luc7 like protein-3

Overview
Nameluc7 like protein-3 (AFJ24827.1)
Smed IDSMED30015962
Length (bp)1473
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of luc7 like protein-3 (SMED30015962) t-SNE clustered cells

Violin plots show distribution of expression levels for luc7 like protein-3 (SMED30015962) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of luc7 like protein-3 (SMED30015962) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for luc7 like protein-3 (SMED30015962) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015962

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30015962h1SMcG0011510 SmedASXL_013715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30015962h1SMcG0011510 SmedASXL_013715SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of luc7 like protein-3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 160.614 bits (405), Expect = 1.436e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 160.614 bits (405), Expect = 1.436e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Human
Match: LUC7L3 (LUC7 like 3 pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:24309])

HSP 1 Score: 160.229 bits (404), Expect = 5.575e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Human
Match: LUC7L2 (LUC7 like 2, pre-mRNA splicing factor [Source:HGNC Symbol;Acc:HGNC:21608])

HSP 1 Score: 111.309 bits (277), Expect = 3.910e-26
Identity = 74/231 (32.03%), Postives = 120/231 (51.95%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDP-HWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   A+LD+LMG +R+ ++ +    + D+ VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S      FE      L  F+ D  R+ EV K RL       S    A  +R+     EI + +  +E+LG EG +EE Q + +++ EK +  K +  E+  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E LEEL + +
Sbjct:    3 AQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEV-EKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVV 232          
BLAST of luc7 like protein-3 vs. Ensembl Human
Match: LUC7L (LUC7 like [Source:HGNC Symbol;Acc:HGNC:6723])

HSP 1 Score: 108.612 bits (270), Expect = 1.294e-25
Identity = 70/230 (30.43%), Postives = 123/230 (53.48%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSN-SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   ALLD+LMG  R+ + +++   + D+ VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ +  R+ E+ K RL       S    A  +++     EI + +   E+LG EG ++E Q +  ++E+ + + K  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G+++I E L++L KT+
Sbjct:    3 AQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDESQKILMEVEKVRAKKKEAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLRKTV 232          
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:98027:-1 gene:WBGene00016811.1 transcript:C50D2.8a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 130.568 bits (327), Expect = 6.382e-34
Identity = 79/240 (32.92%), Postives = 127/240 (52.92%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDPH--WDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGT------EIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQ--FLNNQLEEKQKELKYDKIELENHRKSAKE---------KQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            A  + AA+LDELMG  RN    KD    +DD  +C Y+L GFCPH++F+NTK  LGAC  +HD NL   Y  S  + ++GFE+ L +FL     D QR+I  NK++L     SG       +  +Q  I   ++ +   +   E+ G+EG + +CQ     +++ E +K    +K+   N                K  +VC +CG+ +  ND +  IE H++G++H G+ +I  ++++L
Sbjct:    3 ARNAMAAMLDELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKLSGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPNPQAMPPMLDEMAIKPMEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQL 242          
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Match: C50D2.8 (pep chromosome:WBcel235:II:96127:97944:-1 gene:WBGene00016811.1 transcript:C50D2.8a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C50D2.8)

HSP 1 Score: 130.568 bits (327), Expect = 6.382e-34
Identity = 79/240 (32.92%), Postives = 127/240 (52.92%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDPH--WDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGT------EIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQ--FLNNQLEEKQKELKYDKIELENHRKSAKE---------KQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            A  + AA+LDELMG  RN    KD    +DD  +C Y+L GFCPH++F+NTK  LGAC  +HD NL   Y  S  + ++GFE+ L +FL     D QR+I  NK++L     SG       +  +Q  I   ++ +   +   E+ G+EG + +CQ     +++ E +K    +K+   N                K  +VC +CG+ +  ND +  IE H++G++H G+ +I  ++++L
Sbjct:    3 ARNAMAAMLDELMGPKRNVELGKDTKVTFDDPDICPYFLVGFCPHDMFINTKADLGACQLVHDDNLRRLYPESPEYGQLGFERRLMRFLVQLDEDNQRRIRKNKDKLSGMDDSGKRKLEEEKRQVQLEINSIDDVLKNMIRDAEQAGSEGNVTKCQEIVARSEMVEAEKRGLEEKLSQMNEPNPQAMPPMLDEMAIKPMEVCEVCGSMLIVNDAQQRIEEHLTGKMHTGFQKIRTMIQQL 242          
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207264:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 108.612 bits (270), Expect = 5.491e-26
Identity = 68/241 (28.22%), Postives = 129/241 (53.53%), Query Frame = 3
Query:  186 AALLDELMGINRNSNS--KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACP-KLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKEL-----KYDKIELENHRK-------SAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELD 836
            A +L+ELMG  R++N   +++  +DD +VC  +L GFC H++F NTK  LG C    HD NL N YKNS    ++GFEK   + +     DV+RKI+ +++RL             F    + I++R      ++ + ++     G +G ++  Q   ++ ++ + E+     + +K++ E  R        +A  +Q  VC ICG ++ +ND    +++H++G++H  Y +I++ ++ ++
Sbjct:    6 AQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKERAINMEENVTAGNRQMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207346:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 108.612 bits (270), Expect = 5.491e-26
Identity = 68/241 (28.22%), Postives = 129/241 (53.53%), Query Frame = 3
Query:  186 AALLDELMGINRNSNS--KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACP-KLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKEL-----KYDKIELENHRK-------SAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELD 836
            A +L+ELMG  R++N   +++  +DD +VC  +L GFC H++F NTK  LG C    HD NL N YKNS    ++GFEK   + +     DV+RKI+ +++RL             F    + I++R      ++ + ++     G +G ++  Q   ++ ++ + E+     + +K++ E  R        +A  +Q  VC ICG ++ +ND    +++H++G++H  Y +I++ ++ ++
Sbjct:    6 AQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKERAINMEENVTAGNRQMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Match: Y119D3B.12 (pep chromosome:WBcel235:III:1202548:1207346:1 gene:WBGene00022489.1 transcript:Y119D3B.12a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y119D3B.12)

HSP 1 Score: 108.612 bits (270), Expect = 5.491e-26
Identity = 68/241 (28.22%), Postives = 129/241 (53.53%), Query Frame = 3
Query:  186 AALLDELMGINRNSNS--KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACP-KLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKEL-----KYDKIELENHRK-------SAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELD 836
            A +L+ELMG  R++N   +++  +DD +VC  +L GFC H++F NTK  LG C    HD NL N YKNS    ++GFEK   + +     DV+RKI+ +++RL             F    + I++R      ++ + ++     G +G ++  Q   ++ ++ + E+     + +K++ E  R        +A  +Q  VC ICG ++ +ND    +++H++G++H  Y +I++ ++ ++
Sbjct:    6 AQMLNELMGSQRDANPGERREIRYDDPNVCTDFLVGFCTHDIFRNTKNDLGFCKYTTHDENLKNSYKNSDKKWRMGFEKRFLERIRRIHEDVRRKIQKHEDRLAVTQGESKSAEETFGQKILEIEQRREQLTKKMEDLMDEAALEGEKGNVDAAQTAVDRADKAKVEVEELTQEAEKLKSEKERAINMEENVTAGNRQMQVCQICGCFMLQNDAPQRVDDHLTGKLHIAYQQISDTIKTIE 246          
BLAST of luc7 like protein-3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0344941)

