Metallophos domain-containing protein

Overview
NameMetallophos domain-containing protein
Smed IDSMED30015956
Length (bp)3519
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Metallophos domain-containing protein (SMED30015956) t-SNE clustered cells

Violin plots show distribution of expression levels for Metallophos domain-containing protein (SMED30015956) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Metallophos domain-containing protein (SMED30015956) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Metallophos domain-containing protein (SMED30015956) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30015956

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30015956SMESG000024647.1 dd_Smed_v4_8403_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30015956 dd_Smed_v6_17883_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30015956 dd_Smed_v4_17883_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 84.3445 bits (207), Expect = 2.468e-16
Identity = 42/121 (34.71%), Postives = 66/121 (54.55%), Query Frame = 2
Query:  509 QILPGCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            ++ PG FY   +   +    I+VLN  L+Y  N+     +DP  QF WL+  L  A  +   V++V HV PG  E    K   F   FN+++LK+++ +  VI   FF H HTD+F+++Y+
Sbjct:  121 EVFPGAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW-FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYD 240          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 79.337 bits (194), Expect = 8.246e-15
Identity = 41/117 (35.04%), Postives = 63/117 (53.85%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            G FY   +   +    I+VLN  L+Y  N+     +DP  QF WL+  L  A  +   V++V HV PG  E    K   F   FN+++LK+++ +  VI   FF H HTD+F+++Y+
Sbjct:  173 GAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW-FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYD 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: SMPDL3B (sphingomyelin phosphodiesterase acid like 3B [Source:HGNC Symbol;Acc:HGNC:21416])

HSP 1 Score: 78.9518 bits (193), Expect = 1.698e-14
Identity = 41/117 (35.04%), Postives = 63/117 (53.85%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            G FY   +   +    I+VLN  L+Y  N+     +DP  QF WL+  L  A  +   V++V HV PG  E    K   F   FN+++LK+++ +  VI   FF H HTD+F+++Y+
Sbjct:  173 GAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW-FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYD 288          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: SMPDL3A (sphingomyelin phosphodiesterase acid like 3A [Source:HGNC Symbol;Acc:HGNC:17389])

HSP 1 Score: 69.3218 bits (168), Expect = 9.119e-12
Identity = 41/130 (31.54%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNKKTVYNKNFI 910
            G FY+  + T N    II LN  L+Y  N      +DP NQF WL++ L  ++ +  KV+++AHV  G   S+          +N++ + + Q Y+DVI   F+ H H D+  ++  S+ K +  N  F+
Sbjct:   59 GGFYSQKV-TTNPNLRIISLNTNLYYGPNIMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSSQ-NITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVL--SDKKGSPVNSLFV 184          
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Match: SMPDL3A (sphingomyelin phosphodiesterase acid like 3A [Source:HGNC Symbol;Acc:HGNC:17389])

HSP 1 Score: 69.3218 bits (168), Expect = 2.221e-11
Identity = 41/130 (31.54%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNKKTVYNKNFI 910
            G FY+  + T N    II LN  L+Y  N      +DP NQF WL++ L  ++ +  KV+++AHV  G   S+          +N++ + + Q Y+DVI   F+ H H D+  ++  S+ K +  N  F+
Sbjct:  190 GGFYSQKV-TTNPNLRIISLNTNLYYGPNIMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSS-QNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVL--SDKKGSPVNSLFV 315          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186012:10190157:-1 gene:WBGene00014106.1 transcript:ZK856.5.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 64.3142 bits (155), Expect = 2.848e-10
Identity = 45/131 (34.35%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  515 LPGCFYTHSIDTKNSKQMIIVLNAILWYQVN-SYVK-TNS-DPLNQFMWLKTKL--------RLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNS 874
            L G +Y + +    +    +VLN  L+Y  N +YV  TN  DP +QF +L+ +L        R++      V +VAH+ PG  E  P  F  F  ++N+RFL L   YA+ I    F H HTD F ++ +S
Sbjct:  168 LKGGYYKYRLRNATA----VVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTP-NFTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDS 293          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186023:10190366:-1 gene:WBGene00014106.1 transcript:ZK856.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 64.3142 bits (155), Expect = 2.848e-10
Identity = 45/131 (34.35%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  515 LPGCFYTHSIDTKNSKQMIIVLNAILWYQVN-SYVK-TNS-DPLNQFMWLKTKL--------RLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNS 874
            L G +Y + +    +    +VLN  L+Y  N +YV  TN  DP +QF +L+ +L        R++      V +VAH+ PG  E  P  F  F  ++N+RFL L   YA+ I    F H HTD F ++ +S
Sbjct:  168 LKGGYYKYRLRNATA----VVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTP-NFTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDS 293          
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Match: ZK856.5 (pep chromosome:WBcel235:V:10186023:10190131:-1 gene:WBGene00014106.1 transcript:ZK856.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:ZK856.5)

HSP 1 Score: 64.3142 bits (155), Expect = 2.848e-10
Identity = 45/131 (34.35%), Postives = 67/131 (51.15%), Query Frame = 2
Query:  515 LPGCFYTHSIDTKNSKQMIIVLNAILWYQVN-SYVK-TNS-DPLNQFMWLKTKL--------RLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNS 874
            L G +Y + +    +    +VLN  L+Y  N +YV  TN  DP +QF +L+ +L        R++      V +VAH+ PG  E  P  F  F  ++N+RFL L   YA+ I    F H HTD F ++ +S
Sbjct:  168 LKGGYYKYRLRNATA----VVLNTNLYYNANKAYVNFTNKVDPADQFAFLEKELSNAEKCPNRISENCTSIVHIVAHIGPGVFEKTP-NFTWFRDEYNERFLDLTVRYANSIGWMIFGHHHTDTFHLIKDS 293          
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0347598)

HSP 1 Score: 61.2326 bits (147), Expect = 4.312e-9
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  641 QFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHN---FHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            Q++WL+  L  ++     V++V H+ PG  E +    HN   F  + NQR+L +++ +A VI   FF H H+D F+++Y++  
Sbjct:  241 QWLWLEEVLTKSKEKQETVYIVGHMPPGVDERHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKG 323          
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0347599)

HSP 1 Score: 61.2326 bits (147), Expect = 4.312e-9
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  641 QFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHN---FHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            Q++WL+  L  ++     V++V H+ PG  E +    HN   F  + NQR+L +++ +A VI   FF H H+D F+++Y++  
Sbjct:  241 QWLWLEEVLTKSKEKQETVYIVGHMPPGVDERHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKG 323          
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Match: CG32052 (gene:FBgn0044328 transcript:FBtr0332818)

