FAST kinase domain-containing protein 1, mitochondrial

Overview
NameFAST kinase domain-containing protein 1, mitochondrial
Smed IDSMED30015974
Length (bp)1787
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of FAST kinase domain-containing protein 1, mitochondrial (SMED30015974) t-SNE clustered cells

Violin plots show distribution of expression levels for FAST kinase domain-containing protein 1, mitochondrial (SMED30015974) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of FAST kinase domain-containing protein 1, mitochondrial (SMED30015974) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for FAST kinase domain-containing protein 1, mitochondrial (SMED30015974) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015974

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30015974SMESG000064523.1 SmedASXL_010966SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
cilated neuronSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015974SMESG000064523.1 Contig18055newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30015974SMESG000064523.1 Contig18055uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30015974SMESG000064523.1 dd_Smed_v6_8917_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30015974SMESG000064523.1 dd_Smed_v4_8917_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: CCDC173 (coiled-coil domain containing 173 [Source:HGNC Symbol;Acc:HGNC:25064])

HSP 1 Score: 167.162 bits (422), Expect = 3.174e-44
Identity = 174/524 (33.21%), Postives = 292/524 (55.73%), Query Frame = 2
Query:  140 KFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVK---AQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVID-HCEKGGRNTYPLRVAAAKXXXXXXXXX-XXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVW 1696
            K D++ V ++  +EW R+Q ++ +   EA   + E++ ++++   SQE+VK W+NT  G +++KL  +K R E  E ER+ +D+ E +Y+  +R+KAIE+AK  Q+YQT+RVKNFHS LL S V+KER+AQIE ++    ++   D  ++ + +   E+A K +QEK  K   + RE +   K    Q+K ++E  E+ +     + E I+R    + +E ++  + +REE    ++ +L+ +QD   ++ +E+ + EEEDE++R F  AKK+++++   KE E +   +   E I N LS  LK K+D+ED  I   I+E E ++   E EKD K +  L++I E+R   M+  E E+   K    + L+A  +AD I  E+E  ++     E + +   H+ Q    K + + +   +L      + L+ ++EK FQ+YA+ VI+   E   +  YPL  A  +G GGG GPV +  G +RPSYQ +D   V+L  + +   K      N   +   LGF W
Sbjct:   41 KVDLQQVTIIPHDEWKRIQDSLDRLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDLEEEIYKQGKRKKAIENAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRK----SKIKSDKKWEEQLKLNIEKAFKEEQEKAEK---RHRERVALAKDHLKQIKEHEEEEERRKKYEEKDAEEIKRQNALYEIEMRKKLEKKREEMHESRRRFLEHMQDKHIIKAVEQQQQEEEDEKMRKFIKAKKRLIQMGKEKEAETHRLMEKRRERIHNFLSELLKEKLDNEDMIIARDIAEAEAEWEKREREKDEKNKAELKTIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLTEALVAEKEKEFQDYAREVIELESETTNKYIYPLVKAVQEGPGGGRGPVFVDRGGLRPSYQANDVTGVQLPFYNSQGPK-----YNFQKSKRRLGFTW 552          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Human
Match: CCDC173 (coiled-coil domain containing 173 [Source:HGNC Symbol;Acc:HGNC:25064])

HSP 1 Score: 73.1738 bits (178), Expect = 1.545e-14
Identity = 40/88 (45.45%), Postives = 60/88 (68.18%), Query Frame = 2
Query:  386 DVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAK 649
            D+ E +Y+  +R+KAIE+AK  Q+YQT+RVKNFHS LL S V+KER+AQIE ++    ++   D  ++ + +   E+A K +QEK  K
Sbjct:   24 DLEEEIYKQGKRKKAIENAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRK----SKIKSDKKWEEQLKLNIEKAFKEEQEKAEK 107          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: ccdc173 (coiled-coil domain containing 173 [Source:ZFIN;Acc:ZDB-GENE-081104-457])

HSP 1 Score: 230.335 bits (586), Expect = 1.224e-67
Identity = 197/527 (37.38%), Postives = 309/527 (58.63%), Query Frame = 2
Query:  146 DIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQ--LTECNRDVGFQTKAQRE---FEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQR--LKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEI---LNCDSTNDNLGFVW 1696
            ++R V VLSK+EW RLQ +++             E+RE + + S+++VK+WSNT+ G RQKKL  +K+R  IEE+ERK ID+ EA YQA+ R++AIE AK + YYQTDRVK FH AL+ +EVLKEREAQIELKR++Q    + +RD+  +  ++ E    EE  KA Q+K   Q I     +E +K Q+  ++  +E+ER +   E E I RL   H  E+   ++ ++ E+R  LK    L   +++ K  E ++L  +EE+E+ +  A+ K+KM+K+R  K++E++ E Q H E I  KL+ Q +  + +E+  I  A+SE+EE+   ++ EK++K  +ML +I  HR    +  E +    KQ+ L+ L A+KEAD I  E + RR +    E K L   ++ +    +   + +  ++ + +E++   + +EEK FQ YAK+VI+  E+ GRNTYPL  AA    G G G     G +RPSY   D   V++ ++  +  +NIKE+    +   +   LGF W
Sbjct:   34 NLRQVVVLSKSEWQRLQDSVNGINHHNRSVMAAAEQREALHKRSKDIVKNWSNTIAGQRQKKLEAKKIREAIEEEERKLIDIEEAKYQAQMRKEAIEKAKTQMYYQTDRVKGFHGALMLAEVLKEREAQIELKRMKQNATKDIDRDMLAEMASREEQALLEEQKKALQKKQEHQAI-----VESLKQQIVDHELEKEQERQEVKREAEEIERLRNLHLWEQAMKERKKQGEKRSILKAHRDLLTNREMMKATEAQKL--QEEEEKCKQLASHKEKMMKMRKEKQEEIFRELQRHRETIIQKLAVQKQQLISNEEEIIAKAVSEREERLTREQQEKEKKHTDMLNAIAAHRESMRQEQERKVEEEKQKALEMLNAKKEADQIFMEKQQRRAQKAREEGKTLQDLYIQEMAEKRAKHQRTKKDQQEFVEKSNAFIIEEEKQFQTYAKQVIETAERAGRNTYPLIKAA--REGIGGGLGPVFGGLRPSYLVHDESGVQMPSYLNSRTQNIKELNETSDIQQSKKRLGFTW 551          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Match: ccdc173 (coiled-coil domain containing 173 [Source:ZFIN;Acc:ZDB-GENE-081104-457])