HSP 1 Score: 102.834 bits (255), Expect = 2.180e-23
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 3
Query:  189 ALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQK--RITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSA------KEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A+LD+LMG  RN + ++   + D  VCK +L   CPH++  +T+M LG CPK+HD+     Y++++      ++    + L  F+ D  R+ +  K RL+      T    +K   +     EI + +   E LG  G +E+   L  ++E    EL+  KI+ E+  +++      ++++  VC +C AY+  +D    + +H  G++H G++ I E L EL+KT 
Sbjct:   16 AMLDQLMGTTRNGDERQ-LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIE----ELRAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTA 237          
BLAST of luc7 like protein-3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0345387)

HSP 1 Score: 102.834 bits (255), Expect = 2.180e-23
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 3
Query:  189 ALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQK--RITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSA------KEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A+LD+LMG  RN + ++   + D  VCK +L   CPH++  +T+M LG CPK+HD+     Y++++      ++    + L  F+ D  R+ +  K RL+      T    +K   +     EI + +   E LG  G +E+   L  ++E    EL+  KI+ E+  +++      ++++  VC +C AY+  +D    + +H  G++H G++ I E L EL+KT 
Sbjct:   16 AMLDQLMGTTRNGDERQ-LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIE----ELRAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTA 237          
BLAST of luc7 like protein-3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0075175)

HSP 1 Score: 102.834 bits (255), Expect = 2.180e-23
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 3
Query:  189 ALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQK--RITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSA------KEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A+LD+LMG  RN + ++   + D  VCK +L   CPH++  +T+M LG CPK+HD+     Y++++      ++    + L  F+ D  R+ +  K RL+      T    +K   +     EI + +   E LG  G +E+   L  ++E    EL+  KI+ E+  +++      ++++  VC +C AY+  +D    + +H  G++H G++ I E L EL+KT 
Sbjct:   16 AMLDQLMGTTRNGDERQ-LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIE----ELRAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTA 237          
BLAST of luc7 like protein-3 vs. Ensembl Fly
Match: CG7564 (gene:FBgn0036734 transcript:FBtr0331842)

HSP 1 Score: 102.834 bits (255), Expect = 2.180e-23
Identity = 66/227 (29.07%), Postives = 118/227 (51.98%), Query Frame = 3
Query:  189 ALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQK--RITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSA------KEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A+LD+LMG  RN + ++   + D  VCK +L   CPH++  +T+M LG CPK+HD+     Y++++      ++    + L  F+ D  R+ +  K RL+      T    +K   +     EI + +   E LG  G +E+   L  ++E    EL+  KI+ E+  +++      ++++  VC +C AY+  +D    + +H  G++H G++ I E L EL+KT 
Sbjct:   16 AMLDQLMGTTRNGDERQ-LKFSDPRVCKSFLLDCCPHDILASTRMDLGECPKVHDLAFRADYESAAKTRDYYYDIEAMEHLQAFIADCDRRTDSAKQRLKETQEELTAEVAEKANAVHGLAEEIGKKLAKAEALGEAGEVEDSMELMKEIE----ELRAKKIKAEHEYRTSMPASTYQQQKLRVCEVCSAYLGIHDNDIRLADHFGGKLHLGFLTIREKLIELEKTA 237          
BLAST of luc7 like protein-3 vs. Ensembl Fly
Match: CG3198 (gene:FBgn0029887 transcript:FBtr0070991)

HSP 1 Score: 79.337 bits (194), Expect = 1.402e-15
Identity = 40/102 (39.22%), Postives = 59/102 (57.84%), Query Frame = 3
Query:  192 LLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNS-SSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL 485
            +LDELMG NRN   S +    +W+D   C++Y   FCPH+LF+NT+  LG C ++HD    + Y+++  S  K  +E    +F    + DV RKI+  K RL
Sbjct:    8 MLDELMGRNRNLHPSEAGAKVNWEDPEFCQFYNVKFCPHDLFINTRADLGPCARIHDEEARHLYEDARPSQRKRQYEDEFLRFCNVMLHDVDRKIQKGKQRL 109          
BLAST of luc7 like protein-3 vs. Ensembl Zebrafish
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;Acc:ZDB-GENE-060616-375])

HSP 1 Score: 159.073 bits (401), Expect = 7.497e-43
Identity = 94/236 (39.83%), Postives = 141/236 (59.75%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            + S A LLDELMG +RN      + +  WDDESVCKYYL GFCP ELF NT+  LG C K+HD NL   Y+ SS FMK G+E+   ++L   + +V+R+I     RL      +N    G     +++  +   +I E V  IE+LG+EGR+EE Q    L  QL+E+++EL      +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL + +
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRCNVRWDDESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGTPGPSGKNEEKAQVLTEKIEELVVQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTHSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKL 234          
BLAST of luc7 like protein-3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 115.931 bits (289), Expect = 4.672e-28
Identity = 76/232 (32.76%), Postives = 127/232 (54.74%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSN-SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL-ENGLFSGTEIAIQ-KRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDD 851
            A A   ALLD+LMG +R+ + S++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ D  R+ E+ K RL E       E+A + +++     EI + +   E+LG EG ++E Q +  ++E+ +   K  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G+++I E LE+L KT+ D
Sbjct:    3 AQAQMRALLDQLMGTSRDGDESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEVAQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQLKKTVQD 234          
BLAST of luc7 like protein-3 vs. Ensembl Zebrafish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 110.923 bits (276), Expect = 5.230e-26
Identity = 73/231 (31.60%), Postives = 121/231 (52.38%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNS-KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   A+LD+LMG  R+ ++ ++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S   +  FE    + L  F+ D  R+ E+ K RL       S    A  +R+     EI + +   E+LG EG ++E Q +  ++ EK + LK +  ++  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E LE+L K +
Sbjct:    3 AQAQMRAMLDQLMGTGRDGDTMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECVKIHDLALRADYEIASKQQEFFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKV-EKTRTLKKEAEDIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKLRKAV 232          
BLAST of luc7 like protein-3 vs. Ensembl Zebrafish
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 100.138 bits (248), Expect = 8.095e-23
Identity = 66/211 (31.28%), Postives = 113/211 (53.55%), Query Frame = 3
Query:  231 SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL-ENGLFSGTEIAIQ-KRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDD 851
            S++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ D  R+ E+ K RL E       E+A + +++     EI + +   E+LG EG ++E Q +  ++E+ +   K  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G+++I E LE+L KT+ D
Sbjct:   10 SRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEVAQKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQEVLQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQLKKTVQD 220          
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 154.836 bits (390), Expect = 2.539e-42
Identity = 93/240 (38.75%), Postives = 147/240 (61.25%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDES 857
            + S A LLDELMG +RN      + + HWD ESVCKYYL  FCP ELF NT+  LG C K+HD NL  +Y+ SS +MK G+EK   ++L   + +V+R+I     RL   ++   SG+     K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ LK     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL + +  +S
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRKKS 238          
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 156.377 bits (394), Expect = 6.398e-42
Identity = 92/232 (39.66%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + + HWD ESVCKYYL  FCP ELF NT+  LG C K+HD NL  +Y+ SS +MK G+EK   ++L   + +V+R+I     RL   ++   SG+     K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ LK     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Match: luc7l3 (LUC7-like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:549058])

