+  FF   F G+ +V  S  Y   G++        +I  ++  +FN   R  WG ++D +   K M+ +       I + V   + T  +  +  +   +   FF   G++ +FP+  S  FG    A  YGF +   + + I G  +   +     +   FLI    S ++  L  F    +   +K
Sbjct:  191 VIRFPGQQGAKKQIVVTDKDFNSGEMLRTPQFWVLWTAFFSVNFGGLLLVANSVPY---GRSLGLAAGVLTIGVSIQNLFNGGCRPFWGFVSDKIGRYKTMSVV-----FGINAVVLALFPTIAALGDVAFIAMLAIAFFTWGGSYALFPSTNSDIFGTAYSARNYGFFWAAKATASIFGGGLGAAIATNFGWNTAFLITAITSFIAFALATFVIPRMGRPVK 405          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A0H3YF06 (Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=79327 GN=slc16a-5 PE=2 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.257e-46
Identity = 100/282 (35.46%), Postives = 161/282 (57.09%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLT 847
            YF D  V   VP+CF+  G++YA +QL+G I+L  P+  +    I   N   +    + +FI++    +     +I+ +L        +H++N F    A+K    WIL+  F F G   V  +S YK FGQ FI +D + ++VG+VA+IFN+ GRI WG++ D  SY+  + S+ +  ++ +G+F  C  V +  G+  M+ IWVC +F  + G F + PAIT+K FG K +  IYG +F+  + +GI GA+ +++ L KI Y G+F I  G + ++L LT
Sbjct:  187 YFTDEKVLEKVPYCFLYTGIIYASIQLIGCIILFSPSQTEMMISILS-NTGSSNSELSTNFISETYDDE----NNIQSLL-----PKDNHDSNIF---KAIKQRDFWILWFIFMFCGTINVYATSLYKTFGQLFITSDYYLALVGSVASIFNAMGRIFWGQVMDRFSYKVAIRSIIINSTILMGTFYLCHLVPNSIGARVMFLIWVCGIFANICGIFAVMPAITAKLFGLKKVVTIYGILFSANAFAGIFGALTTSIFLSKINYFGIFGIGAGLTTIALILT 455          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HYG0 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 162.925 bits (411), Expect = 1.120e-42
Identity = 92/286 (32.17%), Postives = 156/286 (54.55%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFR 859
            YF   ++ + VP CFV +G++YA++Q +GV LL     R+PT    +   E+  E  + +   +  L +    K + +       R G+   +D +    ++  Q W+L+ TF  N   +V +++ YK+FG +   ND + +IVG++AA FN+A R+ WG + D V+YR +M  L+   ++ + +F         SG+   Y +WVC +F   +GNF +FPA  +K +G  NL + YG +FT  + SGI+GA+++T++ D I + G+FL+    S L    T  F 
Sbjct:  182 YFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGE---SDSTPGQMVRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL-------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLFE 452          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A267H5U2 (MFS domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig000477g2 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 3.435e-42
Identity = 91/286 (31.82%), Postives = 156/286 (54.55%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFR 859
            YF   ++ + VP CFV +G++YA++Q +GV LL     R+PT    +   E+  E  + +   +  L +    K + +       R G+ ++    +   ++  Q W+L+ TF  N   +V +++ YK+FG +   ND + +IVG++AA FN+A R+ WG + D V+YR +M  L+   ++ + +F         SG+   Y +WVC +F   +GNF +FPA  +K +G  NL + YG +FT  + SGI+GA+++T++ D I + G+FL+    S L    T  F 
Sbjct:  184 YFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQM---VRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL-------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLFE 454          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: A0A1I8HL50 (MFS domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 161.384 bits (407), Expect = 3.832e-42
Identity = 91/286 (31.82%), Postives = 156/286 (54.55%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFR 859
            YF   ++ + VP CFV +G++YA++Q +GV LL     R+PT    +   E+  E  + +   +  L +    K + +       R G+ ++    +   ++  Q W+L+ TF  N   +V +++ YK+FG +   ND + +IVG++AA FN+A R+ WG + D V+YR +M  L+   ++ + +F         SG+   Y +WVC +F   +GNF +FPA  +K +G  NL + YG +FT  + SGI+GA+++T++ D I + G+FL+    S L    T  F 
Sbjct:  182 YFDQPAIIDRVPSCFVFLGLIYALMQAVGVALL-----RRPTAAELEERQELVGEAGDDTAAQETALDEGSPSKPVAMETSEHGNRGGELDSTPGQM---VRKPQFWLLWATFLVNSQSVVYINTQYKSFGLSKGLNDHYLAIVGSLAAAFNAASRVMWGHLHDRVAYRALMFVLSFGMAVLMSTFTL-------SGAPWYYLLWVCAMFSLFAGNFALFPAACAKLYGQTNLTVNYGLLFTANATSGIIGALLTTVLKDAIGWLGLFLLGAAFSTLGAVFTLLFE 452          
BLAST of MFS domain-containing protein vs. TrEMBL
Match: W4XBI5 (MFS domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 162.155 bits (409), Expect = 4.133e-42
Identity = 95/309 (30.74%), Postives = 158/309 (51.13%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETN-----------------------DFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFR 859
            ++   S+ + VP  FVL G +Y V+Q++GV+LL DP    P  G+          + +   +A+           I     +G    G  E +                       D   +  ++    W+L+ TF  NG  I+ +SS YK +GQ FI++D F ++VG+ AA+FN+ GR+ WG +AD  SY+  M  LT   ++ + + V   Y     G  AM+F+W+C +FF  SGNF +FP  T++ FG+K +   YG +FT  ++S  +GA++ + + + + + G+F++  G S++ L LT FFR
Sbjct:  186 FYDQDSILDKVPTSFVLQGGIYLVIQIVGVLLLKDP----PVNGVNNSLYNDESGLLDAQTVARSTT--------IDASEPNGPTEEGSEEDHTKPFPFGIPFPVDNGKDTKASGLDLPPKVMVRTTAFWLLWATFLVNGQGIMFISSLYKAYGQMFIQDDHFLALVGSFAAVFNAGGRLFWGWLADRFSYKLAMILLTGSNAIFLLTLVAAQY-----GGRAMFFVWICGIFFTFSGNFALFPTATARAFGSKYIGPNYGIVFTSVALSSALGAVLVSTLHEHLSWFGMFMLMGGFSIIGLVLTFFFR 477          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060698.1 (SMESG000060698.1)