HSP 1 Score: 164.081 bits (414), Expect = 1.027e-44
Identity = 141/350 (40.29%), Postives = 219/350 (62.57%), Query Frame = 2
Query:  146 DIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQ--LTECNRDVGFQTKAQRE---FEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQR--LKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHR 1174
            ++R V VLSK+EW RLQ +++             E+RE + + S+++VK+WSNT+ G RQKKL  +K+R  IEE+ERK ID+ EA YQA+ R++AIE AK + YYQTDRVK FH AL+ +EVLKEREAQIELKR++Q    + +RD+  +  ++ E    EE  KA Q+K   Q I     +E +K Q+  ++  +E+ER +   E E I RL   H  E+   ++ ++ E+R  LK    L   +++ K  E ++L  +EE+E+ +  A+ K+KM+K+R  K++E++ E Q H E I  KL+ Q +  + +E+  I  A+SE+EE+   ++ EK++K  +ML +I  HR
Sbjct:   34 NLRQVVVLSKSEWQRLQDSVNGINHHNRSVMAAAEQREALHKRSKDIVKNWSNTIAGQRQKKLEAKKIREAIEEEERKLIDIEEAKYQAQMRKEAIEKAKTQMYYQTDRVKGFHGALMLAEVLKEREAQIELKRMKQNATKDIDRDMLAEMASREEQALLEEQKKALQKKQEHQAI-----VESLKQQIVDHELEKEQERQEVKREAEEIERLRNLHLWEQAMKERKKQGEKRSILKAHRDLLTNREMMKATEAQKL--QEEEEKCKQLASHKEKMMKMRKEKQEEIFRELQRHRETIIQKLAVQKQQLISNEEEIIAKAVSEREERLTREQQEKEKKHTDMLNAIAAHR 376          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Match: igf1r (insulin like growth factor 1 receptor [Source:Xenbase;Acc:XB-GENE-484032])

HSP 1 Score: 197.978 bits (502), Expect = 2.096e-55
Identity = 191/529 (36.11%), Postives = 293/529 (55.39%), Query Frame = 2
Query:  143 FDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKR--LRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAE-----AKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAA-AKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDN---LGFVW 1696
             D+  V V  K EW R+  N +  E EA +   EK++RE +   S+E+VK+W+NT+ G RQK+L  +KLR E EE+E++ ID+ EA +Q ++R++AIE A++KQYYQ D+VK FHSALL +EV KERE QIELK   L Q  +  +D       QRE EE +  DQ K  KQ+   R N   +  Q+   K   E E+     EGE I+R    + +E +RL Q + EE++  K+ +L  I D   ++ +E+ K EE DE +R F  AK+KM  L+  KE E+  + + + + I   LSA  K K DDE+ R   A++++E K   +  EK+ K +  +++I EHR    +  E E+  +K   L +L + KE+D +  + +  ++K+R AE      + +    +A+   + +SD  +   ++K  ++++  L +EE  FQEYAK+VID   K GRN Y L+ AA +   GG        G +RPSY   D   V+L ++ +   + IK +            LGF W
Sbjct:   36 VDLMQVTVFPKAEWERIVSNTNSLEQEARQIYEEKKEREALHLHSKEVVKNWTNTIAGLRQKRLESKKLREEKEEEEKRLIDLEEAKFQEQKRKEAIEKARLKQYYQNDKVKTFHSALLLTEVAKERELQIELKNKMLAQSKKKEKDW------QRELEEGIAEDQSKALKQLTDRRNNASELLKQIDEQKHKAELEKLGNHREGEEIQRQTKDYEMEMRRLGQRKLEEKQEIKRAHLAHISDRDFVRALEKQKEEENDEMLRRFVLAKRKMGNLKKAKEAEMNRQVEENRDRITELLSAWYKQKTDDEEERTAKAMADQEAKQKKEAQEKEEKIKADIKAITEHRLADRKQKEKEEKEAKMEALQTLYSMKESDRLFLQQQ--QEKMRKAEEECKNVQAVQVQQMAEKTVMAQSDREA---EIKYAKQSEFFLAKEEDEFQEYAKQVIDVVTKAGRNPYALKKAAKSGTGGGHGPVYTGRGGIRPSYLVQDTSGVQLPSYNSGTTQEIKGLYESGDIQHGKRKLGFTW 553          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Match: Ccdc173 (coiled-coil domain containing 173 [Source:MGI Symbol;Acc:MGI:1923100])

HSP 1 Score: 122.479 bits (306), Expect = 4.580e-29
Identity = 162/524 (30.92%), Postives = 279/524 (53.24%), Query Frame = 2
Query:  140 KFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDS---LMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDH-CEKGGRNTYPLRVAAAKXXXXXXXXX-XXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVW 1696
            K D++ + ++   EW R++ ++++   EA   + E+  ++++   SQELVK W+NT  G +++KL  ++ R E  E ERK +D+ E +Y+  +R+KAIE A+  Q++QT+RVK FHS LL S V+KER+ QI+ K+         D  ++ + +   E+A K DQEK  K+  +     E    Q++ +KE  E  +     + E ++R  + + +E ++    ++EE    ++  L  + +   ++ +E+ + EEEDE+IR F  AKK+++++R+ K+ E +   +   E I N LS  +K K+D ED  I   ISE + +    E EK  K Q  L++I E+R   M+  E E+   +QR +++   L A  +AD I +E E  +      E   +   H+ Q    K + +     +L        L  ++EK F++YA+ VI+   E   +  YP+  A  +GVGGG GP  +  G +RPSYQ +D   V+L  +++  +K      +   +   LGF W
Sbjct:   35 KVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGMKEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKK----NAVKSDKKWEEQVKLNDEKAFKEDQEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEE---RQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEGVGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSK----YNDFQKSKRRLGFTW 547          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|Q0VFZ6|CC173_HUMAN (Coiled-coil domain-containing protein 173 OS=Homo sapiens OX=9606 GN=CCDC173 PE=2 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 1.524e-43
Identity = 174/524 (33.21%), Postives = 292/524 (55.73%), Query Frame = 2
Query:  140 KFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVK---AQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVID-HCEKGGRNTYPLRVAAAKXXXXXXXXX-XXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVW 1696
            K D++ V ++  +EW R+Q ++ +   EA   + E++ ++++   SQE+VK W+NT  G +++KL  +K R E  E ER+ +D+ E +Y+  +R+KAIE+AK  Q+YQT+RVKNFHS LL S V+KER+AQIE ++    ++   D  ++ + +   E+A K +QEK  K   + RE +   K    Q+K ++E  E+ +     + E I+R    + +E ++  + +REE    ++ +L+ +QD   ++ +E+ + EEEDE++R F  AKK+++++   KE E +   +   E I N LS  LK K+D+ED  I   I+E E ++   E EKD K +  L++I E+R   M+  E E+   K    + L+A  +AD I  E+E  ++     E + +   H+ Q    K + + +   +L      + L+ ++EK FQ+YA+ VI+   E   +  YPL  A  +G GGG GPV +  G +RPSYQ +D   V+L  + +   K      N   +   LGF W
Sbjct:   41 KVDLQQVTIIPHDEWKRIQDSLDRLTREAACLRAERKAKKEMHLRSQEVVKHWTNTYAGMKEQKLEAKKKRDEEIEAERQILDLEEEIYKQGKRKKAIENAKQYQFYQTERVKNFHSGLLLSRVMKERDAQIEFRK----SKIKSDKKWEEQLKLNIEKAFKEEQEKAEK---RHRERVALAKDHLKQIKEHEEEEERRKKYEEKDAEEIKRQNALYEIEMRKKLEKKREEMHESRRRFLEHMQDKHIIKAVEQQQQEEEDEKMRKFIKAKKRLIQMGKEKEAETHRLMEKRRERIHNFLSELLKEKLDNEDMIIARDIAEAEAEWEKREREKDEKNKAELKTIAEYRAIVMKNKEEEERQRKIEAKEQLLAVMKADQIFWEHEKEKKCKADKEHQEVQDAHIQQMAKNKFNAKQAKQAELDYCRLTEALVAEKEKEFQDYAREVIELESETTNKYIYPLVKAVQEGPGGGRGPVFVDRGGLRPSYQANDVTGVQLPFYNSQGPK-----YNFQKSKRRLGFTW 552          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Match: sp|A0JLY1|CC173_MOUSE (Coiled-coil domain-containing protein 173 OS=Mus musculus OX=10090 GN=Ccdc173 PE=2 SV=1)