HSP 1 Score: 155.606 bits (392), Expect = 1.711e-41
Identity = 93/240 (38.75%), Postives = 147/240 (61.25%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDES 857
            + S A LLDELMG +RN      + + HWD ESVCKYYL  FCP ELF NT+  LG C K+HD NL  +Y+ SS +MK G+EK   ++L   + +V+R+I     RL   ++   SG+     K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ LK     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL + +  +S
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRTNVHWDHESVCKYYLCEFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRYMKCGYEKDFLRYLQSLLAEVERRIRRGHARLALSQSQQASGSVGPAGKNEEKIQVLTDKIDGLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLKSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKEKLRKKS 238          
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Match: luc7l2 (LUC7-like 2 pre-mRNA splicing factor [Source:NCBI gene;Acc:548778])

HSP 1 Score: 112.849 bits (281), Expect = 8.000e-27
Identity = 75/231 (32.47%), Postives = 121/231 (52.38%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDP-HWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   ALLD+LMG +R+ +S +    ++DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S      FE      L  F+ D  R+ E+ K RL +     S    A  +R+     EI + +   E+LG EG +EE Q + +++ EK +  K +  E+  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E L+EL + +
Sbjct:    3 AQAQMRALLDQLMGTSRDGDSTRQRIKFNDERVCKSHLLNCCPHDILSGTRMDLGECLKVHDLALRADYEIASKQQDFFFELDAMDHLQSFIADCDRRTEIAKKRLADTQEEISAEVAAKAERVHELNEEIGKLLAKAEQLGAEGNVEESQKVMDEV-EKTRVRKREAEEIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDELKRLV 232          
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Match: cyp3a4.2 (cytochrome P450 family 3 subfamily A member 4, gene 2 [Source:Xenbase;Acc:XB-GENE-984218])

HSP 1 Score: 105.531 bits (262), Expect = 1.274e-24
Identity = 69/230 (30.00%), Postives = 120/230 (52.17%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSN-SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   ALLD+LMG  R+ + +++   + D+ VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ +  R+ E+ K RL       S    A  +++     EI + +   E+LG EG ++E Q +  ++E+ +   +  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G++ I E LE L +T+
Sbjct:    3 AQAQMRALLDQLMGTARDGDETRQRVKFTDDRVCKSHLLDCCPHDILAGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAMDHLESFIAECDRRTELAKKRLAETQEEISAEVSAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILMEMEKVKGRKREAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFILIREKLEMLRRTV 232          
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 160.229 bits (404), Expect = 1.467e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 160.229 bits (404), Expect = 1.467e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 160.614 bits (405), Expect = 2.352e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Match: Luc7l3 (LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:1914934])

HSP 1 Score: 160.229 bits (404), Expect = 4.078e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Match: Luc7l2 (LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc:MGI:2183260])

HSP 1 Score: 111.694 bits (278), Expect = 7.240e-27
Identity = 74/231 (32.03%), Postives = 121/231 (52.38%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDP-HWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   A+LD+LMG +R+ ++ +    + D+ VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S      FE      L  F+ D  R+ EV+K RL       S    A  +R+     EI + +  +E+LG EG +EE Q + +++ EK +  K +  E+  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E LEEL + +
Sbjct:    3 AQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEV-EKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVV 232          
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Match: sp|Q5R8W6|LC7L3_PONAB (Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 6.896e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Match: sp|O95232|LC7L3_HUMAN (Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC7L3 PE=1 SV=2)

HSP 1 Score: 160.614 bits (405), Expect = 6.896e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Match: sp|Q3SX41|LC7L3_BOVIN (Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L3 PE=2 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 8.719e-43
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Match: sp|Q5SUF2|LC7L3_MOUSE (Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Luc7l3 PE=1 SV=1)

HSP 1 Score: 160.229 bits (404), Expect = 1.026e-42
Identity = 93/232 (40.09%), Postives = 143/232 (61.64%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL---ENGLFSGTEIAIQK---RITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD ESVCKYYL GFCP ELF NT+  LG C K+HD NL  +Y+ SS FMKVG+E+   ++L   + +V+R+I     RL   +N   SG      K   +I +  ++I+  ++ IE+LG+EG++EE Q    L  QL+E+++ L+     +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKVGYERDFLRYLQSLLAEVERRIRRGHARLALSQNQQSSGAAGPTGKNEEKIQVLTDKIDVLLQQIEELGSEGKVEEAQGMMKLVEQLKEERELLRSTTSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKATVEEL 230          
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Match: sp|Q7TNC4|LC7L2_MOUSE (Putative RNA-binding protein Luc7-like 2 OS=Mus musculus OX=10090 GN=Luc7l2 PE=1 SV=1)

HSP 1 Score: 112.079 bits (279), Expect = 1.085e-25
Identity = 74/231 (32.03%), Postives = 121/231 (52.38%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDP-HWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   A+LD+LMG +R+ ++ +    + D+ VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S      FE      L  F+ D  R+ EV+K RL       S    A  +R+     EI + +  +E+LG EG +EE Q + +++ EK +  K +  E+  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E LEEL + +
Sbjct:    3 AQAQMRAMLDQLMGTSRDGDTTRQRIKFSDDRVCKSHLLNCCPHDVLSGTRMDLGECLKVHDLALRADYEIASKEQDFFFELDAMDHLQSFIADCDRRTEVSKKRLAETQEEISAEVAAKAERVHELNEEIGKLLAKVEQLGAEGNVEESQKVMDEV-EKARAKKREAEEVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLEELKRVV 232          
BLAST of luc7 like protein-3 vs. TrEMBL
Match: I1ZIH3 (Luc7 like protein-3 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 496.123 bits (1276), Expect = 7.220e-172
Identity = 324/325 (99.69%), Postives = 324/325 (99.69%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDESLKSLSVKEDNNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXHKHAESRTERNXXXXXXXXXXXXXXXXXXXXXXITDKWKIRDSRNGS 1142
            MALASQAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQKRITMKENEINETVETIEKLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDESLKSLSVKEDNNRRDGRE KRSRRRSEKDSSRSRHRSRCRTRSRSHERKHKHAESRTERNSRKSERQRTRSKSRTRKHSSNKITDKWKIRDSRNGS
Sbjct:    1 MALASQAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQKRITMKENEINETVETIEKLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDESLKSLSVKEDNNRRDGRERKRSRRRSEKDSSRSRHRSRCRTRSRSHERKHKHAESRTERNSRKSERQRTRSKSRTRKHSSNKITDKWKIRDSRNGS 325          
BLAST of luc7 like protein-3 vs. TrEMBL
Match: A0A0X3P7W8 (Luc7-like protein 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=LC7L3 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 1.253e-43
Identity = 98/243 (40.33%), Postives = 142/243 (58.44%), Query Frame = 3
Query:  132 FRVFWF*VLLFHMALASQAALLDELMGINRNS---NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLE-----NGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKS--AKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEE 830
            FR  +F   L  MALASQAALLDELMG NRN+    S K PHW DE +CK +L GFCPH+LFVNTK  LG C K HD  ++  YK SS + K+G+E+   ++L   + DV ++I    +RL      N          +++I      IN+ VE  EKLG EG++++ Q +    E    +LK+++ +LE   +    + K+ +VC ICGA+  K+D    +E H+SG++H GY +I + + E
Sbjct:   13 FRFQYFAFPLVGMALASQAALLDELMGKNRNACGPESMKTPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKTHDERMVEMYKKSSRYGKMGYEEEFYRYLCYLLEDVDKRIRRGHDRLNVSKAVNPTDPDAAAEKKEKIESITRRINDLVEQAEKLGTEGKVDQAQGVLKLCE----QLKFERSQLEGDVRPGVGQAKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYVRE 251          
BLAST of luc7 like protein-3 vs. TrEMBL
Match: A0A0X3PDX7 (Luc7-like protein 3 (Fragment) OS=Schistocephalus solidus OX=70667 GN=LC7L3 PE=4 SV=1)