HSP 1 Score: 538.11 bits (1385), Expect = 0.000e+0
Identity = 286/301 (95.02%), Postives = 286/301 (95.02%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKIPNKSHS 904
            YFLDSSV NNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMNNEINIEITNISFIAK             IILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIK PNKSHS
Sbjct:  172 YFLDSSVLNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMNNEINIEITNISFIAK-------------IILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKNPNKSHS 459          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060698.1 (SMESG000060698.1)

HSP 1 Score: 526.939 bits (1356), Expect = 0.000e+0
Identity = 280/301 (93.02%), Postives = 281/301 (93.36%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKIPNKSHS 904
            YFLDSSV NNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMNNEINIEITNISFIA                  +GEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIK PNKSHS
Sbjct:  172 YFLDSSVLNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMNNEINIEITNISFIA------------------NGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKNPNKSHS 454          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060694.1 (SMESG000060694.1)

HSP 1 Score: 320.087 bits (819), Expect = 9.917e-107
Identity = 168/299 (56.19%), Postives = 215/299 (71.91%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHETNDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKIPNKS 898
            YF+D SV + VPFCFVLIG MYA++QL+GV++LTDPT  K    +C  N  +           K+       LK         E +S   E  DF+V+ A+KNC+ WIL  TFFFNG+FIVI SSYYK+FGQTFI +D++FSIVGAVAAIFNS GRI WG + D  SYRKVMTSLTV KSL IGSF FC ++ ++ G++ MYF+WVC+LFFCLSG+FG+FPAITS+CFGNKNLAIIYG I   YS+S I+GA+IS+++L +I+YGGVFLIA   S+ S  LTQ FR+S+ +++   +K 
Sbjct:  189 YFVDDSVLDKVPFCFVLIGGMYAIIQLIGVVMLTDPTPDKEHKEMCSDNEILTDIEF------KIQSDDAEMLK---------ETKSFSKEF-DFNVKEAVKNCRFWILSFTFFFNGMFIVIHSSYYKSFGQTFISDDRYFSIVGAVAAIFNSVGRIIWGTLVDFFSYRKVMTSLTVLKSLFIGSFFFCQFIEAEVGAKIMYFLWVCFLFFCLSGSFGLFPAITSQCFGNKNLAIIYGLIVISYSISAIIGALISSLLLPRIQYGGVFLIAVVSSLCSTVLTQCFRNSITDKLHSKDKE 471          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060699.1 (SMESG000060699.1)