HSP 1 Score: 61.2326 bits (147), Expect = 4.312e-9
Identity = 27/83 (32.53%), Postives = 48/83 (57.83%), Query Frame = 2
Query:  641 QFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHN---FHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            Q++WL+  L  ++     V++V H+ PG  E +    HN   F  + NQR+L +++ +A VI   FF H H+D F+++Y++  
Sbjct:  241 QWLWLEEVLTKSKEKQETVYIVGHMPPGVDERHLGTQHNQLTFTERNNQRYLDMVRRFAPVIQGQFFGHLHSDTFRLIYDAKG 323          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:ZFIN;Acc:ZDB-GENE-041008-132])

HSP 1 Score: 82.4185 bits (202), Expect = 9.300e-16
Identity = 45/120 (37.50%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G +YT  +  +   + +IVLN  L+Y  N   +   DP +QF W    L+ A  +  KV+L+ HV PG  E    K   F  +FN+R+++LIQ ++ VI   FF H HTD+F++ YNS  
Sbjct:  175 GGYYTEKLLNQTGLR-VIVLNTNLYYDQNKLTEKVKDPADQFSWADKVLQDAAKNNEKVYLIGHVPPGLFEKKRDKGW-FRKEFNKRYIELIQKHSAVIMGQFFGHHHTDSFRMFYNSKG 292          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:ZFIN;Acc:ZDB-GENE-050327-61])

HSP 1 Score: 68.5514 bits (166), Expect = 2.538e-11
Identity = 34/108 (31.48%), Postives = 60/108 (55.56%), Query Frame = 2
Query:  569 IIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGA---AESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            ++ LN  L+Y  N      SDP  QF WL+  L L+R SM KV+++AHV  G    A++      N    +N++ +K+ ++Y++V++  F+ H H D+  ++ +   K
Sbjct:  199 LLSLNTNLYYSPNEVTVNMSDPAGQFQWLQETLELSRQSMEKVYVIAHVPIGYLPFAKNTTAMREN----YNEQLVKIFRNYSEVVEGQFYGHTHRDSIMVLLDQQGK 302          
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:ZFIN;Acc:ZDB-GENE-050327-61])

HSP 1 Score: 63.1586 bits (152), Expect = 1.603e-10
Identity = 29/89 (32.58%), Postives = 52/89 (58.43%), Query Frame = 2
Query:  626 SDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGA---AESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            SDP  QF WL+  L L+R SM KV+++AHV  G    A++      N    +N++ +K+ ++Y++V++  F+ H H D+  ++ +   K
Sbjct:    3 SDPAGQFQWLQETLELSRQSMEKVYVIAHVPIGYLPFAKNTTAMREN----YNEQLVKIFRNYSEVVEGQFYGHTHRDSIMVLLDQQGK 87          
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Match: ak9 (adenylate kinase 9 [Source:Xenbase;Acc:XB-GENE-994660])

HSP 1 Score: 84.7297 bits (208), Expect = 2.400e-16
Identity = 43/120 (35.83%), Postives = 66/120 (55.00%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G +Y+  +    +   +IVLN  L+Y  NS      DP +QF WL+ +L  A     KV++V HV PG  E    K   F  +FN+R++++IQ +  VI   FF H HTD+F++ Y+ + 
Sbjct:  173 GAYYSEELKDVGAAGRMIVLNTNLYYDSNSLTANMKDPGDQFQWLEDQLNNANLKGEKVYIVGHVPPGYFEKKRDKPW-FREEFNKRYIEIIQKHHRVIQGQFFGHHHTDSFRMFYSDSG 291          
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Match: smpdl3a (sphingomyelin phosphodiesterase acid-like 3A [Source:NCBI gene;Acc:595006])

HSP 1 Score: 73.1738 bits (178), Expect = 9.935e-13
Identity = 38/109 (34.86%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  569 IIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHP----QFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            II LN  L+Y  N      +DP NQF WL+  L+++R +  KV+++AHV  G      + F    P     FN+R +K+ ++Y+DVI A F+ H H D+  ++ +   K
Sbjct:  204 IISLNTNLYYTPNKVTVNMTDPANQFEWLEDTLKISRQNNEKVYIIAHVPVGY-----LPFARLTPAMRETFNERLVKIFRNYSDVITAQFYGHTHRDSIMVLLDEKEK 307          
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Match: smpdl3a (sphingomyelin phosphodiesterase acid-like 3A [Source:NCBI gene;Acc:595006])

HSP 1 Score: 73.1738 bits (178), Expect = 1.135e-12
Identity = 38/109 (34.86%), Postives = 60/109 (55.05%), Query Frame = 2
Query:  569 IIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHP----QFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            II LN  L+Y  N      +DP NQF WL+  L+++R +  KV+++AHV  G      + F    P     FN+R +K+ ++Y+DVI A F+ H H D+  ++ +   K
Sbjct:  180 IISLNTNLYYTPNKVTVNMTDPANQFEWLEDTLKISRQNNEKVYIIAHVPVGY-----LPFARLTPAMRETFNERLVKIFRNYSDVITAQFYGHTHRDSIMVLLDEKEK 283          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Smpdl3b (sphingomyelin phosphodiesterase, acid-like 3B [Source:MGI Symbol;Acc:MGI:1916022])

HSP 1 Score: 77.411 bits (189), Expect = 4.244e-14
Identity = 41/120 (34.17%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G FY+  +   +    ++VLN  L+Y  N      +DP  QF WL   L  A      V+++ HV PG  E    K   F   FN+ +LK+IQ +  VI   FF H HTD+F++ Y++  
Sbjct:  173 GAFYSEKLPGPSRAGRVVVLNTNLYYSNNEQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFEKTQNKAW-FRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYDNTG 291          
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Match: Smpdl3a (sphingomyelin phosphodiesterase, acid-like 3A [Source:MGI Symbol;Acc:MGI:1931437])

HSP 1 Score: 62.3882 bits (150), Expect = 2.054e-9
Identity = 36/124 (29.03%), Postives = 62/124 (50.00%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVS----PGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G FY+  +   N    II LN  L+Y  N      +DP NQF WL+  L  +  +  KV+++AHV     P A ++  ++ +     +N++ L + + Y+ VI   F+ H H D+  ++ + N 
Sbjct:  187 GGFYSQKV-ASNPGLRIISLNTNLYYGPNIMTLNKTDPANQFEWLENTLNSSLWNKEKVYIIAHVPVGYLPYATDTPAIRQY-----YNEKLLDIFRRYSSVIAGQFYGHTHRDSLMVLSDKNG 304          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92485|ASM3B_HUMAN (Acid sphingomyelinase-like phosphodiesterase 3b OS=Homo sapiens OX=9606 GN=SMPDL3B PE=1 SV=2)