HSP 1 Score: 165.622 bits (418), Expect = 6.615e-43
Identity = 98/243 (40.33%), Postives = 142/243 (58.44%), Query Frame = 3
Query:  132 FRVFWF*VLLFHMALASQAALLDELMGINRNS---NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLE-----NGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKS--AKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEE 830
            FR  +F   L  MALASQAALLDELMG NRN+    S K PHW DE +CK +L GFCPH+LFVNTK  LG C K HD  ++  YK SS + K+G+E+   ++L   + DV ++I    +RL      N          +++I      IN+ VE  EKLG EG++++ Q +    E    +LK+++ +LE   +    + K+ +VC ICGA+  K+D    +E H+SG++H GY +I + + E
Sbjct:   13 FRFQYFAFPLVGMALASQAALLDELMGKNRNACGPESMKTPHWSDEDMCKSFLCGFCPHDLFVNTKTDLGPCDKTHDERMVEMYKKSSRYGKMGYEEEFYRYLCYLLEDVDKRIRRGHDRLNVSKAVNPTDPDAAAEKKEKIESITRRINDLVEQAEKLGTEGKVDQAQGVLKLCE----QLKFERSQLEGDVRPGVGQAKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYVRE 251          
BLAST of luc7 like protein-3 vs. TrEMBL
Match: A0A183QX46 (Uncharacterized protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.001e-42
Identity = 91/229 (39.74%), Postives = 134/229 (58.52%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRNS---NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAI-----QKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEE 830
            MALA+Q ALLDELMG NRN+    S   PHW D+ VCK+YL GFCPH+LFVNTK  LG CPK HD  +   YK SS F K+G+E+    +L   + DV+++I     RL           I     +++I      IN+ V+  E+LG EG++++ Q +    E    +LK+++ +LE   +    ++ +VC ICGA+  K+D    +E H+SG++H GY +I + L +
Sbjct:    1 MALAAQKALLDELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGASEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCE----QLKFERSQLEGDARPGMTQELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQ 225          
BLAST of luc7 like protein-3 vs. TrEMBL
Match: C4Q5Y4 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 GN=Smp_031920.7 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 1.752e-42
Identity = 92/231 (39.83%), Postives = 135/231 (58.44%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRNS---NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAI-----QKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSA--KEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEE 830
            MALA+Q ALLDELMG NRN+    S   PHW D+ VCK+YL GFCPH+LFVNTK  LG CPK HD  +   YK SS F K+G+E+    +L   + DV+++I     RL           I     +++I      IN+ V+  E+LG EG++++ Q +    E    +LK+++ +LE   +    + K+ +VC ICGA+  K+D    +E H+SG++H GY +I + L +
Sbjct:    1 MALAAQKALLDELMGKNRNACNGESSGGPHWSDDDVCKFYLCGFCPHDLFVNTKTDLGQCPKSHDERMRESYKKSSRFGKMGYEQDFVHYLTQLLEDVEKRIRRGHERLAVNKCVNNPDPIGASEKKEKIAALTKRINDLVKQAEELGTEGKVDQAQGVLKLCE----QLKFERSQLEGDARPGMTQTKELEVCEICGAFRIKDDAPQRVEEHLSGKMHLGYAKIRDYLRQ 227          
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 155.992 bits (393), Expect = 2.417e-42
Identity = 93/234 (39.74%), Postives = 139/234 (59.40%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDK 839
            + S A LLDELMG +RN      + +  WD E+VCKYYL GFCP ELF NT+  LG C K+HD NL   Y+ SS FMK G+E+   ++L   + +V+R+I     RL      +N    G     +++  +   +I E V  IE+LG+EGR+EE Q    L  QL+E+++EL      +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL K
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEEKAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTPSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEELKK 232          
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:103043258])

HSP 1 Score: 154.836 bits (390), Expect = 1.982e-41
Identity = 92/232 (39.66%), Postives = 138/232 (59.48%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WD E+VCKYYL GFCP ELF NT+  LG C K+HD NL   Y+ SS FMK G+E+   ++L   + +V+R+I     RL      +N    G     +++  +   +I E V  IE+LG+EGR+EE Q    L  QL+E+++EL      +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRCNVRWDHETVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKLYEKSSRFMKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPSGKNEEKAQVLTEKIEELVIQIEELGSEGRVEEAQGMMKLVEQLKEEREELSSTPSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:103037252])

HSP 1 Score: 114.775 bits (286), Expect = 1.204e-27
Identity = 75/232 (32.33%), Postives = 123/232 (53.02%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSN-SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDD 851
            A A   ALLD+LMG  R+ + S++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ D  R+ E+ K RL       S    A  +++     EI + +   E+LG EG ++E Q +  ++E+ +   K  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G+++I E LE+L KT+ D
Sbjct:    3 AQAQMRALLDQLMGTARDGDESRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECSKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEVAAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKILQEVEKVRSRKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLEQLKKTVLD 234          
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 109.768 bits (273), Expect = 5.088e-26
Identity = 71/226 (31.42%), Postives = 118/226 (52.21%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            A A   A+LD+LMG  R+ + ++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S   +  FE    + L  F+ D  R+ E+ K RL       S    A  +R+     EI + +   E+LG EG ++E Q +  ++ EK + LK +  ++  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E L++L
Sbjct:    3 AQAQMRAMLDQLMGTGRDDSMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECLKVHDLALRADYEIASKHQEYFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKV-EKTRTLKKEAEDIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDKL 227          
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Match: zgc:158803 (zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15])