HSP 1 Score: 288.115 bits (736), Expect = 2.744e-94
Identity = 153/301 (50.83%), Postives = 205/301 (68.11%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFIAKLVLSKC*SLKHIRIILISGEQRSGDHET--NDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKIPNKS 898
            YF + +V NNVPFCFV+IG  YA++QL+GVILL D   +KP+    Q+ N             +L+ ++   LK +  I    +Q   D +    D SV+ A+K+ +LWIL  TFF NGI I+I+SS YK+FGQTFI ND++FSIVGAVAAIFNS GR+ WGR+ D +SYRK+MT LT+  S+ +GSF FC  V  + G   MY IWVC LFFCLSG+F +FPAITS+CFG  N+AIIYG +F G++VSG++GA+I + +L  I YGG+F++AT  S++SL LTQFF     N+  +P K 
Sbjct:  184 YFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREEKQLKNG-----------ERLLDNEAKGLKELPEI----KQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSGGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPRP-FNE-DLPEKP 467          
BLAST of MFS domain-containing protein vs. Planmine SMEST
Match: SMESG000060699.1 (SMESG000060699.1)

HSP 1 Score: 286.574 bits (732), Expect = 1.754e-93
Identity = 152/304 (50.00%), Postives = 205/304 (67.43%), Query Frame = 2
Query:    2 YFLDSSVRNNVPFCFVLIGVMYAVLQLLGVILLTDPTLRKPTTGICQMXXXXXXXXXXXSFI---AKLVLSKC*SLKHIRIILISGEQRSGDHET--NDFSVRNALKNCQLWILFLTFFFNGIFIVIVSSYYKNFGQTFIKNDKFFSIVGAVAAIFNSAGRITWGRIADSVSYRKVMTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFPAITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIATGCSMLSLTLTQFFRDSLLNQIKIPNKS 898
            YF + +V NNVPFCFV+IG  YA++QL+GVILL D   +KP+  +         E      +    +L+ ++   LK +  I    +Q   D +    D SV+ A+K+ +LWIL  TFF NGI I+I+SS YK+FGQTFI ND++FSIVGAVAAIFNS GR+ WGR+ D +SYRK+MT LT+  S+ +GSF FC  V  + G   MY IWVC LFFCLSG+F +FPAITS+CFG  N+AIIYG +F G++VSG++GA+I + +L  I YGG+F++AT  S++SL LTQFF     N+  +P K 
Sbjct:  184 YFTNETVLNNVPFCFVIIGTAYAIIQLIGVILLMDSAFKKPSREVRLTLINSTKENEVEKQLKNGERLLDNEAKGLKELPEI----KQAKLDPKVLLTDSSVKEAIKDKRLWILCSTFFLNGIVIIIISSLYKSFGQTFISNDRYFSIVGAVAAIFNSGGRLVWGRLLDKISYRKMMTILTISMSVMMGSFYFCGLVKHEMGVLIMYAIWVCLLFFCLSGSFAMFPAITSQCFGTTNMAIIYGIVFLGFAVSGVIGALICSSLLSLINYGGLFIVATLSSIISLVLTQFFPRP-FNE-DLPEKP 481          
The following BLAST results are available for this feature:
BLAST of MFS domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F10G7.51.936e-3027.39pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
F10G7.51.936e-3027.39pep chromosome:WBcel235:II:4693542:4696408:1 gene:... [more]
F10G7.52.221e-3027.39pep chromosome:WBcel235:II:4693414:4696408:1 gene:... [more]
Y59A8B.212.448e-2225.00pep chromosome:WBcel235:V:17986260:17994546:1 gene... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|P37662|YHJX_ECOLI4.449e-925.88Uncharacterized MFS-type transporter YhjX OS=Esche... [more]
sp|Q51330|OXLT_OXAFO8.696e-822.42Oxalate:formate antiporter OS=Oxalobacter formigen... [more]
back to top
BLAST of MFS domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0H3YF062.257e-4635.46Slc16a-5 (Fragment) OS=Schmidtea mediterranea OX=7... [more]
A0A1I8HYG01.120e-4232.17MFS domain-containing protein OS=Macrostomum ligna... [more]
A0A267H5U23.435e-4231.82MFS domain-containing protein (Fragment) OS=Macros... [more]
A0A1I8HL503.832e-4231.82MFS domain-containing protein OS=Macrostomum ligna... [more]
W4XBI54.133e-4230.74MFS domain-containing protein OS=Strongylocentrotu... [more]
back to top
BLAST of MFS domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of MFS domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060698.10.000e+095.02SMESG000060698.1[more]
SMESG000060698.10.000e+093.02SMESG000060698.1[more]
SMESG000060694.19.917e-10756.19SMESG000060694.1[more]
SMESG000060699.12.744e-9450.83SMESG000060699.1[more]
SMESG000060699.11.754e-9350.00SMESG000060699.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015978 ID=SMED30015978|Name=MFS domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=983bp
ATATTTTTTGGATTCTTCAGTTCGGAATAATGTTCCATTTTGTTTTGTTT
TAATTGGAGTAATGTATGCTGTACTGCAGCTTTTGGGAGTGATTCTTCTA
ACCGACCCTACACTTAGAAAGCCAACTACAGGAATATGTCAAATGAACAA
TGAAATAAATATTGAAATTACAAATATTTCATTTATCGCAAAGTTGGTTT
TGTCTAAATGTTGATCCTTGAAACATATTAGAATCATCTTAATAAGCGGT
GAACAGAGATCCGGTGATCACGAAACGAACGACTTCTCCGTTAGAAATGC
ATTAAAAAATTGTCAACTTTGGATTTTATTTTTGACATTTTTTTTCAATG
GAATTTTTATTGTCATTGTTTCGTCTTATTACAAGAATTTCGGACAGACA
TTTATTAAAAATGATAAATTTTTCTCAATCGTTGGTGCTGTTGCTGCTAT
ATTCAATTCAGCGGGGCGGATAACATGGGGTCGTATAGCCGATTCGGTGT
CATATAGGAAAGTTATGACGAGTCTCACGGTTTGTAAATCTCTGTCAATT
GGGTCGTTTGTTTTCTGCAGTTACGTCACTTCAAAATCCGGAAGTGAGGC
GATGTATTTCATATGGGTTTGTTGGCTTTTCTTTTGCTTATCTGGCAATT
TTGGAATATTTCCTGCGATCACTTCAAAATGTTTTGGAAATAAAAACTTG
GCAATTATTTACGGATTCATCTTTACCGGCTATTCTGTCTCTGGTATTGT
TGGTGCAATCATATCCACAATGGTTCTTGACAAGATCCGGTATGGAGGAG
TGTTTTTAATCGCAACCGGGTGCAGTATGCTAAGCCTAACCCTCACTCAA
TTTTTCAGAGATTCATTATTGAATCAAATAAAAATTCCAAACAAATCACA
TTCCTAGCTCTGGAAATGTACTGAAACTTGTAATAACGGCTGAATACCAA
ATTGTTACTTTATAATTACATATATTATTTGAG
back to top