HSP 1 Score: 78.9518 bits (193), Expect = 8.154e-14
Identity = 41/117 (35.04%), Postives = 63/117 (53.85%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            G FY   +   +    I+VLN  L+Y  N+     +DP  QF WL+  L  A  +   V++V HV PG  E    K   F   FN+++LK+++ +  VI   FF H HTD+F+++Y+
Sbjct:  173 GAFYCEKLPGPSGAGRIVVLNTNLYYTSNALTADMADPGQQFQWLEDVLTDASKAGDMVYIVGHVPPGFFEKTQNKAW-FREGFNEKYLKVVRKHHRVIAGQFFGHHHTDSFRMLYD 288          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|P58242|ASM3B_MOUSE (Acid sphingomyelinase-like phosphodiesterase 3b OS=Mus musculus OX=10090 GN=Smpdl3b PE=1 SV=1)

HSP 1 Score: 77.411 bits (189), Expect = 2.969e-13
Identity = 41/120 (34.17%), Postives = 60/120 (50.00%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G FY+  +   +    ++VLN  L+Y  N      +DP  QF WL   L  A      V+++ HV PG  E    K   F   FN+ +LK+IQ +  VI   FF H HTD+F++ Y++  
Sbjct:  173 GAFYSEKLPGPSRAGRVVVLNTNLYYSNNEQTAGMADPGEQFRWLGDVLSNASRDGEMVYVIGHVPPGFFEKTQNKAW-FRESFNEEYLKVIQKHHRVIAGQFFGHHHTDSFRMFYDNTG 291          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q54SR8|SGMC_DICDI (Sphingomyelinase phosphodiesterase C OS=Dictyostelium discoideum OX=44689 GN=sgmC PE=3 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.711e-13
Identity = 40/120 (33.33%), Postives = 61/120 (50.83%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN 880
            G +YT  +   +    II LN + +Y  N      +DP  Q +WL   L  A  +  +V+++ HV PG  E   V   NFH QFN  +L     Y+D+I+   + H+HTD F++ Y+  N
Sbjct:  187 GGYYTELV---SEGFRIISLNTVFYYNENRQCLNLTDPAGQLLWLNETLANASLAGERVWIIGHVPPGYNEKYDV--FNFHKQFNDEYLFSFSQYSDIIEFHIYGHEHTDTFRLFYDDPN 301          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3ZC91|ASM3A_BOVIN (Acid sphingomyelinase-like phosphodiesterase 3a OS=Bos taurus OX=9913 GN=SMPDL3A PE=2 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 3.993e-11
Identity = 40/126 (31.75%), Postives = 65/126 (51.59%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPG-----AAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            G FYT  + + N K  II LN  L+Y  NS     +DP NQF WL+  L +++ +  KV+++AHV  G        S   K+H      N++ + + + Y+D+I   F+ H H D+  ++ +   K
Sbjct:  187 GGFYTQKV-SNNPKLRIISLNTNLYYGPNSVTLNQTDPANQFEWLENTLNISQQNKEKVYIIAHVPVGYLPYARGISAMRKYH------NEKLIDIFRKYSDIIAGQFYGHTHRDSIMVLSDKKGK 305          
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Match: sp|Q92484|ASM3A_HUMAN (Acid sphingomyelinase-like phosphodiesterase 3a OS=Homo sapiens OX=9606 GN=SMPDL3A PE=1 SV=2)

HSP 1 Score: 69.3218 bits (168), Expect = 1.067e-10
Identity = 41/130 (31.54%), Postives = 67/130 (51.54%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNKKTVYNKNFI 910
            G FY+  + T N    II LN  L+Y  N      +DP NQF WL++ L  ++ +  KV+++AHV  G   S+          +N++ + + Q Y+DVI   F+ H H D+  ++  S+ K +  N  F+
Sbjct:  190 GGFYSQKV-TTNPNLRIISLNTNLYYGPNIMTLNKTDPANQFEWLESTLNNSQQNKEKVYIIAHVPVGYLPSS-QNITAMREYYNEKLIDIFQKYSDVIAGQFYGHTHRDSIMVL--SDKKGSPVNSLFV 315          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A0X3PCP8 (Metallophos domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR117202 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.258e-22
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIV-LNAILWYQVNSYVKTN-SDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIV 865
            GCF++  ++      ++++ +N +LWY  N     +  DP+ QF WL+  L  AR S  KV L+ H  PGA E++P K+ +F  ++NQRFL L+ D AD++  G FAHQHTD F+++
Sbjct:  179 GCFFSRRLNISGGSSLVLISVNGMLWYSNNRKADASLPDPVGQFAWLEATLSRARESNTKVLLICHFPPGATENSPEKYRHFFEKYNQRFLDLLLDNADILIGGLFAHQHTDTFRVL 295          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A0V0JC01 (Acid sphingomyelinase-like phosphodiesterase 3b OS=Schistocephalus solidus OX=70667 GN=ASM3B PE=4 SV=1)

HSP 1 Score: 110.538 bits (275), Expect = 1.290e-20
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIV-LNAILWYQVNSYVKTN-SDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIV 865
            GCF++  ++      ++++ +N +LWY  N     +  DP+ QF WL+  L  AR S  KV L+ H  PGA E++P K+ +F  ++NQRFL L+ D AD++  G FAHQHTD F+++
Sbjct:  193 GCFFSRRLNISGGSSLVLISVNGMLWYSNNRKADASLPDPVGQFAWLEATLSRARESNTKVLLICHFPPGATENSPEKYRHFFEKYNQRFLDLLLDNADILIGGLFAHQHTDTFRVL 309          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A183T178 (Metallophos domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS10226 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.832e-20
Identity = 47/117 (40.17%), Postives = 73/117 (62.39%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIV-LNAILWYQVNSYVKTN-SDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIV 865
            GCF++  ++      ++++ +N +LWY  N     +  DP+ QF WL+  L  AR S  KV L+ H  PGA E++P K+ +F  ++NQRFL L+ D AD++  G FAHQHTD F+++
Sbjct:  373 GCFFSRRLNISGGSSLVLISVNGMLWYSNNRKADASLPDPVGQFAWLEATLSRARESNTKVLLICHFPPGATENSPEKYRHFFEKYNQRFLDLLLDNADILIGGLFAHQHTDTFRVL 489          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A4S2LMK8 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006457 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 1.746e-19
Identity = 47/118 (39.83%), Postives = 73/118 (61.86%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSY-VKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            GCF++H +    S  +++ +N ++WY+ N   V   SDPL QF WL      AR+S  K+ LV+H  PGA+E+ P  F      FN+RF++L+Q  AD++ AG FAH H D+F+++ +
Sbjct:   86 GCFFSHLLHLPTSDLLLVSVNGLIWYRENPLLVHAGSDPLQQFDWLNATFAWARSSKCKILLVSHFPPGASENTPRGFKFLQSGFNKRFVQLLQANADILMAGLFAHTHVDSFRVLSD 203          
BLAST of Metallophos domain-containing protein vs. TrEMBL
Match: A0A4S2LKV7 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006457 PE=4 SV=1)