HSP 1 Score: 107.842 bits (268), Expect = 1.171e-25
Identity = 75/241 (31.12%), Postives = 128/241 (53.11%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNS-KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELD-KTIDDESLKSLS 872
            A A   A+LD+LMG  R+ +S ++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S   +  FE    + L  F+ D  R+ E+ K RL       S    A  +R+     EI + +   E+LG EG ++E Q +  ++ EK + LK +  ++  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E L++L  +T++ +  K++S
Sbjct:    3 AQAQMRAMLDQLMGTGRDGDSMRQRIKFTDERVCKSHLLESCPHDILSGTRMDLGECLKVHDLALRADYEIASKHQEYFFELDAAEHLQSFIADCDRRTELAKKRLAETQEEISAEVAAKAERVHELNEEIGKLLARAEQLGGEGNVDEAQQVLEKV-EKTRTLKKEAEDIYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLDKLRVRTVNIKHHKTIS 242          
BLAST of luc7 like protein-3 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001648.1 (pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-1 gene:ENSPMAG00000001483.1 transcript:ENSPMAT00000001648.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 159.844 bits (403), Expect = 7.863e-44
Identity = 92/232 (39.66%), Postives = 141/232 (60.78%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN--SNSKK-DPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLE----NGLFSGTEIAIQ--KRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN   N K+ D HWDDE VCK+YL  +CP ELFVNT+  LG C K+HD NL   Y+ SS FM++G+E+   ++L   + DV+R+I     RL      G   G     +  ++I +    I E ++ IE++G EGR+EE Q    L  Q+++++ +L+     +E    +A+EKQ +VC +CGA++   DP++ I++H+ G+ H GY +I   +EE+
Sbjct:    1 MLSNAQLLDELMGRDRNLAPNEKRCDVHWDDERVCKHYLVEYCPAELFVNTRADLGPCDKIHDENLKKLYEKSSRFMRMGYEQDFLRYLQSIMADVERRIRRGHARLALAQTGGPMPGGASMTKNDEKIKVLTERIEELLDDIEQMGCEGRVEEAQGMMKLVEQIKDERDQLRATASTIETF--AAQEKQMEVCEVCGAFLIVGDPQSRIDDHLMGKQHMGYAKIKSTIEEM 230          
BLAST of luc7 like protein-3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 97.8265 bits (242), Expect = 1.359e-23
Identity = 67/221 (30.32%), Postives = 109/221 (49.32%), Query Frame = 3
Query:  204 LMGINRNSN-------SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            L G NR ++       S++   + D+ VCK +L   CPH+    T+M LG CPK HD+ L   Y+ +S      FE    K L  F+ D  R+ EV K RL       S    A  + +     EI + +   E LG  G +EE Q + +++E+ ++  +  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G++ I E L+EL
Sbjct:    7 LQGKNRKASHSPSRDVSRQRIKFTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRLAETQEEISAEVSAKAENVHAINEEIGKLLAKAEALGAAGNVEESQNVMDEVEKVRQRKRDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIEIREKLQEL 227          
BLAST of luc7 like protein-3 vs. Ensembl Sea Lamprey
Match: luc7l (LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GENE-040625-111])

HSP 1 Score: 63.929 bits (154), Expect = 1.635e-11
Identity = 33/85 (38.82%), Postives = 45/85 (52.94%), Query Frame = 3
Query:  231 SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL 485
            S++   + D+ VCK +L   CPH+    T+M LG CPK HD+ L   Y+ +S      FE    K L  F+ D  R+ EV K RL
Sbjct:    4 SRQRIKFTDDVVCKSHLLDCCPHDTLAGTRMDLGDCPKTHDLALRADYEIASKKKDYFFEVDAMKHLQSFIADCDRRTEVAKKRL 88          
BLAST of luc7 like protein-3 vs. Ensembl Yeast
Match: LUC7 (Essential protein associated with the U1 snRNP complex; splicing factor involved in recognition of 5' splice site; contains two zinc finger motifs; N-terminal zinc finger binds pre-mRNA; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000002245])

HSP 1 Score: 86.6557 bits (213), Expect = 1.345e-19
Identity = 73/236 (30.93%), Postives = 119/236 (50.42%), Query Frame = 3
Query:  177 ASQAALLDELMGI------NRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKL----HDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEI-AIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEE---KQKEL-KYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDK 839
            A Q  L+++LMG       NR S+ K+D    D  +CK YL G CP++LF  TK SLG CP++    H I    + K   +F +  FE+     L  FV +   +I V    L++      +I  + + + + +  I    + I+ L     +      + +L+E   K+KE+ K  +   EN  +SA++K + VC +CGAY+S+ D    + +H  G+IH GYV++ E  + L K
Sbjct:    9 AEQRKLVEQLMGRDFSFRHNRYSHQKRDLGLHDPKICKSYLVGECPYDLFQGTKQSLGKCPQMHLTKHKIQYEREVKQGKTFPE--FEREYLAILSRFVNECNGQISVALQNLKHTAEERMKIQQVTEELDVLDVRIGLMGQEIDSLIRADEVSMGMLQSVKLQELISKRKEVAKRVRNITENVGQSAQQKLQ-VCEVCGAYLSRLDTDRRLADHFLGKIHLGYVKMREDYDRLMK 241          
BLAST of luc7 like protein-3 vs. Ensembl Nematostella
Match: EDO31275 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYE8])

HSP 1 Score: 145.206 bits (365), Expect = 1.805e-40
Identity = 87/228 (38.16%), Postives = 137/228 (60.09%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            MA+ S AALLDELMG +R+       K  HW D  VCK++L GFCP ELFVNT+  LG C KLHD  +   Y+ SS   ++G+E+   ++L   + DV+R+I     RL +G  +  +   +K +T    +IN  ++ +E+LG EG++EE Q    L  QL+E++++L     ++ +   S +EKQ +VC +CGA++   D +  +++H+ G+ H GY +I   LEE+
Sbjct:    1 MAVLSAAALLDELMGSDRDLAPDQKGKRAHWSDSEVCKHFLCGFCPSELFVNTRSDLGPCEKLHDEKMKTAYEQSSRCGRMGYEEEFLRYLQNIMSDVERRIRRGHQRL-DGAQNKPDNEKEKMLT---EKINSLIDQVEQLGCEGKVEEAQGVMKLIEQLKEEREQLSGTPRDMTSMMTS-QEKQMEVCEVCGAFLIVGDAQTRVDDHLMGKQHMGYAKIKNTLEEM 223          
BLAST of luc7 like protein-3 vs. Ensembl Nematostella
Match: EDO34740 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNI9])

HSP 1 Score: 69.3218 bits (168), Expect = 9.527e-15
Identity = 33/81 (40.74%), Postives = 47/81 (58.02%), Query Frame = 3
Query:  249 WDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLEN 491
            +  + VCK YL G CPH+LF NTKM LG+C K+H+  L   ++ +S     G+     + L  F+ D  RKI + K RLE+
Sbjct:    3 FTSDRVCKSYLMGLCPHQLFNNTKMDLGSCQKIHNPALKADFEAASKTRDYGYNMDQMEHLQSFINDCDRKIAIAKKRLED 83          
BLAST of luc7 like protein-3 vs. Ensembl Nematostella
Match: EDO48445 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJX6])