protein sequence of SMED30015978-orf-1

>SMED30015978-orf-1 ID=SMED30015978-orf-1|Name=SMED30015978-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=131bp
MTSLTVCKSLSIGSFVFCSYVTSKSGSEAMYFIWVCWLFFCLSGNFGIFP
AITSKCFGNKNLAIIYGFIFTGYSVSGIVGAIISTMVLDKIRYGGVFLIA
TGCSMLSLTLTQFFRDSLLNQIKIPNKSHS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0022857transmembrane transporter activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000018Category 4 cell
Vocabulary: INTERPRO
TermDefinition
IPR036259MFS_trans_sf
IPR020846MFS_dom
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: biological process
TermDefinition
GO:0055085transmembrane transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:1.20.1250.20coord: 2..130
e-value: 3.4E-11
score: 44.5
NoneNo IPR availablePANTHERPTHR11360MONOCARBOXYLATE TRANSPORTERcoord: 17..108
NoneNo IPR availablePANTHERPTHR11360:SF3OXALATE/FORMATE ANTIPORTERcoord: 17..108
NoneNo IPR availableCDDcd17353MFS_OFA_likecoord: 14..114
e-value: 6.72414E-19
score: 78.806
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 30..52
NoneNo IPR availableTMHMMTMhelixcoord: 91..113
IPR036259MFS transporter superfamilySUPERFAMILYSSF103473MFS general substrate transportercoord: 10..115