HSP 1 Score: 106.301 bits (264), Expect = 2.031e-19
Identity = 47/118 (39.83%), Postives = 73/118 (61.86%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSY-VKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            GCF++H +    S  +++ +N ++WY+ N   V   SDPL QF WL      AR+S  K+ LV+H  PGA+E+ P  F      FN+RF++L+Q  AD++ AG FAH H D+F+++ +
Sbjct:  202 GCFFSHLLHLPTSDLLLVSVNGLIWYRENPLLVHAGSDPLQQFDWLNATFAWARSSKCKILLVSHFPPGASENTPRGFKFLQSGFNKRFVQLLQANADILMAGLFAHTHVDSFRVLSD 319          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:NCBI gene;Acc:103027922])

HSP 1 Score: 84.3445 bits (207), Expect = 1.696e-16
Identity = 46/119 (38.66%), Postives = 68/119 (57.14%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHN--FHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYN 871
            G +YT  +  +   + ++VLN  L+Y  N   +  +DP +QF W    L  A  +M KV++V HV PG  E    K H   F PQFN+ +L+LIQ + D+I   FF H HTD+F++ Y+
Sbjct:  176 GGYYTEKLLNQTGLR-VLVLNTNLYYDQNKITENINDPADQFRWADQVLSEAAKNMEKVYIVGHVPPGFFEK---KRHKPWFRPQFNKHYLELIQKHHDIIIGQFFGHHHTDSFRLFYD 290          
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:NCBI gene;Acc:103046912])

HSP 1 Score: 63.1586 bits (152), Expect = 9.459e-10
Identity = 33/125 (26.40%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVS----PGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            G FY+  I        ++ LN   +Y  N   +  +DP  QF WL+  L L++ S+ KV+++AHV     P A ++  ++ H+     N++ + + + Y+ +I   F+ H H D+  ++ +   K
Sbjct:  189 GGFYSQLI---KPGLRVVSLNTNFYYTPNKATENLTDPGGQFKWLQDTLELSKQSLEKVYVIAHVPIGYLPYAKDTTAMREHH-----NEKLVDIFRSYSSIIQGQFYGHTHRDSIMVLLDQQGK 305          
BLAST of Metallophos domain-containing protein vs. Ensembl Sea Lamprey
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:ZFIN;Acc:ZDB-GENE-041008-132])

HSP 1 Score: 50.8322 bits (120), Expect = 1.443e-6
Identity = 26/68 (38.24%), Postives = 36/68 (52.94%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPG 724
            G +Y+  +    + Q I+VLN  L+Y  N      +DP  QF WL   L  A A+  KVF++ HV PG
Sbjct:  173 GAYYSEKL-VGRAGQRIVVLNTNLYYASNVQTAGLADPAGQFDWLDKVLTNASANKEKVFIIGHVPPG 239          
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Match: EDO46993 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNV6])

HSP 1 Score: 54.299 bits (129), Expect = 2.640e-7
Identity = 34/140 (24.29%), Postives = 64/140 (45.71%), Query Frame = 2
Query:  515 LPGCFYTHSIDTKNSKQMIIVLNAILW--YQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPG----AAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKI-VYNSNNKKTVYNKNFII 913
            L G +Y   +   + + ++++LN++ W  Y V            Q  WL+ +L  A+    KVF+  H+ PG      +  P    N   ++      ++  Y+D++   FFAH H D FK+ ++N++   T    +F +
Sbjct:  263 LDGGYY--KVHIADGRMILLILNSMYWNPYAVEKSYNVQVIAKRQLDWLEQQLEFAKKESKKVFIAGHIPPGIDPFGDKGTPFWMENCTARYTNM---IVGKYSDIVAGQFFAHIHQDDFKLQMFNTSQHLTGSKTSFAL 397          
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Match: EDO46874 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNK9])

HSP 1 Score: 54.299 bits (129), Expect = 2.813e-7
Identity = 36/141 (25.53%), Postives = 73/141 (51.77%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPL-------NQFMWLKTKLRLARASMMKVFLVAHVSPG--AAESNPVKFHNFHPQFNQRFLKLIQD-YADVIDAGFFAHQHTDAFKIVYNSNNKKTVYNKNFII 913
            G +Y   +D    + +++ LN++ WY V+++  + SD          QF WL+ +L  A+    KV + +HV PG  +  +NP+   +     ++RF +L+   Y +V+ A  + H H D  ++     ++++V N++F +
Sbjct:  297 GGYY--KVDIAGGRMVLLALNSMYWY-VDAHSDSESDSTYIQTKAAQQFNWLEGQLEQAKQQGKKVIITSHVPPGIDSYSNNPLWLDD----ASRRFTELVAGRYHEVVAAQLYGHVHRDDIRLQAIQGDEESV-NRSFAL 429          
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Match: EDO31208 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SYL6])

HSP 1 Score: 50.8322 bits (120), Expect = 1.715e-6
Identity = 23/86 (26.74%), Postives = 43/86 (50.00%), Query Frame = 2
Query:  629 DPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNKK 886
            DP  Q  WL   L+ +  +  KV ++ H+ PG+++   +K       F+  +  +I  Y   + A FF H H+D F++ Y+   ++
Sbjct:  132 DPAGQLQWLVDTLQESEDNGEKVHIIGHIPPGSSDC--LK------AFSWNYYSIINRYQSTVTAQFFGHTHSDEFEVFYDEKTRR 209          
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Match: smpdl3b (sphingomyelin phosphodiesterase acid like 3B [Source:NCBI gene;Acc:101169562])

