SMED30015961

Overview
NameSMED30015961
Smed IDSMED30015961
Length (bp)509
Neoblast Clusters

Zeng et. al., 2018



 

 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)



Explore this single cell expression dataset with our NB Cluster Shiny App



Embryonic Expression

Davies et. al., 2017

Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020



SMED30015961

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30015961 dd_Smed_v4_26920_1_1dd_Smed_v4PMID:29674431
Fincher et al., 2018		FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30015961 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.028596:9577..10085 -2482
v31.004379:36749..37257 +2455
Homology
[Close]
BLAST of SMED30015961 vs. TrEMBL
Match: A0A0C2J3B7 (Uncharacterized protein OS=Thelohanellus kitauei OX=669202 GN=RF11_12426 PE=4 SV=1)

HSP 1 Score: 55.0694 bits (131), Expect = 4.125e-6
Identity = 33/76 (43.42%), Postives = 40/76 (52.63%), Query Frame = -3 
Query:   88 RCHTQVINSPLLVSMNISDINFPDHYKVTYDGQNFLLNVYGREYNNQILFFGTHDNLRLLETTSHWFLI*THQFLP 315
            R  + VINS    S    +I  PD  K+T   QNFLL   G EY N++  FGT  NL+LLE    WFL  T +  P
Sbjct:   80 RKRSDVINSR---SNTPQEITLPDTLKLTTRFQNFLLYDLGDEYTNRVFMFGTAGNLQLLEEYPQWFLDGTFKIAP 152
The following BLAST results are available for this feature:
BLAST of SMED30015961 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 1
Match NameE-valueIdentityDescription
A0A0C2J3B74.125e-643.42Uncharacterized protein OS=Thelohanellus kitauei O... [more]
back to top
BLAST of SMED30015961 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of SMED30015961 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015961 ID=SMED30015961|Name=SMED30015961|organism=Schmidtea mediterranea sexual|type=transcript|length=509bp
ATATTTGTAATATACGCTAGAAAGAAAGATTATGTGCTATACCATGTAGA
TAACCTAAAATGTTACTATCATGATATTTGCCAACTATGGCAAGAATTGA
TGCGTTTAAATCAAAAACCAATGCGATGTTGTTTCCAATAATCTGAGATT
GTCATGTGTTCCAAAGAATAATATTTGATTGTTATACTCTCTGCCGTAAA
CATTCAGAAGGAAATTTTGGCCATCATATGTAACTTTGTAATGATCGGGA
AAATTGATATCACTTATATTCATCGAAACGAGTAATGGACTATTAATAAC
TTGAGTGTGACATCTGACATTGAGAATAATTGTTTAACCGTCCCACCATT
TCTTATTCACGAAGTTTAATTTTAGCCTTACATTGAAACTTGTTGCGCCT
TTGATCACACTCAAATGACACAACACTATTTTCGAAATCTTTCTGTTTCA
CATACACATAACCTTCAACAACCACTTTCTATTATCCTTTATTCGATTTT
ACAAACCGC
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR007588Znf_FLYWCH