HSP 1 Score: 122.479 bits (306), Expect = 3.204e-28
Identity = 162/524 (30.92%), Postives = 279/524 (53.24%), Query Frame = 2
Query:  140 KFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDS---LMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDH-CEKGGRNTYPLRVAAAKXXXXXXXXX-XXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVW 1696
            K D++ + ++   EW R++ ++++   EA   + E+  ++++   SQELVK W+NT  G +++KL  ++ R E  E ERK +D+ E +Y+  +R+KAIE A+  Q++QT+RVK FHS LL S V+KER+ QI+ K+         D  ++ + +   E+A K DQEK  K+  +     E    Q++ +KE  E  +     + E ++R  + + +E ++    ++EE    ++  L  + +   ++ +E+ + EEEDE+IR F  AKK+++++R+ K+ E +   +   E I N LS  +K K+D ED  I   ISE + +    E EK  K Q  L++I E+R   M+  E E+   +QR +++   L A  +AD I +E E  +      E   +   H+ Q    K + +     +L        L  ++EK F++YA+ VI+   E   +  YP+  A  +GVGGG GP  +  G +RPSYQ +D   V+L  +++  +K      +   +   LGF W
Sbjct:   35 KVDLQQITIIPHAEWERIRDSLNRLTREAAVLRAERAAKKKMHVKSQELVKHWTNTYAGMKEQKLKAKQKRDEEIEAERKVLDLEEEIYKEGERKKAIESARQCQFHQTERVKRFHSGLLLSRVMKERDVQIQYKK----NAVKSDKKWEEQVKLNDEKAFKEDQEKEEKRRRERVALAEDHLKQIEEHKEEEEARKKSEEKDAEEMKRQNLLYEIEMKKNLSKKQEEIDTNRKLLLDNMHNKNIIRAVEQQQQEEEDEKIRKFIKAKKRLIQMRMDKDAETHRLMEERRERINNFLSKLIKEKLDTEDLIIARDISEADAELEKREKEKHEKNQADLKAIAEYRASVMKNKEEEE---RQRKIEAKEQLQAVLKADKIFQELEKEKSLKVTREKLEIQDAHIQQIAINKYNAKQMKEEELDYWRLTDALTVEKEKEFEKYAREVINFESESTKKYAYPMVKAVQEGVGGGRGPPFVGRGGIRPSYQATDATGVQLPCFKSQGSK----YNDFQKSKRRLGFTW 547          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A267FZU5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017876g1 PE=4 SV=1)

HSP 1 Score: 349.747 bits (896), Expect = 7.610e-110
Identity = 243/543 (44.75%), Postives = 358/543 (65.93%), Query Frame = 2
Query:   83 SSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLR-VAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEI-LNCDS---TNDNLGFVW 1696
              +A  +REFV        + D+R V VL+  +W+R+   +H+RE E +  ++ +++R  +K  S+EL+KDW NT+LGARQKKL ER  RL  EE+E+K +DV EA   AE R++ +E AK++QYYQTDRVKNFHSAL  +EVLKEREAQIEL RLR      +D  +    ++E E+A++ DQ++ A++I K +E   + + Q++ ++E   +E      EG  +RRLAVA+ALEK+RLDQI ++EQR    + L+QI DV++M++++RL +EEEDE+ R+FAAAKKKM++LR  KE+E+++EKQ +L  IK +L+A+L AK  DE+ R+ NA+ E+EEK  ++E  K R+RQ M  SI++HR    R L  E    KQRD++ + AR+EAD + ++ E +R + +LAE +R A    +QA+  +   + +   +L+    N +LL+QEE+ FQ YA +VIDHCE+GGRNT PLR  A A   GG    +   G +RPSYQT+D + ++L N++ N A  +K      DS   T  NLG VW
Sbjct:   17 GEQAAPQREFV----VGGGQTDLRNVTVLTGEDWSRITRQLHRREIEEQAAKQARDERANLKVRSRELIKDWDNTLLGARQKKLDERNRRLAKEEEEKKALDVEEARLAAEHRKEILEKAKIQQYYQTDRVKNFHSALRLTEVLKEREAQIELNRLRARANEGQDQKYLEIWRKEHEDAIRRDQDEAAERIRKRQECATYQREQIRLHQEQHGREAQLEDEEGLELRRLAVANALEKKRLDQIAKQEQRELMHDNLKQIADVRRMKDVQRLFDEEEDEDCRVFAAAKKKMMRLRAEKEREIHEEKQRNLNRIKERLAAELAAKRSDEEERLYNAVQEREEKLASEEDSKRRQRQTMQESIKQHREDQSRRLAAEAAEQKQRDMEMVRARREADELFQQRERQRAQEKLAEERRRADLLASQARNRETEAQKAKQAELEYEAANLQLLEQEEEQFQSYATKVIDHCERGGRNTLPLRKAAKAGAGGGLGPQLPGRGGIRPSYQTADKRGIQLPNFRRNSAAQVKAGQTGPDSVSGTQKNLGMVW 555          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A1S3JFI6 (coiled-coil domain-containing protein 173 OS=Lingula unguis OX=7574 GN=LOC106172817 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 2.873e-102
Identity = 236/545 (43.30%), Postives = 358/545 (65.69%), Query Frame = 2
Query:   71 KVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAA-AKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDS-TNDNLGFVWK 1699
            + DS+  +L++      +       D+R V VL++ +W R+   +++ + EAE+ +R +E++E +K+ S++ VK+W+NT+ G RQK+L  RK+R E EE ERK++D+ EA +QA++R++AIE AK  QYYQTDRVK FHSAL+F+EVLKEREAQ+ELKRL++     +D  +  K ++++E+ ++ DQ K  +++ +  E  EF KAQ++ + + R     D   EGE++++LA+ + LEK+RL+ I R+EQ+   Q+ +++I+DVKKM+EI++   EEEDEE RIFAAAK+KM+KLR+ KEK L++EKQ  LE+I+++L+AQ+K K+DDED RIR A  E+E K   ++AEKD K + ML  + EHR + MR  E ++   + R+++ L  RKEAD + + NE+ +   +  E K LA  HL QA   K  ++     +L+   +N +LL  EE  FQEYA +VIDHC +GGRN YPLR AA     GG        G +RPSY   D   V+L N+Q    + +K+ +  D  TN  LGFVW+
Sbjct:   15 RADSAPGSLQQPMMTLPDGT-----DLRQVTVLTQGDWGRINMQLNRGQIEAEERRRRREEKEAVKKMSKDKVKNWTNTIAGHRQKRLKARKIREEKEEAERKQVDLEEAQFQAQKRKEAIEKAKTLQYYQTDRVKGFHSALMFTEVLKEREAQLELKRLKEKAYEGKDNDWLDKQRKDYEDGIRDDQRKALQRLQEREEVAEFQKAQIREHIKDRLIAMEDDKKEGEDLKKLAIQYHLEKKRLEDIRRDEQKQNMQQNVKRIEDVKKMREIQQEIEEEEDEECRIFAAAKRKMMKLRVEKEKLLHNEKQERLEKIRDRLAAQMKQKVDDEDQRIRKATEEREAKIAKEDAEKDAKNRRMLSEMAEHRYQQMREKEEKEAAERAREMEMLQIRKEADKLFQRNEEMKHSRKFDENKHLADFHLMQAGQRKLKEDEVKVEQLQQDAKNMELLKLEEDQFQEYAGKVIDHCLQGGRNVYPLRKAARPGAGGGLGPIFEGKGGIRPSYMAMDHSGVQLPNYQRGTTEEVKKNIYGDGRTNKRLGFVWR 554          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A1S3IXI2 (coiled-coil domain-containing protein 173-like OS=Lingula unguis OX=7574 GN=LOC106168274 PE=4 SV=1)