HSP 1 Score: 82.8037 bits (203), Expect = 6.447e-16
Identity = 45/119 (37.82%), Postives = 66/119 (55.46%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSN 877
            G +YT  +  +N  +M+ VLN  L+Y  N   +   DP +QF W    L  A A   KV+++ HV PG  E    K   F P++N+R+L LI+ +  VI   FF H HTD+F++ YN +
Sbjct:  173 GGYYTEKLLNRNGYRML-VLNTNLYYDQNQVTQNMDDPADQFNWADQILTEAAAIKEKVYIIGHVPPGFFEKKRSKPW-FAPKYNRRYLDLIEKHHSVILGQFFGHHHTDSFRMFYNKD 289          
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Match: smpdl3a (sphingomyelin phosphodiesterase acid like 3A [Source:NCBI gene;Acc:101171626])

HSP 1 Score: 62.7734 bits (151), Expect = 1.288e-9
Identity = 36/128 (28.12%), Postives = 59/128 (46.09%), Query Frame = 2
Query:  506 LQILPGCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAE--SNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNK 883
            L +  G FY+  +        ++ LN IL+Y  +   K  SDP  QF WL+  L  A  ++ K++++ HV  G      N       H   N+R + + + YA VI   F+ H H D+  ++ +   K
Sbjct:  179 LTLSEGGFYSQLV---KPGLRLVSLNTILYYGPDQVTKNMSDPAGQFQWLQETLESAAQNLEKIYIIGHVPVGYLPFVKNTTAIQKRH---NERLVSIFRKYAHVIAGHFYGHTHRDSIMVLLDQRGK 300          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000024647.1 (SMESG000024647.1)

HSP 1 Score: 251.136 bits (640), Expect = 6.698e-73
Identity = 119/124 (95.97%), Postives = 122/124 (98.39%), Query Frame = 2
Query:  521 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLRLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNKKTV 892
            GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKL+LARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNN+  +
Sbjct:  161 GCFYTHSIDTKNSKQMIIVLNAILWYQVNSYVKTNSDPLNQFMWLKTKLQLARASMMKVFLVAHVSPGAAESNPVKFHNFHPQFNQRFLKLIQDYADVIDAGFFAHQHTDAFKIVYNSNNEPVI 284          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 254.603 bits (649), Expect = 1.402e-68
Identity = 167/381 (43.83%), Postives = 218/381 (57.22%), Query Frame = 1
Query:  940 MVSNSNNNDQTPMSTIQTAMSNSQIPRSTIPASNGNDFAKVTSGTIWR*SH*IC*FHGR-LQYVSY--GL*MEPINYSTTVTII-------FKKAAREN*QQIDKRTMANDWTRFKDALVIQLKMRRYKSNNAAKILQ*SAKAR*VGK*ICISFNHSFRESF*I-----DKSKN*KTWERVFCKTNS*QE*K*EIKNTLYYVDFNIFNELIKQIMKI*LNLKTTQSKAESYAIIYKLREISMSPVRNNLLQKLTSLSPKFRVKSESRKPTSNSTEE-ERPIKCSHCQRIGQRINQFWFKSNFQRTSISVHCNHCQKREHSDYQCWSENNMQRSSRGKWPDRLKSNGGNSFNKIKINSQRNNGNVEC*NFV*KFHVSRNFFA 2034
            M SNSNNNDQTP+ST+ T +SN Q   + + A+  ND+A      + +       + G  +++V +     M    Y  + +I+        K AARE  QQIDKR +ANDWT+ KDAL  +L     K     K      +                +++F I     D +K  K   +    T   +E    IK  L YVDFN F+ELIK+ MKI LNLKTTQ KAES+  I + R+ S+SP++NNL QK TS SPKFRVK E RK T +  EE ERP++CSHCQ++G  INQ WFK+N  R+   V C+HCQ++ HS+ QCW +N  QRS    WPD LKSNGG SFNK+  NSQR N N++C N   + HVSRN FA
Sbjct:    1 MASNSNNNDQTPVSTVTTPVSNVQ---TNMSATLSNDYASCQKLPVQQ-------YGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKE----IKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGHSNSQCWFKNEEQRSPNRMWPDWLKSNGGKSFNKMSTNSQRINDNIQCYNCGKRGHVSRNCFA 367          

HSP 2 Score: 135.191 bits (339), Expect = 1.438e-31
Identity = 76/136 (55.88%), Postives = 90/136 (66.18%), Query Frame = 2
Query: 1055 QKLPVEQYGDDPIEFVDFMADYNMYPTAYRWSQSIIVQRLPLYLKKQQ----GRIDNRLTRELWQ--MTGRGSKMHW*YS*K*DDINRIMRQKFYNRVQKPDESVSEFAYHLTTLSEKAFEL--TKVKIKRHGKEF 1438
            QKLPV+QYG DP++FVDFMADY MY TAY WSQSI+VQRL L LK        +ID R     W        +K+         DI RIMRQKFYNRVQ+PDESVSEFAYHLTTL++KAFE+   +V + +  KE 
Sbjct:   39 QKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIG------GDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKEL 168          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 254.603 bits (649), Expect = 1.461e-68
Identity = 169/387 (43.67%), Postives = 222/387 (57.36%), Query Frame = 1
Query:  940 MVSNSNNNDQTPMSTIQTAMSNSQIPRSTIPASNGNDFAKVTSGTIWR*SH*IC*FHGR-LQYVSY--GL*MEPINYSTTVTII-------FKKAAREN*QQIDKRTMANDWTRFKDALVIQL------KMRRYKSNNAAKILQ*SAKAR*VGK*ICISFNHSFRESF*I-----DKSKN*KTWERVFCKTNS*QE*K*EIKNTLYYVDFNIFNELIKQIMKI*LNLKTTQSKAESYAIIYKLREISMSPVRNNLLQKLTSLSPKFRVKSESRKPTSNSTEE-ERPIKCSHCQRIGQRINQFWFKSNFQRTSISVHCNHCQKREHSDYQCWSENNMQRSSRGKWPDRLKSNGGNSFNKIKINSQRNNGNVEC*NFV*KFHVSRNFFA 2034
            M SNSNNNDQTP+ST+ T +SN Q   + + A+  ND+A      + +       + G  +++V +     M    Y  + +I+        K AARE  QQIDKR +ANDWT+ KDAL  +L      ++ R K  N  +    S                  +++F I     D +K  K   +    T   +E    IK  L YVDFN F+ELIK+ MKI LNLKTTQ KAES+  I + R+ S+SP++NNL QK TS SPKFRVK E RK T +  EE ERP++CSHCQ++G  INQ WFK+N  R+   V C+HCQ++ HS+ QCW +N  QRS    WPD LKSNGG SFNK+  NSQR N N++C N   + HVSRN FA
Sbjct:    1 MASNSNNNDQTPVSTVTTPVSNVQ---TNMSATLSNDYASCQKLPVQQ-------YGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSE------FAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKE----IKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGHSNSQCWFKNEEQRSPNRMWPDWLKSNGGKSFNKMSTNSQRINDNIQCYNCGKRGHVSRNCFA 367          