HSP 1 Score: 48.1358 bits (113), Expect = 4.792e-6
Identity = 29/89 (32.58%), Postives = 52/89 (58.43%), Query Frame = 3
Query:  585 GNEGRIEECQFLNNQLEE-KQKELKYDKIELENHRKSAKEKQE-DVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            G  G +EE   L N++EE K K+ + ++I       S+ ++Q+  VC +C AY+S  D    + +H  G++H G+++I   L+EL++ I
Sbjct:   79 GAAGEVEESISLMNEVEELKIKKREAEEIYRSQLPTSSIQQQKLRVCEVCAAYLSLYDNDRRLADHFGGKLHMGFIKIRNRLQELNEEI 167          
BLAST of luc7 like protein-3 vs. Ensembl Medaka
Match: luc7l3 (LUC7 like 3 pre-mRNA splicing factor [Source:NCBI gene;Acc:101172245])

HSP 1 Score: 155.606 bits (392), Expect = 1.028e-41
Identity = 90/232 (38.79%), Postives = 138/232 (59.48%), Query Frame = 3
Query:  174 LASQAALLDELMGINRN---SNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL------ENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQF---LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            + S A LLDELMG +RN      + +  WDDESVC+YYL GFCP ELF NT+  LG C K+HD NL   Y+ SS F K G+E+   ++L   + +V+R+I     RL      +N    G     +++I +   +I + V  IE+LG+EGR+EE Q    L  QL+++++ L      +E+   +A+EKQ +VC +CGA++   D ++ +++H+ G+ H GY +I   +EEL
Sbjct:    1 MLSAAQLLDELMGRDRNLAPDEKRANVRWDDESVCRYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKTYEKSSRFQKEGYERDFLRYLQSLLAEVERRIRRGHARLALSQAQQNSGGPGPTGKNEEKIQVLTEKIEDLVVQIEELGSEGRVEEAQGMMKLVEQLKDEREMLNSTPSTIESF--AAQEKQMEVCEVCGAFLIVGDAQSRVDDHLMGKQHMGYAKIKSTVEEL 230          
BLAST of luc7 like protein-3 vs. Ensembl Medaka
Match: ENSORLT00000005146.2 (putative RNA-binding protein Luc7-like 1 [Source:NCBI gene;Acc:101163228])

HSP 1 Score: 113.62 bits (283), Expect = 5.829e-27
Identity = 75/231 (32.47%), Postives = 121/231 (52.38%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSNS-KKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED---VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   A+LD+LMG  R+ +S ++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S   +  FE    + L  F+ D  R+ E+ K RL       S    A  +R+     EI + +   E+LG EG ++E Q L  ++ EK + LK +  ++  +   A   Q+    VC +C AY+  +D    + +H  G++H G++ I E LE+L K +
Sbjct:    3 AQAQMRAMLDQLMGTGRDGDSMRQRIKFTDERVCKSHLLNSCPHDILSGTRMDLGECAKVHDLALRADYEIASKEQEYFFELDATEHLQSFIADCDRRTELAKKRLAETQDEISAEVAAKAERVHELNEEIGKLLAKAEQLGGEGNVDEAQQLLEKV-EKTRALKKEAEDVYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHIGFIEIREKLEKLRKAV 232          
BLAST of luc7 like protein-3 vs. Ensembl Medaka
Match: luc7l (LUC7 like [Source:NCBI gene;Acc:101168406])

HSP 1 Score: 112.079 bits (279), Expect = 8.341e-27
Identity = 72/230 (31.30%), Postives = 123/230 (53.48%), Query Frame = 3
Query:  171 ALASQAALLDELMGINRNSN-SKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGL--FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQED--VCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTI 845
            A A   ALLD+LMG  R+ + +++   + DE VCK +L   CPH++   T+M LG C K+HD+ L   Y+ +S    + FE      L  F+ D  R+ E+ K RL       S    A  +++     EI + +   E+LG EG ++E Q +  ++E+ + + K  + E  N   ++  +Q+   VC +C AY+  +D    + +H  G++H G+++I E L++L KT+
Sbjct:    3 AQAQMRALLDQLMGTARDGDETRQRVKFTDERVCKSHLLNCCPHDILSGTRMDLGECTKIHDLALRADYEIASKERDLFFELDAVDHLESFIADCDRRTELAKKRLAETQEEISAEVAAKAEKVHELNEEIGKLLAKAEQLGAEGNVDEAQKVLQEVEKVRTKKKDAEEEYRNSMPASSFQQQKLRVCEVCSAYLGLHDNDRRLADHFGGKLHLGFIQIREKLDQLKKTV 232          
BLAST of luc7 like protein-3 vs. Planmine SMEST
Match: SMESG000063299.1 (SMESG000063299.1)

HSP 1 Score: 220.705 bits (561), Expect = 4.849e-68
Identity = 114/224 (50.89%), Postives = 162/224 (72.32%), Query Frame = 3
Query:  183 QAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLENGLFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDDE 854
            QAALLD+LMG++RN+  K +  WD++ VCK+YLAGFCPHELFVNT++SLG C K+H+ N L KY+NSSS++ VG+E+ L++ L GFVRDV+ KI  N+ +L     S  E+ ++ RI  ++ EI+  VE IE LGNEG+IEECQ +  +LEEKQK+  YDKIELE     +   ++ VC +CGA+ +K D   + ENH++G+ H GYV+INE+L++L   ++ E
Sbjct:    5 QAALLDQLMGVDRNNIRKGEITWDNDRVCKHYLAGFCPHELFVNTRLSLGPCTKIHENNFLKKYQNSSSYLNVGYERKLQRLLEGFVRDVKLKIRSNEEKLVGNGKSRIELLLESRIEQQQKEIDSLVEKIEILGNEGKIEECQNIYLELEEKQKQYNYDKIELERIGTDSTYTKDVVCQVCGAFTNKMDMNMNDENHINGKTHSGYVKINEVLDQLASLLEKE 228          
BLAST of luc7 like protein-3 vs. Planmine SMEST
Match: SMESG000041410.1 (SMESG000041410.1)

HSP 1 Score: 174.096 bits (440), Expect = 2.284e-50
Identity = 107/233 (45.92%), Postives = 146/233 (62.66%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRNSNSKK--DPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL-ENG--LFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEELDKTIDD 851
            MA A+QAALLDELMG NRN    +    HWD + +CK YLAGFCP+ELF+NTK  +G C  +HD  L ++Y+ SS   K+ +E  LK+FL   V D  R+I  NK RL ENG  +  G  I  +++I     +I++ +E IEKLGNEG+I ECQ    + EE Q+E K+ + ++E H  +AKE +  VC ICGA   KND    ++ H +GR+H GY  + E LEE+ K+  D
Sbjct:    1 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEME--VCEICGAMQVKNDIELRVKEHEAGRMHAGYKIVREFLEEMIKSDRD 231          
BLAST of luc7 like protein-3 vs. Planmine SMEST
Match: SMESG000041410.1 (SMESG000041410.1)

HSP 1 Score: 148.288 bits (373), Expect = 1.076e-41
Identity = 92/194 (47.42%), Postives = 124/194 (63.92%), Query Frame = 3
Query:  168 MALASQAALLDELMGINRNSNSKK--DPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRL-ENG--LFSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGA 734
            MA A+QAALLDELMG NRN    +    HWD + +CK YLAGFCP+ELF+NTK  +G C  +HD  L ++Y+ SS   K+ +E  LK+FL   V D  R+I  NK RL ENG  +  G  I  +++I     +I++ +E IEKLGNEG+I ECQ    + EE Q+E K+ + ++E H  +AKE +  VC ICGA
Sbjct:    1 MAHAAQAALLDELMGRNRNDTKHQAYKIHWDSDEICKNYLAGFCPNELFINTKADMGPCELIHDDKLCDEYRKSSDHKKLRYESDLKRFLEKMVYDADRRIVSNKRRLKENGSTVIGGIIIERRRQIEELTIKIDKLIEDIEKLGNEGKIMECQLKMTECEELQREKKFFENDIELHSNNAKEME--VCEICGA 192          
BLAST of luc7 like protein-3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 132.494 bits (332), Expect = 1.328e-35
Identity = 83/221 (37.56%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  198 DELMGINRNS--NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLE-NGL-FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQL---EEKQKELKYDK--IELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            DELMG NRN+  +  K+ HWDD+ VC Y+LAG CPH LF+NTK  LG C K+H+  L+  Y+ SS + K+GFE+ L + L   V DV+R+I   + RL  NG   +G     +KR                      ++EE     N+L    EK +ELKY++   + E    S + K+ +VC +CGA+  K+D    +E H+SG++H GY ++ E L+ +
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKR----------------------KLEEVTNKINELISKAEKLEELKYEQNFYQKEIEMLSQQSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 209          
BLAST of luc7 like protein-3 vs. Planmine SMEST
Match: SMESG000063148.1 (SMESG000063148.1)

HSP 1 Score: 132.494 bits (332), Expect = 3.353e-35
Identity = 83/221 (37.56%), Postives = 123/221 (55.66%), Query Frame = 3
Query:  198 DELMGINRNS--NSKKDPHWDDESVCKYYLAGFCPHELFVNTKMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIEVNKNRLE-NGL-FSGTEIAIQKRITMXXXXXXXXXXXXXXLGNEGRIEECQFLNNQL---EEKQKELKYDK--IELENHRKSAKEKQEDVCNICGAYISKNDPRNSIENHVSGRIHCGYVRINEILEEL 833
            DELMG NRN+  +  K+ HWDD+ VC Y+LAG CPH LF+NTK  LG C K+H+  L+  Y+ SS + K+GFE+ L + L   V DV+R+I   + RL  NG   +G     +KR                      ++EE     N+L    EK +ELKY++   + E    S + K+ +VC +CGA+  K+D    +E H+SG++H GY ++ E L+ +
Sbjct:   11 DELMGKNRNNVNDFNKETHWDDDDVCCYFLAGLCPHSLFINTKADLGQCEKIHNEKLIQNYRKSSRYKKMGFEEDLYRLLNQLVSDVERRIWKGQERLRLNGPSLNGGFHEERKR----------------------KLEEVTNKINELISKAEKLEELKYEQNFYQKEIEMLSQQSKELEVCCVCGAFRIKDDAPQRVEEHLSGKMHIGYTKVREFLKNM 209          
The following BLAST results are available for this feature:
BLAST of luc7 like protein-3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LUC7L31.436e-4340.09LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L31.436e-4340.09LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L35.575e-4340.09LUC7 like 3 pre-mRNA splicing factor [Source:HGNC ... [more]
LUC7L23.910e-2632.03LUC7 like 2, pre-mRNA splicing factor [Source:HGNC... [more]
LUC7L1.294e-2530.43LUC7 like [Source:HGNC Symbol;Acc:HGNC:6723][more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C50D2.86.382e-3432.92pep chromosome:WBcel235:II:96127:98027:-1 gene:WBG... [more]
C50D2.86.382e-3432.92pep chromosome:WBcel235:II:96127:97944:-1 gene:WBG... [more]
Y119D3B.125.491e-2628.22pep chromosome:WBcel235:III:1202548:1207264:1 gene... [more]
Y119D3B.125.491e-2628.22pep chromosome:WBcel235:III:1202548:1207346:1 gene... [more]
Y119D3B.125.491e-2628.22pep chromosome:WBcel235:III:1202548:1207346:1 gene... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG75642.180e-2329.07gene:FBgn0036734 transcript:FBtr0344941[more]
CG75642.180e-2329.07gene:FBgn0036734 transcript:FBtr0345387[more]
CG75642.180e-2329.07gene:FBgn0036734 transcript:FBtr0075175[more]
CG75642.180e-2329.07gene:FBgn0036734 transcript:FBtr0331842[more]
CG31981.402e-1539.22gene:FBgn0029887 transcript:FBtr0070991[more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
luc7l37.497e-4339.83LUC7-like 3 pre-mRNA splicing factor [Source:ZFIN;... [more]
luc7l4.672e-2832.76LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
zgc:1588035.230e-2631.60zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
luc7l8.095e-2331.28LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l32.539e-4238.75LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l36.398e-4239.66LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l31.711e-4138.75LUC7-like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l28.000e-2732.47LUC7-like 2 pre-mRNA splicing factor [Source:NCBI ... [more]
cyp3a4.21.274e-2430.00cytochrome P450 family 3 subfamily A member 4, gen... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Luc7l31.467e-4340.09LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l31.467e-4340.09LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l32.352e-4340.09LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l34.078e-4340.09LUC7-like 3 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
Luc7l27.240e-2732.03LUC7-like 2 (S. cerevisiae) [Source:MGI Symbol;Acc... [more]
back to top
BLAST of luc7 like protein-3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5R8W6|LC7L3_PONAB6.896e-4340.09Luc7-like protein 3 OS=Pongo abelii OX=9601 GN=LUC... [more]
sp|O95232|LC7L3_HUMAN6.896e-4340.09Luc7-like protein 3 OS=Homo sapiens OX=9606 GN=LUC... [more]
sp|Q3SX41|LC7L3_BOVIN8.719e-4340.09Luc7-like protein 3 OS=Bos taurus OX=9913 GN=LUC7L... [more]
sp|Q5SUF2|LC7L3_MOUSE1.026e-4240.09Luc7-like protein 3 OS=Mus musculus OX=10090 GN=Lu... [more]
sp|Q7TNC4|LC7L2_MOUSE1.085e-2532.03Putative RNA-binding protein Luc7-like 2 OS=Mus mu... [more]
back to top
BLAST of luc7 like protein-3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
I1ZIH37.220e-17299.69Luc7 like protein-3 OS=Schmidtea mediterranea OX=7... [more]
A0A0X3P7W81.253e-4340.33Luc7-like protein 3 (Fragment) OS=Schistocephalus ... [more]
A0A0X3PDX76.615e-4340.33Luc7-like protein 3 (Fragment) OS=Schistocephalus ... [more]
A0A183QX461.001e-4239.74Uncharacterized protein OS=Schistosoma rodhaini OX... [more]
C4Q5Y41.752e-4239.83Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
luc7l32.417e-4239.74LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l31.982e-4139.66LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
luc7l1.204e-2732.33LUC7 like [Source:NCBI gene;Acc:103037252][more]
zgc:1588035.088e-2631.42zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
zgc:1588031.171e-2531.12zgc:158803 [Source:ZFIN;Acc:ZDB-GENE-070424-15][more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001648.17.863e-4439.66pep scaffold:Pmarinus_7.0:GL476581:121672:135516:-... [more]
luc7l1.359e-2330.32LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
luc7l1.635e-1138.82LUC7-like (S. cerevisiae) [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
LUC71.345e-1930.93Essential protein associated with the U1 snRNP com... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO312751.805e-4038.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO347409.527e-1540.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484454.792e-632.58Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of luc7 like protein-3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
luc7l31.028e-4138.79LUC7 like 3 pre-mRNA splicing factor [Source:NCBI ... [more]
ENSORLT00000005146.25.829e-2732.47putative RNA-binding protein Luc7-like 1 [Source:N... [more]
luc7l8.341e-2731.30LUC7 like [Source:NCBI gene;Acc:101168406][more]
back to top
BLAST of luc7 like protein-3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000063299.14.849e-6850.89SMESG000063299.1[more]
SMESG000041410.12.284e-5045.92SMESG000041410.1[more]
SMESG000041410.11.076e-4147.42SMESG000041410.1[more]
SMESG000063148.11.328e-3537.56SMESG000063148.1[more]
SMESG000063148.13.353e-3537.56SMESG000063148.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30015962
GenBankAFJ24827.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015962 ID=SMED30015962|Name=luc7 like protein-3|organism=Schmidtea mediterranea sexual|type=transcript|length=1473bp
GTTTAAATCATTATTTTGTAAATTAGCGCAAATCAAATTTTAACAAATCT
CATTATTTCATTGGAGGTTTATATCCTTAACTTATTTGTTTCTATTTTGT
TACATATTAACATATCCTTTGAAAAGTTAATTTTCGAGTTTTTTGGTTTT
AGGTATTGTTATTCCACATGGCACTGGCATCTCAAGCAGCTCTTCTTGAT
GAACTCATGGGTATCAATAGAAATAGTAATAGCAAAAAAGATCCTCACTG
GGACGATGAAAGCGTGTGTAAATACTATCTTGCTGGTTTTTGTCCACATG
AATTATTTGTTAACACAAAAATGTCCCTTGGTGCTTGTCCAAAATTACAT
GACATAAATCTTTTGAATAAGTATAAAAATAGTTCATCTTTTATGAAAGT
TGGATTTGAGAAGCTATTGAAAAAATTTCTTGGGGGTTTTGTTAGAGATG
TTCAGCGAAAAATAGAAGTTAATAAAAATCGTTTGGAAAATGGATTGTTT
TCTGGTACTGAAATCGCAATACAAAAAAGAATTACAATGAAAGAAAACGA
AATTAATGAAACCGTTGAAACGATTGAAAAACTAGGTAATGAGGGTCGAA
TTGAAGAATGTCAATTTTTAAATAATCAATTAGAAGAAAAACAAAAAGAA
CTGAAATATGATAAGATAGAATTAGAAAATCACCGAAAAAGTGCCAAAGA
AAAGCAAGAAGATGTTTGCAATATTTGCGGAGCATATATAAGTAAAAATG
ATCCAAGAAACAGCATTGAAAACCATGTGAGTGGTAGAATTCATTGTGGA
TATGTCAGGATTAATGAAATTCTTGAAGAATTAGATAAAACAATAGATGA
TGAATCTTTGAAATCATTGAGTGTTAAAGAGGACAACAATAGAAGAGATG
GGCGTGAAAGCAAACGAAGTAGGCGACGCAGTGAAAAGGACAGTAGTCGT
AGTAGGCATAGAAGCAGATGCAGAACAAGATCAAGAAGTCACGAAAGAAA
GCATAAACATGCGGAATCAAGAACTGAAAGAAATTCCAGGAAATCGGAGA
GACAAAGAACTCGAAGTAAAAGTCGTACAAGGAAACATTCTTCTAACAAA
ATTACTGATAAATGGAAAATTAGGGATTCAAGAAATGGGAGCTGAAGTTA
TTGGAAAGCTGTCAACTAAAAACTCAGAGTCTTCATTTACTATTGCATAT
CATCGAATTAGAATAATTCGGCAACAATACTTAAAAGTGGATATTGAAAG
GTTGTTTAACAAATTTTGACAACAGTGATGTCATTTTGCTTTCTCATGAT
AATGGGTTTGCCACCCAAATTCCTATTGAAGTTTTGATAATTGAAATGTG
TAAATTTTTAATTTCAGAAAAAAATTTCAATACCAATATAATTTTTGATC
AGTTTTGAGGCTTTTCGACACTTGAATAACATCAAGCAGTTACTTGTTAA
GATTTTTTTATGGAGAAGAAAAC
back to top

protein sequence of SMED30015962-orf-1

>SMED30015962-orf-1 ID=SMED30015962-orf-1|Name=SMED30015962-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MGVKANEVGDAVKRTVVVVGIEADAEQDQEVTKESINMRNQELKEIPGNR
RDKELEVKVVQGNILLTKLLINGKLGIQEMGAEVIGKLSTKNSESSFTIA
YHRIRIIRQQYLKVDIERLFNKF*
back to top

protein sequence of SMED30015962-orf-2

>SMED30015962-orf-2 ID=SMED30015962-orf-2|Name=SMED30015962-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=326bp
MALASQAALLDELMGINRNSNSKKDPHWDDESVCKYYLAGFCPHELFVNT
KMSLGACPKLHDINLLNKYKNSSSFMKVGFEKLLKKFLGGFVRDVQRKIE
VNKNRLENGLFSGTEIAIQKRITMKENEINETVETIEKLGNEGRIEECQF
LNNQLEEKQKELKYDKIELENHRKSAKEKQEDVCNICGAYISKNDPRNSI
ENHVSGRIHCGYVRINEILEELDKTIDDESLKSLSVKEDNNRRDGRESKR
SRRRSEKDSSRSRHRSRCRTRSRSHERKHKHAESRTERNSRKSERQRTRS
KSRTRKHSSNKITDKWKIRDSRNGS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR004882Luc7-rel
Vocabulary: biological process
TermDefinition
GO:0006376mRNA splice site selection
Vocabulary: cellular component
TermDefinition
GO:0005685U1 snRNP
Vocabulary: molecular function
TermDefinition
GO:0003729mRNA binding