HSP 1 Score: 330.102 bits (845), Expect = 3.130e-102
Identity = 236/545 (43.30%), Postives = 358/545 (65.69%), Query Frame = 2
Query:   71 KVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAA-AKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDS-TNDNLGFVWK 1699
            + DS+  +L++      +       D+R V VL++ +W R+   +++ + EAE+ +R +E++E +K+ S++ VK+W+NT+ G RQK+L  RK+R E EE ERK++D+ EA +QA++R++AIE AK  QYYQTDRVK FHSAL+F+EVLKEREAQ+ELKRL++     +D  +  K ++++E+ ++ DQ K  +++ +  E  EF KAQ++ + + R     D   EGE++++LA+ + LEK+RL+ I R+EQ+   Q+ +++I+DVKKM+EI++   EEEDEE RIFAAAK+KM+KLR+ KEK L++EKQ  LE+I+++L+AQ+K K+DDED RIR A  E+E K   ++AEKD K + ML  + EHR + MR  E ++   + R+++ L  RKEAD + + NE+ +   +  E K LA  HL QA   K  ++     +L+   +N +LL  EE  FQEYA +VIDHC +GGRN YPLR AA     GG        G +RPSY   D   V+L N+Q    + +K+ +  D  TN  LGFVW+
Sbjct:   15 RADSAPGSLQQPMMTLPDGT-----DLRQVTVLTQGDWGRINMQLNRGQIEAEERRRRREEKEAVKKMSKDKVKNWTNTIAGHRQKRLEARKIREEKEEAERKQVDLEEAQFQAQKRKEAIEKAKTLQYYQTDRVKGFHSALMFTEVLKEREAQLELKRLKEKAYEGKDNDWLDKQRKDYEDGIRDDQRKALQRLQEREEVAEFQKAQIREHIKDRLIAMEDDKKEGEDLKKLAIQYHLEKKRLEDIRRDEQKQNMQQNVKRIEDVKKMREIQQEIEEEEDEECRIFAAAKRKMMKLRVEKEKLLHNEKQERLEKIRDRLAAQMKQKVDDEDQRIRKATEEREAKIAKEDAEKDAKNRRMLSEMAEHRYQQMREKEEKEAAERAREMEMLQIRKEADKLFQRNEEMKHSRKFDENKHLADFHLMQAGQRKLKEDEVKVEQLQQDAKNMELLKLEEDQFQEYAGKVIDHCLQGGRNVYPLRKAARPGAGGGLGPIFEGKGGIRPSYMAMDHSGVQLPNYQRGTTEEVKKNIYGDGRTNKRLGFVWR 554          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Match: A0A1I8IQV9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 334.339 bits (856), Expect = 3.180e-98
Identity = 254/560 (45.36%), Postives = 368/560 (65.71%), Query Frame = 2
Query:   38 IFSKLNRLMTLKVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXX-XSVRPSYQTSDGKSVELSNWQTNDAKNIKEI-LNCDS---TNDNLGFVWKK 1702
            I   L RL         +A  +REFV        + D+R V VL+  +W+R+   +H+RE E +  ++ +++R  +K  S+EL+KDW NT+LGARQKKL ER  RL  EE+E+K +DV EA   AE R++ +E AK++QYYQTDRVKNFHSAL  +EVLKEREAQIEL RLR      +D  +    ++E E+A++ DQ++ A++I K +E   + + Q++ ++E   +E      EG  +RRLAVA+ALEK+RLDQI ++EQR    + L+QI DV++M++++RL +EEEDE+ R+FAAAKKKM++LR  KE+E+++EKQ +L  IK +L+A+L AK  DE+ R+ NA+ E+EEK  ++E  K R+RQ M  SI++HR    R L  E    KQRD++ + AR+EAD + ++ E +R + +LAE +R A    +QA+  +   + +   +L+    N +LL+QEE+ FQ YA +VIDHCE+GGRNT PLR AA  G GGGLGP LPG G +RPSYQT+D + ++L N++ N A  +K      DS   T  NLG    K
Sbjct:  630 ISHSLGRLDV----GGEQAAPQREFVVGGG----QTDLRNVTVLTGEDWSRITRQLHRREIEEQAAKQARDERANLKVRSRELIKDWDNTLLGARQKKLDERNRRLAKEEEEKKALDVEEARLAAEHRKEILEKAKIQQYYQTDRVKNFHSALRLTEVLKEREAQIELNRLRARANEGQDQKYLEIWRKEHEDAIRRDQDEAAERIRKRQECATYQREQIRLHQEQHGREAQLEDEEGLELRRLAVANALEKKRLDQIAKQEQRELMHDNLKQIADVRRMKDVQRLFDEEEDEDCRVFAAAKKKMMRLRAEKEREIHEEKQRNLNRIKERLAAELAAKRSDEEERLYNAVQEREEKLASEEDSKRRQRQTMQESIKQHREDQSRRLAAEAAEQKQRDMEMVRARREADELFQQRERQRAQEKLAEERRRADLLASQARNRETEAQKAKQAELEYEAANLQLLEQEEEQFQSYATKVIDHCERGGRNTLPLRKAAKAGAGGGLGPQLPGRGGIRPSYQTADKRGIQLPNFRRNSAAQVKAGQTGPDSVSGTQKNLGMTGSK 1181          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Match: K1Q2U4 (Uncharacterized protein C2orf77 OS=Crassostrea gigas OX=29159 GN=CGI_10019970 PE=4 SV=1)

HSP 1 Score: 310.842 bits (795), Expect = 2.020e-94
Identity = 239/523 (45.70%), Postives = 349/523 (66.73%), Query Frame = 2
Query:  146 DIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVK-HNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEE---HRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXX-XXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKE-ILNCDSTNDNLGFVW 1696
            DIR V +LSK+EWNR+Q  +HKR+ E E+ +R +E++E  KQ S+E+V+ W NT+ G R +KL  RKLR + EE+E++ ID+ EA YQA++R++AIE AK +QYYQTDRVKNFHSAL+ +EVLKEREAQIELK+L++     +D  +   A+RE E A+  DQEK  ++I  T++N  F+ AQ++ H KE +E+   D   EG+ ++RLA+    EK+RLDQI+R+E+    ++ + QI D + ++++   + +EEDEE RIFAAAK+KM+KLR  KE+++++EKQ +L++I+ KL+AQL+ K+ DED RIR A+ E EEK      E+  K  +ML+ +EE   HRNK MR  E ++   ++++L+ +  R+ AD I + NE+ + + R  +A  L   H  Q    K+ +  ++  KL + + NQ LL  EE+ FQEYA RVIDHCEKGGRN YPLR AA  G GGG GPV    G +RPSY  +D    ++ ++Q +  +  KE I     +   LGFVW
Sbjct:   64 DIRDVTILSKSEWNRIQQELHKRQIEEERMRRLREEKENRKQMSKEMVQHWGNTIAGTRTRKLEARKLREQKEEEEKQAIDLEEAKYQAQKRKEAIEKAKTQQYYQTDRVKNFHSALMLTEVLKEREAQIELKKLQEKANEGKDAEWLQLAKREHENAILQDQEKARQRIHATKDNQRFLSAQIQEHMKEKQEEVEEDH-KEGDELQRLALQFHTEKERLDQIKRDEKLQMMRDNVAQINDRRVIKKVMEQQEDEEDEECRIFAAAKRKMMKLRAEKEQQIHEEKQRNLQKIREKLAAQLQQKVSDEDERIRKAVEEAEEK---RAKEEAEKEAKMLKGMEESAKHRNKQMREAEQKKKEERRQELEMVRIRQAADEIFRRNEEEKHQRRREDAVGLKNFHQEQVNLRKQKEAEAIQEKLALDQANQALLAVEEEQFQEYAGRVIDHCEKGGRNVYPLRKAAKNGAGGGKGPVFEGKGGIRPSYMVNDKSGKQMPHYQRDSTEETKESIYGPAKSKKRLGFVW 582          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: ccdc173 (coiled-coil domain containing 173 [Source:NCBI gene;Acc:103043159])

HSP 1 Score: 217.238 bits (552), Expect = 8.413e-63
Identity = 192/523 (36.71%), Postives = 290/523 (55.45%), Query Frame = 2
Query:  137 EKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNW---QTNDAKNIKEILNCDSTNDNLGFVW 1696
            +  D+  V VL ++EW RLQ ++++     +      ++RE +   S+E+VK+W+NT+ G RQKKL  +K+R EIEE+ERK ID+ EA YQ ++R++AIE AK +QYYQTDRVK FHSALL +EVLKEREAQIEL+R  Q    + D        R  EEA + +++K  K+  +     E +K Q+K +   +  E+ +   E E  +RL      E+   +Q ++EE+R   + + + + D   +Q  E  K ++E+E  R+FA AK+KM+KLR  KE+ L+   Q H E I  +L+AQ + +  +E+  I  A+++ E K I  + E D K+  M++SI  HR   ++  E      KQ+  +SL A+KEAD+I  E +  +++     AK L   ++ Q    +E  +       K    N KL+ +EE  FQ+YAK VI   +   RNTYPL  AA    G G G     G VRPSY   D    ++ N+    T D K + E ++   +   LGF W
Sbjct:   30 QPIDLLQVTVLPRSEWLRLQDSLNQVNKHKDSLIEAAKQREAMHLRSKEVVKNWTNTIAGQRQKKLEAKKIREEIEEEERKRIDIEEAKYQEQKRKEAIERAKTQQYYQTDRVKGFHSALLLTEVLKEREAQIELRRREQNASKDVDKEVLAMIARREEEASQIEEQKALKKKQECLAVAESLKQQIKEHDHTKAWEKMEERKEAEETQRLRQLFLWEQSMHEQNKQEEKRNIMRAHQKHLADRDIIQAQEAQKQDQEEENRRLFAEAKEKMMKLRKEKEEMLFRGMQRHREAIIERLAAQRQEQTSNEEELISKAVAQAEAKRIRQQREMDGKKAAMVKSIAAHREATLQEKERIDHEEKQKAAESLAAKKEADSIFLEKQQLKEQKMKEYAKTLQDTYVHQMVEKRELGKRIKKEDQKFEASNVKLIVEEEMQFQQYAKHVIQTAKAAQRNTYPLHKAA--KEGIGGGLGPVFGGVRPSYLVHDESGAQMPNYVSGTTQDIKELNETIDIQQSKKRLGFTW 550          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: ENSAMXT00000053346.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000860.1:123916:127712:1 gene:ENSAMXG00000029288.1 transcript:ENSAMXT00000053346.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 62.3882 bits (150), Expect = 6.517e-10
Identity = 106/377 (28.12%), Postives = 182/377 (48.28%), Query Frame = 2
Query:  413 EQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFV-KAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSA-QLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEAD-AILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLK----VMEE-NQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAA 1519
            +QR++AI  AK   +YQ++RV+ F S +  SE+ K+ +A+IE K         R     +KAQ         D+E  + Q  K R   E + K+ ++  K+  E E C                AL+KQ                    +++ K++   E L+ EEE++  ++F  +K +  KL++ K ++   E+Q   + +   +   QL+ +  DED  I  A  E + K    +++K+  +  M  SI+E+   + +  E  +L  K+ D + L + KEAD   LKE     QK++ A+ KR     L +  AL+ +++  +  +LK    ++E  + +L+ +EE+ FQ YA+R I   E  GR+TY LR AA
Sbjct:  121 DQRQEAISRAKDIFFYQSERVRQFRSTVGLSEIQKDIQAEIERK---------RKEKMASKAQ---------DEEYCSMQ--KNRLQKELLEKSLLQQKKKEEEMELC---------------RALQKQ--------------------VEEKKELLAGEALRKEEEEKRQKLFLDSKDQQAKLQLEKREQQIRERQERTKLVTQSMEKHQLQKQPLDEDLLISKAKREDQAKIRQLQSKKEEMKAVMTDSIKEYTKASRKEKERRRLKEKRDDAELLASYKEADRKFLKE-----QKIK-AQKKREKGKELNKFNALQMAEKQELEQRLKQEDLLLESRDAELIKEEEERFQRYAERCIQSAEAAGRSTYTLRKAA 436          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Match: ENSAMXT00000050253.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000860.1:74977:78710:-1 gene:ENSAMXG00000037600.1 transcript:ENSAMXT00000050253.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.7658 bits (138), Expect = 1.887e-8
Identity = 103/376 (27.39%), Postives = 175/376 (46.54%), Query Frame = 2
Query:  413 EQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKL-SAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEAD-AILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLK----VMEE-NQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAA 1519
            +QR++AI  AK   +YQ++RV+ F S +  SE+ K+ +A+IE KR  ++         + + Q+E         EK+  Q  K  + ME  +A  K  +E +E      L  GE +R+               E+EE+R K                              +F  +K +  KL++ K ++   E+Q   E +   +   QL+ +  DED  I  A  E + K    +++K+  +  M  SI+E+   + +  E  +L  K+ D + L + KEAD   LKE     QK++ A+ KR     + +  AL+ +++  +  +LK    ++E  + +L+ +EE+ FQ YA+R I   E  GR+TY LR AA
Sbjct:  126 DQRQEAISRAKDIFFYQSERVRQFRSTVGLSEIQKDIQAEIERKRKEKM---------KNRLQKEL-------LEKSLLQQKKKEQEMELCRALQKQVEEKKE------LLAGEALRK---------------EQEEKRQK------------------------------LFLDSKDQQAKLQLEKREQQIRERQERTELVTQSMEKHQLQKQPLDEDLLISKAKREDQAKIRQLQSKKEEMKAVMTDSIKEYTKASRKEKERLRLKEKRDDAELLASYKEADRKFLKE-----QKIK-AQKKREKGKEINKFNALQMAEKQELEQRLKQEDLLLESRDAQLIKEEEERFQRYAERCIQSAEAAGRSTYTLRKAA 428          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Sea Lamprey
Match: ccdc173 (coiled-coil domain containing 173 [Source:ZFIN;Acc:ZDB-GENE-081104-457])

HSP 1 Score: 167.548 bits (423), Expect = 1.936e-45
Identity = 164/521 (31.48%), Postives = 280/521 (53.74%), Query Frame = 2
Query:  143 FDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNC-DSTND--NLGFVW 1696
             D+  V VL + EW R++ ++ +RE + E E+  +E+R  +   S+E+ + W+NT+   R++KLA   LR E EE+ RK +DV EA +QAEQRRKA+E A+  QY+QT+RV+ FHSAL  +E LKEREAQ+ELK   +    +R+  +   + RE EEA + ++   A++        E  + QV+  +   E+   +   E   + RLA AH  E++ + ++   +++   + + + + D ++++  E+ +  EED+ IR+ +AAK K+  L+  KE+E+  E+    E     L+A ++ ++++ED R+  A++E++     ++ +KD + Q    SI +HR + M+    EQ   +QR L+ L AR EAD +  E++  +++    E+++L   H+ Q    + ++E +          + +L  +EE+ FQEYA RVID    GGRN  PL                    VR +     G  +        DA+ +KE+ +  D   D   LGFVW
Sbjct:   30 HDLNQVIVLPRAEWERIERSLKRREIQEEMERASREERAAMLARSKEITQKWTNTLEAQREQKLAAFTLRKEQEEEARKRLDVEEAKFQAEQRRKALERARTLQYHQTERVRGFHSALQLTETLKEREAQLELKGRVESARRSRERDWVQASSREREEAQREEERCAAERAEVAARIAEAQRQQVEEQRREVERALMEAREETREVERLARAHMWEQRVVRELRERDKKDIMKAHREHMADKERLRAKEQERQAEEDKRIRVHSAAKHKINLLKRKKEEEILREQLAQRERATELLAAHIQQRVNNEDERVARAVAEQDAHHEQEQRKKDERAQAARLSIAQHRQQTMKEKAAEQHAERQRALEELRARTEADLLFAESQRLKEQHLAEESRQLKDVHVEQMTRRRAAEEAARRESRSRERRDAELAAEEERRFQEYALRVIDAARTGGRNPLPL--------------------VRAAAAGGQGPPLPGRGAIRADAQEVKELYSSGDVAQDKKRLGFVW 530          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Nematostella
Match: EDO49042 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHV0])

HSP 1 Score: 223.016 bits (567), Expect = 1.002e-65
Identity = 190/522 (36.40%), Postives = 284/522 (54.41%), Query Frame = 2
Query:  158 VKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNK------AMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPL-RVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNW--QTNDAKNIKEILNCDSTNDNLGFVW 1696
            V V+   +W R+Q ++ +   +  +++  KE++  +   S E+VK W NT+ G R KKL  RK+R E EE ER +ID+ EA +QA++R++AIE AK +QYYQTDRVK FHSALL +EV+KEREAQ+++K+ +   +  R+       QR+FEEA++ DQ++  ++    RE  +F   QVK + E     +   + EG+NI++    +   K+ +++  R+E+    +++   +   K++QE ER K EEEDEEIR F  AKKKM K+R  KE EL++  Q H   ++ KL+ Q++ K+DDED RI  A++E+E K   D  EK        R I EHR         MR  E +     +RD + L  R E+D +    +  ++  +L E K L    + Q    K   E    + LK    N  LL +EE  FQEYA+ VI    K GRN YPL + A     GG          +RPS+  SDG  V+L N+   T    + +   +   +   LGF W
Sbjct:    5 VTVIQPKDWTRIQNSLARYNKDVARQKAIKEEKLALHNISNEMVKHWDNTIEGLRNKKLQARKIREEKEEAERVKIDIEEAKHQAQKRKEAIEKAKTQQYYQTDRVKTFHSALLLTEVIKEREAQVKMKKGQTNADKIREAHVLRLQQRQFEEAIREDQKRALERYNARREVADFQLFQVKDHIEENHLAKDMDMQEGQNIKQQVDMYESAKKIIEEQRRQEKIQLMKDHQSHLSKRKELQEFERKKQEEEDEEIRQFVYAKKKMSKMRKEKETELFNAFQDHTNRMRQKLADQMQQKVDDEDERIAKALAEREAKREADMKEK--------RGIHEHRLYQLFMCLQMRESERKAAEEAKRDQEILRKRVESDKLYHAKQVEKKLEKLHETKNLKTFQMDQVGERKVRKEQEKVSDLKTDLANDMLLREEELQFQEYAQHVISEERKRGRNPYPLIKAAQEGPGGGRGPKYEGKNGLRPSFLVSDGTGVQLPNYANATTQGSHTRIYGDPGKSRKRLGFTW 518          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: ccdc173 (coiled-coil domain containing 173 [Source:ZFIN;Acc:ZDB-GENE-081104-457])

HSP 1 Score: 80.1073 bits (196), Expect = 1.277e-15
Identity = 80/204 (39.22%), Postives = 123/204 (60.29%), Query Frame = 2
Query:  386 DVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELK-RLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEF---VKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKEL 985
            D+ EA Y+ E+R++A++ A+++ Y+QTDRVK  H ALL +EVLKEREAQ+ELK + +  TE       +    RE +EA+K  +EKT K   K RE M F   +K Q+K N+ +RE++           ++       E QRL ++++ EQR      LQQ + ++K   IE  K E E+E+ ++F +AK+KM KLR  K++E+
Sbjct:  109 DLEEANYREEKRKEAVQKAELQLYHQTDRVKGLHRALLLTEVLKEREAQMELKQQTKSATERWEKEILEKIMTRE-DEAMKQQEEKTLK---KRRERMAFAEDLKNQMKENELIREQQE----------QKEKQKDQEEIQRLFELQQREQRTD----LQQREHLRK---IEAQKQEIEEEQRKLFLSAKQKMTKLRKEKDREI 291          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Match: ccdc173 (coiled-coil domain containing 173 [Source:ZFIN;Acc:ZDB-GENE-081104-457])

HSP 1 Score: 78.9518 bits (193), Expect = 1.432e-15
Identity = 68/139 (48.92%), Postives = 96/139 (69.06%), Query Frame = 2
Query:  275 SQELVKDWSNTVL-GARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELK-RLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFV 685
            SQE+V  WSNTV  G R+KKL  +K+R +IEE++RK++D+ EA Y+ E+R++A++ A+++ Y+QTDRVK  H ALL +EVLKEREAQ+ELK + +  TE       +    RE +EA+K  +EKT K   K RE M F 
Sbjct:   26 SQEVVTKWSNTVAQGQRKKKLEAKKVREQIEEEKRKQMDLEEANYREEKRKEAVQKAELQLYHQTDRVKGLHRALLLTEVLKEREAQMELKQQTKSATERWEKEILEKIMTRE-DEAMKQQEEKTLK---KRRERMAFA 160          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000064523.1 (SMESG000064523.1)

HSP 1 Score: 967.992 bits (2501), Expect = 0.000e+0
Identity = 545/549 (99.27%), Postives = 548/549 (99.82%), Query Frame = 2
Query:   62 MTLKVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHXXXXXXXXXXXXXXXXXXXXXCSQELVKDWSNTVLGARQXXXXXXXXXXXXXXXXXXXXDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD 1708
            MTLKVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHK EFEAEKEQREKEKREQIKQCSQELVKDWSNTVLGARQKKLAERKLRLEIEEKERKEIDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQI+KTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQI+DVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAK+VIDHCEKGGRNTYPLRVAAAKGVGGGLGPVLPGGSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD
Sbjct:    1 MTLKVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHKSEFEAEKEQREKEKREQIKQCSQELVKDWSNTVLGARQKKLAERKLRLEIEEKERKEIDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEVLKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIMKTRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQIEREEQRLKKQEYLQQIEDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKLRIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKKVIDHCEKGGRNTYPLRVAAAKGVGGGLGPVLPGGSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD 549          
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Planmine SMEST
Match: SMESG000064523.1 (SMESG000064523.1)

HSP 1 Score: 415.616 bits (1067), Expect = 5.862e-144
Identity = 218/219 (99.54%), Postives = 219/219 (100.00%), Query Frame = 2
Query: 1052 MDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKXXXXXXXXXXXXXSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD 1708
            MDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAK+VIDHCEKGGRNTYPLRVAAAKGVGGGLGPVLPGGSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD
Sbjct:    1 MDDEDFRIRNAISEKEEKFINDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEADAILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEENQKLLDQEEKIFQEYAKKVIDHCEKGGRNTYPLRVAAAKGVGGGLGPVLPGGSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD 219          
The following BLAST results are available for this feature:
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CCDC1733.174e-4433.21coiled-coil domain containing 173 [Source:HGNC Sym... [more]
CCDC1731.545e-1445.45coiled-coil domain containing 173 [Source:HGNC Sym... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1731.224e-6737.38coiled-coil domain containing 173 [Source:ZFIN;Acc... [more]
ccdc1731.027e-4440.29coiled-coil domain containing 173 [Source:ZFIN;Acc... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
igf1r2.096e-5536.11insulin like growth factor 1 receptor [Source:Xenb... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Ccdc1734.580e-2930.92coiled-coil domain containing 173 [Source:MGI Symb... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q0VFZ6|CC173_HUMAN1.524e-4333.21Coiled-coil domain-containing protein 173 OS=Homo ... [more]
sp|A0JLY1|CC173_MOUSE3.204e-2830.92Coiled-coil domain-containing protein 173 OS=Mus m... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FZU57.610e-11044.75Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1S3JFI62.873e-10243.30coiled-coil domain-containing protein 173 OS=Lingu... [more]
A0A1S3IXI23.130e-10243.30coiled-coil domain-containing protein 173-like OS=... [more]
A0A1I8IQV93.180e-9845.36Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1Q2U42.020e-9445.70Uncharacterized protein C2orf77 OS=Crassostrea gig... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ccdc1738.413e-6336.71coiled-coil domain containing 173 [Source:NCBI gen... [more]
ENSAMXT00000053346.16.517e-1028.12pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050253.11.887e-827.39pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ccdc1731.936e-4531.48coiled-coil domain containing 173 [Source:ZFIN;Acc... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO490421.002e-6536.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ccdc1731.277e-1539.22coiled-coil domain containing 173 [Source:ZFIN;Acc... [more]
ccdc1731.432e-1548.92coiled-coil domain containing 173 [Source:ZFIN;Acc... [more]
back to top
BLAST of FAST kinase domain-containing protein 1, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000064523.10.000e+099.27SMESG000064523.1[more]
SMESG000064523.15.862e-14499.54SMESG000064523.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015974 ID=SMED30015974|Name=FAST kinase domain-containing protein 1, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=1787bp
TTAAAAACACATAACTACATTTTCAAATTAAAAATAAATATTTAGTAAAT
TAAATAGATTAATGACTTTAAAAGTTGATTCATCATCCAAAGCCCTTAAA
GAAAGAGAATTCGTTTATAAGAATGAATGCAATGATGAAAAGTTTGATAT
CAGAGGAGTGAAAGTATTGTCAAAAAATGAATGGAACCGATTACAGTATA
ATATTCACAAAAGGGAATTTGAAGCTGAAAAGGAACAGAGAGAAAAAGAG
AAACGCGAACAAATTAAACAATGTTCACAGGAATTGGTTAAAGATTGGTC
CAACACAGTTTTAGGTGCTAGACAAAAAAAACTAGCTGAAAGAAAATTAA
GATTAGAAATTGAAGAAAAAGAAAGAAAAGAAATTGACGTGGCTGAAGCT
TTATATCAAGCAGAACAAAGACGAAAAGCGATTGAAGATGCAAAAGTTAA
ACAATACTATCAAACAGATAGAGTGAAAAATTTCCACTCTGCTCTTCTTT
TTTCCGAAGTCCTAAAAGAAAGAGAAGCTCAAATAGAATTGAAGCGACTA
AGACAATTAACTGAATGTAACAGAGATGTAGGATTTCAGACGAAAGCTCA
ACGAGAATTCGAAGAAGCACTAAAAGCGGACCAAGAGAAAACTGCAAAAC
AAATAATTAAAACTAGAGAAAATATGGAGTTTGTCAAGGCTCAAGTTAAA
CACAATAAAGAACTGAGAGAAAAAGAGAGATGTGATTTCTTAACTGAAGG
TGAAAATATAAGAAGACTGGCTGTAGCTCATGCACTCGAGAAACAAAGAT
TGGATCAAATTGAACGAGAAGAACAAAGATTAAAGAAGCAAGAATACTTA
CAACAAATTCAAGACGTGAAGAAAATGCAAGAAATAGAAAGATTGAAAAA
TGAGGAGGAAGATGAAGAAATTAGAATATTTGCTGCAGCAAAGAAGAAAA
TGCTAAAATTAAGAATAGGAAAAGAAAAGGAACTTTATGACGAAAAACAG
GGCCATTTGGAAGAAATCAAAAACAAACTTTCAGCTCAGTTGAAAGCAAA
AATGGACGATGAAGATTTTAGAATTAGAAATGCAATAAGTGAAAAAGAAG
AAAAGTTCATAAACGATGAAGCTGAAAAAGATAGAAAGCGCCAAGAAATG
CTCAGATCAATTGAAGAACATAGAAACAAAGCAATGAGAGCTTTGGAATG
TGAACAGCTATTTAGTAAGCAAAGAGACTTAGATTCTTTAATGGCTAGAA
AGGAAGCTGATGCTATTCTCAAAGAAAATGAAGATAGAAGACAAAAGTTG
AGATTAGCTGAAGCGAAACGATTAGCTCAAGGACATTTAGCTCAAGCGAA
AGCTTTGAAAGAATCCGATGAAAATTCAATGAATAATAAACTAAAAGTAA
TGGAAGAAAATCAAAAATTGCTTGATCAAGAAGAAAAAATATTCCAAGAA
TATGCTAAAAGGGTTATTGATCATTGCGAAAAAGGGGGCCGTAACACTTA
TCCACTGAGAGTTGCGGCGGCTAAAGGAGTCGGCGGCGGGTTGGGCCCGG
TGCTTCCAGGAGGAAGTGTTCGACCATCCTACCAGACTTCTGACGGGAAA
TCTGTTGAATTATCAAATTGGCAAACGAATGATGCAAAAAATATAAAAGA
AATTTTAAATTGTGATTCAACTAATGACAATTTGGGATTTGTTTGGAAGA
AATGTGATTAGAATTTTAATCTAGACATTCGGGAAAATTGTCTAAATTTG
ATTAAACATTTAAAGTAACTACAAGAGTAAATTTAAG
back to top

protein sequence of SMED30015974-orf-1

>SMED30015974-orf-1 ID=SMED30015974-orf-1|Name=SMED30015974-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=550bp
MTLKVDSSSKALKEREFVYKNECNDEKFDIRGVKVLSKNEWNRLQYNIHK
REFEAEKEQREKEKREQIKQCSQELVKDWSNTVLGARQKKLAERKLRLEI
EEKERKEIDVAEALYQAEQRRKAIEDAKVKQYYQTDRVKNFHSALLFSEV
LKEREAQIELKRLRQLTECNRDVGFQTKAQREFEEALKADQEKTAKQIIK
TRENMEFVKAQVKHNKELREKERCDFLTEGENIRRLAVAHALEKQRLDQI
EREEQRLKKQEYLQQIQDVKKMQEIERLKNEEEDEEIRIFAAAKKKMLKL
RIGKEKELYDEKQGHLEEIKNKLSAQLKAKMDDEDFRIRNAISEKEEKFI
NDEAEKDRKRQEMLRSIEEHRNKAMRALECEQLFSKQRDLDSLMARKEAD
AILKENEDRRQKLRLAEAKRLAQGHLAQAKALKESDENSMNNKLKVMEEN
QKLLDQEEKIFQEYAKRVIDHCEKGGRNTYPLRVAAAKGVGGGLGPVLPG
GSVRPSYQTSDGKSVELSNWQTNDAKNIKEILNCDSTNDNLGFVWKKCD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004672protein kinase activity
GO:0016301kinase activity
GO:0003674molecular_function
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0016310phosphorylation
GO:0008150biological_process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000418head
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR039986CCDC173
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 233..272
NoneNo IPR availableCOILSCoilCoilcoord: 86..121
NoneNo IPR availableCOILSCoilCoilcoord: 46..74
NoneNo IPR availableCOILSCoilCoilcoord: 415..435
NoneNo IPR availableCOILSCoilCoilcoord: 275..295
NoneNo IPR availableCOILSCoilCoilcoord: 342..362
NoneNo IPR availablePFAMPF13868TPHcoord: 133..471
e-value: 9.0E-19
score: 67.2
IPR039986Coiled-coil domain-containing protein 173PANTHERPTHR28663FAMILY NOT NAMEDcoord: 17..497