HSP 2 Score: 135.576 bits (340), Expect = 1.331e-31
Identity = 76/136 (55.88%), Postives = 90/136 (66.18%), Query Frame = 2
Query: 1055 QKLPVEQYGDDPIEFVDFMADYNMYPTAYRWSQSIIVQRLPLYLKKQQ----GRIDNRLTRELWQ--MTGRGSKMHW*YS*K*DDINRIMRQKFYNRVQKPDESVSEFAYHLTTLSEKAFEL--TKVKIKRHGKEF 1438
            QKLPV+QYG DP++FVDFMADY MY TAY WSQSI+VQRL L LK        +ID R     W        +K+         DI RIMRQKFYNRVQ+PDESVSEFAYHLTTL++KAFE+   +V + +  KE 
Sbjct:   39 QKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIG------GDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKEL 168          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000057446.1 (SMESG000057446.1)

HSP 1 Score: 254.218 bits (648), Expect = 1.519e-68
Identity = 169/387 (43.67%), Postives = 222/387 (57.36%), Query Frame = 1
Query:  940 MVSNSNNNDQTPMSTIQTAMSNSQIPRSTIPASNGNDFAKVTSGTIWR*SH*IC*FHGR-LQYVSY--GL*MEPINYSTTVTII-------FKKAAREN*QQIDKRTMANDWTRFKDALVIQL------KMRRYKSNNAAKILQ*SAKAR*VGK*ICISFNHSFRESF*I-----DKSKN*KTWERVFCKTNS*QE*K*EIKNTLYYVDFNIFNELIKQIMKI*LNLKTTQSKAESYAIIYKLREISMSPVRNNLLQKLTSLSPKFRVKSESRKPTSNSTEE-ERPIKCSHCQRIGQRINQFWFKSNFQRTSISVHCNHCQKREHSDYQCWSENNMQRSSRGKWPDRLKSNGGNSFNKIKINSQRNNGNVEC*NFV*KFHVSRNFFA 2034
            M SNSNNNDQTP+ST+ T +SN Q   + + A+  ND+A      + +       + G  +++V +     M    Y  + +I+        K AARE  QQIDKR +ANDWT+ KDAL  +L      ++ R K  N  +    S                  +++F I     D +K  K   +    T   +E    IK  L YVDFN F+ELIK+ MKI LNLKTTQ KAES+  I + R+ S+SP++NNL QK TS SPKFRVK E RK T +  EE ERP++CSHCQ++G  INQ WFK+N  R+   V C+HCQ++ HS+ QCW +N  QRS    WPD LKSNGG SFNK+  NSQR N N++C N   + HVSRN FA
Sbjct:    1 MASNSNNNDQTPVSTVTTPVSNVQ---TNMSATLSNDYASCQKLPVQQ-------YGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIGGDIKRIMRQKFYNRVQRPDESVSE------FAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKE----IKKALCYVDFNNFDELIKKTMKIELNLKTTQPKAESFTTIDESRDRSVSPIKNNLFQKSTSPSPKFRVKFEPRKSTCSPNEERERPVQCSHCQKLGHNINQCWFKNNSGRSPSPVQCDHCQRKGHSNSQCWFKNEEQRSPNRMWPDWLKSNGGKSFNKMSTNSQRINDNIQCYNCGKRGHVSRNCFA 367          

HSP 2 Score: 135.576 bits (340), Expect = 1.261e-31
Identity = 79/153 (51.63%), Postives = 96/153 (62.75%), Query Frame = 2
Query: 1055 QKLPVEQYGDDPIEFVDFMADYNMYPTAYRWSQSIIVQRLPLYLKKQQ----GRIDNRLTRELWQ--MTGRGSKMHW*YS*K*DDINRIMRQKFYNRVQKPDESVSEFAYHLTTLSEKAFEL--TKVKIKRHGKEFSARPILSRSKNKRSKTL 1489
            QKLPV+QYG DP++FVDFMADY MY TAY WSQSI+VQRL L LK        +ID R     W        +K+         DI RIMRQKFYNRVQ+PDESVSEFAYHLTTL++KAFE+   +V + +  KE      L+  + +  K L
Sbjct:   39 QKLPVQQYGGDPVKFVDFMADYYMYATAYGWSQSIMVQRLRLNLKGAAREAWQQIDKRFIANDWTKLKDALAAKLIG------GDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAKKAFEIKPEQVDVAKQMKELLQDQFLTGVRKEIKKAL 185          
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Match: SMESG000080881.1 (SMESG000080881.1)

HSP 1 Score: 145.976 bits (367), Expect = 8.046e-55
Identity = 83/153 (54.25%), Postives = 98/153 (64.05%), Query Frame = 2
Query: 1055 QKLPVEQYGDDPIEFVDFMADYNMYPTAYRWSQSIIVQRLPLYLKKQQ----GRIDNRLTRELWQ--MTGRGSKMHW*YS*K*DDINRIMRQKFYNRVQKPDESVSEFAYHLTTLSEKAFEL--TKVKIKRHGKEFSARPILSRSKNKRSKTL 1489
            QKLPV+QYG DP+EFVDF ADY MY TAY WSQSI+VQRLPLYLK        +ID RL    W        +K+         DI RIMRQKFYNRVQ+PDESVSEFAYHLTTL+EKAFE+   +V + +  KE      L+  + +  K L
Sbjct: 1570 QKLPVQQYGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIANDWTKLKDALAAKLIG------GDIKRIMRQKFYNRVQRPDESVSEFAYHLTTLAEKAFEIKPEQVDVVKQVKELLQDQFLTGVRKEIKKAL 1716          

HSP 2 Score: 89.3521 bits (220), Expect = 8.046e-55
Identity = 53/99 (53.54%), Postives = 66/99 (66.67%), Query Frame = 1
Query: 1474 EIKNTLYYVDFNIFNELIKQIMKI*LNLKTTQSKAESYAIIYKLREISMSPVRNNLLQKLTSLSPKFRVKSESRKPTS--NSTEEERPIKCSHCQRIGQ 1764
            EIK  L YVDFN F+ELIK+ MKI LNLKTTQ KAES+  I + R+ S+S ++NNL QK TS SPKFRVKS S  P+   +    +  I+C  C+  G 
Sbjct: 1711 EIKKALCYVDFNNFDELIKKAMKIELNLKTTQPKAESFTTIDESRDRSVSRIKNNLFQKSTSPSPKFRVKSPSTSPSPQRDRVNLQGRIQCHSCRGYGH 1809          

HSP 3 Score: 78.1814 bits (191), Expect = 4.191e-14
Identity = 55/144 (38.19%), Postives = 78/144 (54.17%), Query Frame = 1
Query:  877 QQENGVQQKFYNLRNKVQLETMVSNSNNNDQTPMSTIQTAMSNSQIPRSTIPASNGNDFAKVTSGTIWR*SH*IC*FHGR-LQYV----SYGL*MEPINYSTTVTI-----IFKKAAREN*QQIDKRTMANDWTRFKDALVIQL 1278
            ++E  VQ++FYNLRN+ Q E M SNS NNDQT +ST+ T +SN Q   S       ND+A      + +       + G  +++V     Y +      +S ++ +       K AARE  QQIDKR +ANDWT+ KDAL  +L
Sbjct: 1513 KREKVVQKRFYNLRNQKQSEIMASNSINNDQTLVSTVTTPVSNIQANMSA-----SNDYASCQKLPVQQ-------YGGDPVEFVDFKADYYMYATAYGWSQSIMVQRLPLYLKGAAREAWQQIDKRLIANDWTKLKDALAAKL 1644          
The following BLAST results are available for this feature:
BLAST of Metallophos domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SMPDL3B2.468e-1634.71sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3B8.246e-1535.04sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3B1.698e-1435.04sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
SMPDL3A9.119e-1231.54sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
SMPDL3A2.221e-1131.54sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ZK856.52.848e-1034.35pep chromosome:WBcel235:V:10186012:10190157:-1 gen... [more]
ZK856.52.848e-1034.35pep chromosome:WBcel235:V:10186023:10190366:-1 gen... [more]
ZK856.52.848e-1034.35pep chromosome:WBcel235:V:10186023:10190131:-1 gen... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG320524.312e-932.53gene:FBgn0044328 transcript:FBtr0347598[more]
CG320524.312e-932.53gene:FBgn0044328 transcript:FBtr0347599[more]
CG320524.312e-932.53gene:FBgn0044328 transcript:FBtr0332818[more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
smpdl3b9.300e-1637.50sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a2.538e-1131.48sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
smpdl3a1.603e-1032.58sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ak92.400e-1635.83adenylate kinase 9 [Source:Xenbase;Acc:XB-GENE-994... [more]
smpdl3a9.935e-1334.86sphingomyelin phosphodiesterase acid-like 3A [Sour... [more]
smpdl3a1.135e-1234.86sphingomyelin phosphodiesterase acid-like 3A [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Smpdl3b4.244e-1434.17sphingomyelin phosphodiesterase, acid-like 3B [Sou... [more]
Smpdl3a2.054e-929.03sphingomyelin phosphodiesterase, acid-like 3A [Sou... [more]
back to top
BLAST of Metallophos domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q92485|ASM3B_HUMAN8.154e-1435.04Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
sp|P58242|ASM3B_MOUSE2.969e-1334.17Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
sp|Q54SR8|SGMC_DICDI9.711e-1333.33Sphingomyelinase phosphodiesterase C OS=Dictyostel... [more]
sp|Q3ZC91|ASM3A_BOVIN3.993e-1131.75Acid sphingomyelinase-like phosphodiesterase 3a OS... [more]
sp|Q92484|ASM3A_HUMAN1.067e-1031.54Acid sphingomyelinase-like phosphodiesterase 3a OS... [more]
back to top
BLAST of Metallophos domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A0X3PCP83.258e-2240.17Metallophos domain-containing protein OS=Schistoce... [more]
A0A0V0JC011.290e-2040.17Acid sphingomyelinase-like phosphodiesterase 3b OS... [more]
A0A183T1781.832e-2040.17Metallophos domain-containing protein OS=Schistoce... [more]
A0A4S2LMK81.746e-1939.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A4S2LKV72.031e-1939.83Uncharacterized protein OS=Opisthorchis felineus O... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smpdl3b1.696e-1638.66sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a9.459e-1026.40sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
smpdl3b1.443e-638.24sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO469932.640e-724.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO468742.813e-725.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO312081.715e-626.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
smpdl3b6.447e-1637.82sphingomyelin phosphodiesterase acid like 3B [Sour... [more]
smpdl3a1.288e-928.13sphingomyelin phosphodiesterase acid like 3A [Sour... [more]
back to top
BLAST of Metallophos domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000024647.16.698e-7395.97SMESG000024647.1[more]
SMESG000057446.11.402e-6843.83SMESG000057446.1[more]
SMESG000057446.11.461e-6843.67SMESG000057446.1[more]
SMESG000057446.11.519e-6843.67SMESG000057446.1[more]
SMESG000080881.18.046e-5554.25SMESG000080881.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30015956 ID=SMED30015956|Name=Metallophos domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=3519bp
GGGGCAATATTTACGTCATATAATTAATTATAAATTCTCGGAATGTTCTT
TACTGTTGTCTAAGCATTTCGTTTTCATGATGATATGATTTTTCAGTGTT
GTTCGTATAAATTCTATGATCATCTGGTAAAACAAAATTCAGTATTGTTT
AGTACCTACTGATATGTTGATCACATGTAACTTATGATTTTTTCTCCCGA
TAGTATTTTTCCTTTTTACTTTCCATTCCAATTCTTTCAAACATATTTTT
GTTGTTAGCGTATCTACCATTATTGTATTTACGAGAAATAACATTTAGAC
TCATCTATATCAAATTCCTTTCAATTTCTACTCTCAGTTAAAACATCAAT
CCTTTCTTCGTTCTAATTTTTCTATTTTTTGTATTTAATGCTAAAATTGA
TTTTCTTAATATTTTTCAAGATCTCCCCCCCTTCTCTTTAAAAAATAATA
TTAGCCCAATTAGGAAATTACCGTTTATTGTGACATTAAATGACGTTTTT
ACTAACTTCAAATATTACCAGGTTGTTTTTACACCCATTCGATTGACACA
AAAAATTCCAAGCAAATGATAATTGTGCTAAACGCCATATTGTGGTACCA
AGTAAATTCCTATGTAAAGACTAACTCAGATCCGTTAAATCAGTTTATGT
GGTTGAAAACAAAGCTCCGACTCGCTAGGGCGAGTATGATGAAAGTATTC
CTTGTTGCTCATGTTTCCCCTGGTGCGGCAGAGTCAAATCCCGTAAAGTT
TCATAACTTCCATCCCCAATTTAATCAGAGATTTTTGAAACTCATTCAAG
ATTATGCGGATGTTATTGATGCGGGATTCTTTGCCCACCAGCATACAGAT
GCCTTCAAGATTGTATATAACTCTAACAACAAGAAAACGGTGTACAACAA
AAATTTTATAATTTGAGAAATAAAGTTCAATTGGAAACGATGGTTAGTAA
TTCAAATAACAATGATCAGACACCTATGTCGACTATTCAAACAGCTATGT
CTAATAGTCAAATACCTAGGTCTACTATTCCGGCAAGCAATGGCAATGAT
TTCGCAAAAGTTACCAGTGGAACAATATGGAGATGATCCCATTGAATTTG
TTGATTTCATGGCAGACTACAATATGTATCCTACGGCTTATAGATGGAGC
CAATCAATTATAGTACAACGGTTACCATTATATTTAAAAAAGCAGCAAGG
GAGAATTGACAACAGATTGACAAGAGAACTATGGCAAATGACTGGACGAG
GTTCAAAGATGCATTGGTAATACAGTTAAAAATGAGACGATATAAATCGA
ATAATGCGGCAAAAATTCTACAATAGAGTGCAAAAGCCAGATGAGTCGGT
AAGTGAATTTGCATATCATTTAACCACTCTTTCAGAGAAAGCTTTTGAAT
TGACAAAAGTAAAAATTAAAAGACATGGGAAAGAGTTTTCTGCAAGACCA
ATTCTTAGCAGGAGTAAAAATAAGAGATCAAAAACACTTTATATTATGTT
GACTTCAATATCTTCAACGAATTGATTAAACAGATCATGAAAATCTAATT
GAATTTAAAAACTACCCAATCAAAAGCAGAATCCTACGCAATTATCTATA
AACTAAGAGAAATATCAATGAGTCCTGTTCGAAATAATCTACTTCAAAAA
TTAACCAGCCTATCGCCTAAGTTCAGAGTGAAGTCTGAATCAAGAAAACC
AACTAGCAATTCCACTGAAGAAGAAAGGCCAATTAAGTGTAGTCATTGCC
AAAGAATTGGACAACGCATAAATCAATTCTGGTTTAAAAGTAATTTTCAA
AGAACTTCAATCTCAGTTCATTGTAATCATTGTCAAAAAAGAGAACACAG
CGATTACCAATGTTGGTCTGAAAATAATATGCAAAGAAGCTCAAGAGGGA
AGTGGCCAGATCGGTTGAAAAGTAATGGTGGAAACAGTTTCAACAAAATT
AAAATCAATAGTCAGCGAAATAATGGCAACGTAGAGTGTTGAAACTTTGT
TTAAAAATTTCATGTTTCACGAAATTTTTTTGCAAGATCAAGATCTCCAT
CAACGTCACTATCACCACAAAGAGAGTAAATGTTCAAGGTCCAATTCAAT
GTAACTCTTACAGAGGCTATGGACGCATTGCAAGATCGTAAGCGGCAATC
AAACTCACAATTTTCAGAATTTTAACTTAGCTAAATTTTCATTTTTAGAG
TCTTTAAATTTTAGTATTTGTACATTTTATGTTTTAGTTAATAAATTTTT
CTTATCATGGATGGTCGGTTATTACTTTATAATATATGGCAGGTCCTCCT
TAAAATCTTTTTATATGAATAACATTAGAACTTTAGTAGCTCGAAAGGTT
AGCTCAACTGAACATTTAATTTTGCCTGGTTGTAGCGCCAATTAGAAGTA
TCTCGATCCCTCAGTGGTCGCCATAAGTTGAGGCCTTGTCGCGCTTAACT
AGCAGGTGGATCTTTGTTGTTCCAAACGAGGCAATCGATGGAAATGTCGA
CTGGTGCGGTTTGAAATTAAAATATGTAAATGGCGTCATATGAGTTAGAG
AGGAAAATTATGACAAACCAAAAGATTTTTTTACTTCTTTTAAATTCTAT
GAGGGCAGAAGGGATAGATAAAGACAATTAATTCAAATCATATTTTTGCA
TTGATAGAGATATTTTGAGTATGTTGATATTAAATGGACAATAACTGCGG
TGAACGCAGGTAGGAAAACGTTGAATGTATTATCGGGGTCCCCTATTTTT
TGAATTTATTCTCGATGAAGTCAGGTAATTAATAATGCTTGTCATAAAAC
CCTAAAACATTGAAAAATAAATAAATCCCAAAATTAACTAATAAAAGACA
TTTAATTTCAACTCTACAAAAATTGTATTTTCACTTGTTGCCATCCTCAA
TTTGTTGGTATCACTGAGGGTCTAACAAAACCTCCTTTACAAGTCGCGCT
AACTAATCCTAACTCAAAGCCCGGAAAGAATCGCAGGCGCTGAAAGAAGT
GACTCGCCGAAAATATACTATTATTGGCCCAACTCTTTCAATAAATATCC
GAAGCAATTATATTAGAGTCCCAAAAACTGAGAACCGAAGCTCCAGTAAC
CTCTTCCGGAAATTCCACGACAGAAGATTCGAATTTGTCGTTAACTATGA
CGATCGATGTTGAGAATCTATCCATTATTTTTCCTCCTCATCAGCAGTTG
ACCATCAAAGAAAAGAATAAAAAATTGTCCAACCTCAAAGCGATCGATAT
CCCTCTGAACAGCATCGAACACATTCAAAGGCATAAGAATCTTCCCGCGG
ATATCGCCACCAGTGATAAAGAAACATATGGATTTAAGTGCCTAAAATCA
TCGGGAACTCAGAAACATTTCGTTTAACCAACTCAGGATCGCAGCGAAAT
GCACATTAACCTATCGATATCTATTGATCAATGTTAACTGTGTTTGTTTT
GTGTCTTTTGACGTGGAGGTATGAAACTGGATAAATCTCGTATATCTTAA
TAAAATTGTTTTTGTGGTT
back to top

protein sequence of SMED30015956-orf-1

>SMED30015956-orf-1 ID=SMED30015956-orf-1|Name=SMED30015956-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MIRHLCRLFKQLCLIVKYLGLLFRQAMAMISQKLPVEQYGDDPIEFVDFM
ADYNMYPTAYRWSQSIIVQRLPLYLKKQQGRIDNRLTRELWQMTGRGSKM
HW*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity